[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80708.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1adjA2.bssp"
#ERROR : Can't open dsspfile "1usyA.bssp"
#ERROR : Can't open dsspfile "1q1lA.bssp"
#ERROR : Can't open dsspfile "1wu7A2.bssp"
#ERROR : Can't open dsspfile "1z7mA1.bssp"
#ERROR : Can't open dsspfile "1c0aA3.bssp"
#ERROR : Can't open dsspfile "1asyA2.bssp"
#ERROR : Can't open dsspfile "1lmzA.bssp"
#ERROR : Can't open dsspfile "1h4qA2.bssp"
#ERROR : Can't open dsspfile "1n4kA1.bssp"
#ERROR : Can't open dsspfile "1serA2.bssp"
#ERROR : Can't open dsspfile "1b70A.bssp"
#ERROR : Can't open dsspfile "1gc5A.bssp"
#ERROR : Can't open dsspfile "1adjA1.bssp"
#ERROR : Can't open dsspfile "1wu7A1.bssp"
#ERROR : Can't open dsspfile "1httA1.bssp"
#ERROR : Can't open dsspfile "1evkA1.bssp"
#ERROR : Can't open dsspfile "1e1cB2.bssp"
#ERROR : Can't open dsspfile "1qe0A1.bssp"
#ERROR : Can't open dsspfile "1atiA2.bssp"
#ERROR : Can't open dsspfile "1g5hA1.bssp"
#ERROR : Can't open dsspfile "1v95A.bssp"
#ERROR : Can't open dsspfile "1evkA2.bssp"
#ERROR : Can't open dsspfile "1atiA1.bssp"

## Summary of PDB Search
:421
    9e-62 100%  1adjA2 [d.104.1.1] HISTIDYL-TRNA SYNTHETASE A:2 -- 325
    1e-48  19%  1usyA  [d.104.1.1] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    2e-42  16%  1q1lA  [d.258.1.1] CHORISMATE SYNTHASE
    5e-39  26%  1wu7A2 [d.104.1.1] HISTIDYL-TRNA SYNTHETASE A:3 -- 329
    9e-37  21%  1z7mA1 [d.104.1.1] ATP PHOSPHORIBOSYLTRANSFERASE REGULATORY SUBUNIT
    5e-31  16%  1c0aA3 [d.104.1.1] ASPARTYL TRNA SYNTHETASE A:107 -- 287 A:421 --
    1e-25  13%  1asyA2 [d.104.1.1] ASPARTYL-TRNA SYNTHETASE A:205 -- 557
    4e-25  14%  1lmzA  [a.96.1.4] 3-METHYLADENINE DNA GLYCOSYLASE I (TAG)
    1e-22  12%  1h4qA2 [d.104.1.1] PROLYL-TRNA SYNTHETASE A:5 -- 276
    2e-22  14%  1n4kA1 [a.118.22.1] INOSITOL 1,4,5-TRISPHOSPHATE RECEPTOR TYPE 1
    3e-20  15%  1serA2 [d.104.1.1] PROTEIN (SERYL-TRNA SYNTHETASE (E.C.6.1.1.11))
    2e-19  15%  1b70A  [d.104.1.1] PHENYLALANYL-TRNA SYNTHETASE
    1e-16   6%  1gc5A  [c.72.1.3] ADP-DEPENDENT GLUCOKINASE
    2e-15 100%  1adjA1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:326 -- 421
    4e-15  24%  1wu7A1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:330 -- 426
    6e-14  31%  1httA1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:326 -- 424
    1e-13  18%  1evkA1 [c.51.1.1] THREONYL-TRNA SYNTHETASE A:533 -- 642
    1e-12  13%  1e1cB2 [c.23.6.1] METHYLMALONYL-COA MUTASE BETA CHAIN B:476 -- 638
    2e-12  24%  1qe0A1 [c.51.1.1] HISTIDYL-TRNA SYNTHETASE A:326 -- 420
    5e-12  20%  1atiA2 [d.104.1.1] GLYCYL-TRNA SYNTHETASE A:1 -- 394
    6e-11  13%  1g5hA1 [c.51.1.1] MITOCHONDRIAL DNA POLYMERASE ACCESSORY SUBUNIT
    2e-09  12%  1v95A  [c.51.1.1] NUCLEAR RECEPTOR COACTIVATOR 5
    9e-08  23%  1evkA2 [d.104.1.1] THREONYL-TRNA SYNTHETASE A:242 -- 532
    2e-04  29%  1atiA1 [c.51.1.1] GLYCYL-TRNA SYNTHETASE A:395 -- 505
:421

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
1adjA2          -TARAVRGTKDLFGKELRMHQRIVATARKVLEAAGALELVTPIFEETQVFEKGVGAATDIVRKEMFTFQD
1usyA           ---------------------EKVFSFYSKATKKGFSPFFVPALEKAEEPAGNF-------------FLD
1q1lA           --------------------------SLRYLRFLTAGESHGKGLT---AILEGIPANLPLSEEEINHELR
1wu7A2          LQIEKIRGFRDFYPEDXDVEKFIFKTAEEAAEAFGFRRIDFPSLEYLDLYRIKSG---EELLQQTYSFVD
1z7mA1          -----PEESAEMTLNQVKSLRQIEGRLRKLFSLKNYQEVMPPSFEYTQLYTALESNGKTFNQEKMFQFIK
1c0aA3          LKYRYLDLRRPEMAQRLKTRAKITSLVRRFMDDHGFLDIETPMLT---------KATPEGARDYLVPSRV
1asyA2          LDYRVIDLRTVTNQAIFRIQAGVCELFREYLATKKFTEVHTPKLLGAPSEG-----------GSSVFEVT
1lmzA           ----------------------------------------------------------------------
1h4qA2          ---GPVRGTIVVRPYGYAIWENIQQVLDRMFKETGHQNAYFPLFIPMSFLRFS-----PELAVVTHAGGE
1n4kA1          ------AEVRDLDNDASKVLGSIAGKLEKGTITQNERRSVTKLLEDLVYFVTGGTNSGQDVLEVVFSKPN
1serA2          ------SRSYALKGDLALYELALLRFAMDFMARRGFLPMTLPSYAREKAFLGT-----GHFPAYRDQVWA
1b70A           -------GASLFSGGL-HPITLMERELVEIFRALGYQAVEGPEVESEFFNFDALNIPEHHPARDTFWLTG
1gc5A           PVFEGNKLKLVHPKDAIAEEEELIHYIYEFPRGFQVFDVQAPRENRFIANADDYN--ARVYMRREF----
1adjA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1atiA2          EIYGGLQGVYDYGPLGVELKNNLKQAWWRVYERDDMEGLDASVLTHRLVLHYTFADPMVDNWTPPRYFNM
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1evkA2          ----------------WTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLWEK--TGHWDNYKDAMFTT-S
1atiA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
1adjA2          RGGRSLTLRPEGTAAMVRAYLEHGMKVWPQPVRLWMAGPMFRAERPQKGRYRQFHQVNYEALGSENPILD
1usyA           RKGNLFSIREDFTKTVLNHRKRYSP---DSQIKVWYADFVYRYS---GSDLVAEYQLGLEKVPRNSLDDS
1q1lA           R--RQRGYGIEKDTAEILSGVRFGK----TLGSPIALFIRNRDWGGIKYNQRDLRNILERASARE-TAAR
1wu7A2          KGGREVTLIPEATPSTVRXVTSRKDL--QRPLRWYSFPKVWRYEEPQAGRYREHYQFNADIFGSDSPEAD
1z7mA1          HEGQSITLRYDFTLPLVRLYSQIKDS---TSARYSYFGKIFRKE-------KENYQIGIELFGESADKSE
1c0aA3          HKGKFYALPQSPQLFKQLLMMSG-------FDRYYQIVKCFRDEDLRADRQPEFTQIDVETSFMTAPQVR
1asyA2          YFKGKAYLAQSPQFNKQQLIVAD-------FERVYEIGPVFRAENSNTHRHTEFTGLDMEMAFEEHYHEV
1lmzA           --------------------------------------------------YIAYHD---NEWGVPETDSK
1h4qA2          ELEEPLAVRPTSETVIGYMWSKWIRSWRDLPQLLNQWGNVVRWEMRTRPRTSEFLWQEGHTAHATREEAE
1n4kA1          RERQKL-MREQNILKQIFKLLQAPFTHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQK-----Q
1serA2          IAETDLYLTGTAEVVLNALHSGEILPYEALPLRYAGYAPAFRSEAGSFGKDVRGLMRVHQFHKVEQYVLT
1b70A           EGFRRLLLRTHTSPMQVRYMVAHTP-----PFRIVVPGRVFRFEQTDATHEAVFHQLEGLVVGEGIAMAH
1gc5A           -----REGFEEITRNVELAIISG----LQVLKEYYPDGTTYKDVLDRVESHLNILNRYNVKSHFEFAYTA
1adjA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1atiA2          RGGRGLLLRPE-TAQGIFVNFKNVLDATSRGFGIAQIGKAFRNERNFIFRVREFEQMEIEYFVRPGEDEY
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1evkA2          SENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNESGSLHRVRGFTQDDAHIFCTEEQIRD
1atiA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLELNPMRILDSKS
1adjA2          AEAVVLLYECLKELGLRRLKVKLSSVGDPEDRARYNAYLREVLSPHREALSEDSKERLEENPMRILDSKS
1usyA           LEVLEIIVESASEFFEGPVIVEIGHTGPKDLHEKVLNLIDTKNLAEIEFLSHMKKIDLSRVEKIIEDSIY
1q1lA           VAVGAVCKKFLSEFGIKIGSF-VVSIGQKEVEELKDKSYFANP-----EKLLSYHEKAEDSELRIPFEKD
1wu7A2          AEVIALASSILDRLGLRKIXEEIIGGXTSSDPFSVFSIIDRYHKISREEFVDQLRSAGIGEDGVSXIADL
1z7mA1          LEILSLALQVIEQLGLNKTVFEIGSAKFFQRLCQLADGSTELLTKDLSGLNAFIEKNNFSKELRGLLKEI
1c0aA3          EVMEALVRHLWLEVKGVDL--------GDFPVMTFAEAERRYGSDKPDLRDESKWAPLWVIDFPMFEDDG
1asyA2          LDTLSELFVFIFSELPKRFAHEILPKDGKMVRLTYKEGIEMLRAAGKEIGDFEDLSENEKFLGKLVRDKY
1lmzA           KL--------FEMICLEGQQAGLSWITVLKKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGIIRHRG-
1h4qA2          EEVLSIYARLAREYAAIPVIEGLKTEKEKFAGAVYTTTIEALMKDGKALQAGTSHYLGENFARAFDIKFQ
1n4kA1          IGYDVLAEDTITAL--------------------------------------------------------
1serA2          EASLEASDRILRLLELPYRLVEVATGWRQVDIEVYLPSEGRYRETHSCSALLDWQARRANLRYRDPEGRV
1b70A           LKGAIYELAQALFGPDSKVRFQPVYFPFVEPGAQFAVWWPEGGKWLELGGAGMVHQAVDAYRERLGLPPA
1gc5A           NRRVRFTSVGLNEVELASIMEIIGDEELAKEVLEGHIFSVIDALMDETGIERIHFHTY------------
1adjA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1atiA2          RYWVEERLKWWQEMGLSRENLVPYQQ-PPESSAHYAKATVDI-----LYRFPHGSLELEGIAQR-TDFDL
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1evkA2          NGCIRLVYDMYSTFGFEKIVVKLSTIGSDEMWDRAEADLAVAL---------------------------
1atiA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           ERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQS
1adjA2          ERDQALLKELGVRPMLDFLGEEARAHLKEVERHLERLSVPYELEPALVRGLDYYVRTAFEVHHEEIGAQS
1usyA           RRSPEHLKTM-------DLPLSVREDLLSASSFLQEKTVSVEIDLTLARTIEEYCGLIFTIYDT--SSSR
1q1lA           EEFKTYIDEV--KEKGESLGG-----------------VFEVFALNVPPGLGSHIQWDRRIDGREIGEAA
1wu7A2          CSGTRGIDEXARITGKSSEEIARXAAVEDLLASY--GVKNVRYDFSIVRGLSYYTGIVFEAYD-RSGQFR
1z7mA1          FITNELSR---LENLVNTKDDVLISSFDQLKEFSEKLSMIKPIIIDLVPKMDYYTDLMFKAYS--SAANQ
1c0aA3          EGGLTAMHHPFTSPKDMTAAELKAAPENAVANAYDMVINGYEVGGGSVRIHNGD----MQQTVFGILGIN
1asyA2          DTDFYILD--KFPLEIRPFYTMPDPANPKYSNSYDFFMRGEEILSGAQRIHDH------ALLQERMKAHG
1lmzA           -KIQAIIG--NARAYLQM-----EQNGEPFADFVWSFVNHQPQMTQATTLSEIPTSTPASDASKALKKRG
1h4qA2          DRDLQVKYVHLSWRFIGAIIMT------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1serA2          RYAYTLNNTAL--ATPRILAMLLENHQLQ----DGRVRVPQALIPYMG----------------------
1b70A           YRGVTGFLGVERLAMLRYGIPDIRYFFGGRLKFLEQFKGVL-----------------------------
1gc5A           ----------------------------------------------------------------------
1adjA1          ----------------------------------------------------------------------
1wu7A1          ----------------------------------------------------------------------
1httA1          ----------------------------------------------------------------------
1evkA1          ----------------------------------------------------------------------
1e1cB2          ----------------------------------------------------------------------
1qe0A1          ----------------------------------------------------------------------
1atiA2          GSHTKDQEALGITARVLRN-EHSTQRLAYRDPETGKWFVPYVIEPSA-----------------------
1g5hA1          ----------------------------------------------------------------------
1v95A           ----------------------------------------------------------------------
1evkA2          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPEEKGPDLYLIPLTEEAVAEAFYLAEA
1adjA2          ALGGGGRYDGLSELLGGPRVPGVGFAFGVERVALALEAEGFGLPE-------------------------
1usyA           LVAAGGEYTVNGE-------KGVGGSIFLEGK--------------------------------------
1q1lA           RRFGSQVHDEIGWSEGKGYFRHSNNLGGTEGGITNGXPIVVRVAXKPIPTIVAVPA--------------
1wu7A2          AILGGGRYDNLASLXSGESVPAVGFGXGDAVISLLLKRENVQIP--------------------------
1z7mA1          PILSGGRYDQLLSNFQEE-AFAIGFCCHMDTILKALERQE------------------------------
1c0aA3          EEEQREKFGFLLDALKYGTPPHAGLAFGLDRLTMLLTGTD-NIRDVIAFPKTTAAACLMTEAPSFANPTA
1asyA2          LSPEDPGLKDYCDGFSYGCPPHAGGGIGLERVVMFYLDLK------------------------------
1lmzA           FKFVGT----------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
1adjA1          ---------------------------------------------EKGPDLYLIPLTEEAVAEAFYLAEA
1wu7A1          ------------------------------------------------KSVYICRVGKINSSIXNEYSRK
1httA1          ---------------------------------------------DPVVDIYLVASGADTQSAAMALAER
1evkA1          ------------------------------------------FPTWLAPQVVIMNITDSQSEYVNELTQK
1e1cB2          --------------------APARKGLAWHRDSEVFEQLMDRSTSVERPKVFLACLGTRRDFGGREGFSS
1qe0A1          ----------------------------------------------ENLDLFIVTMGDQADRYAVKLLNH
1atiA2          ----------------------------------------------------------------------
1g5hA1          -------------------------------------------------LDVGKGPTVELRQVCQGLLNE
1v95A           -------------------------------------------------DCSVIVVNKQTKDYAESVGRK
1evkA2          ----------------------------------------------------------------------
1atiA1          ----------------------------------------------------VIPLVKNRPEITEY-AKR


                         .         .         .         .         *         .         .:420
query           LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL
1adjA2          ----------------------------------------------------------------------
1usyA           ----------------------------------------------------------------------
1q1lA           ----------------------------------------------------------------------
1wu7A2          ----------------------------------------------------------------------
1z7mA1          ----------------------------------------------------------------------
1c0aA3          LAELIQVV--------------------------------------------------------------
1asyA2          ----------------------------------------------------------------------
1lmzA           ----------------------------------------------------------------------
1h4qA2          ----------------------------------------------------------------------
1n4kA1          ----------------------------------------------------------------------
1serA2          ----------------------------------------------------------------------
1b70A           ----------------------------------------------------------------------
1gc5A           ----------------------------------------------------------------------
1adjA1          LRPRLRAEYALAPRKPAKGLEEALKRGAAFAGFLGEDELRAGEVTLKRLATGEQVRLSREEVPGYLLQAL
1wu7A1          LRERXNVTVEIXERGLSAQLKYASAIGADFAVIFGERDLERGVVTIRNXYTGSQENVGLDSVVEHLISQA
1httA1          LRPGVKLMTNHGGGNFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLRTLL
1evkA1          LSNAIRVKADLRNEKIGFKIREHTLRRVPYMLVCGDKEVESGKVAVRTRRGKDLGSMDVNEVIEKLQQEI
1e1cB2          PVWHIDTPQ-VEGGTTAEIVEAFKKSGAQVADLCSSAKVYAQQG--------------------------
1qe0A1          LRHNIKADKDYLQRKIKGQMKQADRLGAKFTIVIGDQELENNKIDVKNMTTGESETIELDALVEYFKK--
1atiA2          ----------------------------------------------------------------------
1g5hA1          LLENISVWPGYSETSLEQLHSKYDEXSVLFSVLVTETTLENGLIQLRSRDTTXKEXXHISKLRDFLVKYL
1v95A           VRDLMVVDLIFLNTELSQALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQRNMPQADAMVLVARNY
1evkA2          ----------------------------------------------------------------------
1atiA1          LKARLLAVLYEDTGNIGKAYRRHDEVGTPFAVTVDYDTILKDTVTVRDRDTMEQIRLHVDELEGFLRERL


                         .         .         +         .         .         .         .:490
query           G
1adjA2          -
1usyA           -
1q1lA           -
1wu7A2          -
1z7mA1          -
1c0aA3          -
1asyA2          -
1lmzA           -
1h4qA2          -
1n4kA1          -
1serA2          -
1b70A           -
1gc5A           -
1adjA1          G
1wu7A1          -
1httA1          G
1evkA1          -
1e1cB2          -
1qe0A1          -
1atiA2          -
1g5hA1          -
1v95A           -
1evkA2          -
1atiA1          -