[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80739.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1l7vA.bssp"

## Summary of PDB Search
:342
    7e-24  23%  1l7vA  [f.22.1.1] VITAMIN B12 TRANSPORT SYSTEM PERMEASE PROTEIN
:342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIVTELRLPRXXXXXXXX
1l7vA           -----------------------------------------------------FVWQIRLPRTLAVLLVG


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXFQGLFRNPLADPYLMGSASGAAFAVTLFASLLGGLSPAFSQHAVFQHLPLSATFFGFXXXX
1l7vA           AALAISGAVXQALFENPLAEPGLLGVSNGAGVGLIAAVLLGQGQLPALGLCAIAGALIITLILLRFARRH


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXRXXXXXXXXXXXXXXXXXXXXYLMMQDADRVRAVFAYTLGNLAFAGWEGVRVXXXX
1l7vA           LSTSRLLLAGVALG------------IICSALXTWAIYFSTSVDLRQLXYWXXGGFGGVDWRQSWLXLAL


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXGRVLNALGLGEETARXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIIGFVGLVTPHLLRR
1l7vA           IPVLLWICCQ-SRPXNXLALGEISARQLGLPLWFWRNVLVAATGWXVGVSVALAGAIGFIGLVIPHILRL


                         .         *         .         .         .         .         +:350
query           LLGEDYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELPVGVVTTLLGGPFFLYLMWRxxxxx
1l7vA           CGLTDHRVLLPGCALAGASALLLADIVARLALAAAELPIGVVTATLGAPVFIWLLLK-----