[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80786.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1t6sA1.bssp"
#ERROR : Can't open dsspfile "1t6sA2.bssp"

## Summary of PDB Search
:177
    5e-10  29%  1t6sA1 [a.4.5.60] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 85
    9e-09  54%  1t6sA2 [a.4.5.60] CONSERVED HYPOTHETICAL PROTEIN A:86 -- 162
:177

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xEEAPSLKTLLLAVLFAAGRPVALKELRALGHPEEAVLRALKALERDLEAGHLGVALERVAGGWRLVVHP
1t6sA1          -EQRQQLLRSLEALIFSSEEPVNLQTLQITAHKFSELQEAVDELNRDYEATGRTFRIHAIAGGYRFLTEP
1t6sA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KALEAVERVLxxxxxxLSRAALEVLALVAYHQPVTRAELEAMRGKGVEGVLESLLERGLVRVVGEKEAPG
1t6sA1          EFADLVRQLL------------------------------------------------------------
1t6sA2          ----------------LSRSMLEVLAVVAWHQPVTKGEIQQIRGASPDYSIDRLLARGLIEVRGRADSPG


                         +         .         .         .         .         *         .:210
query           RPKLYGTTERFLEVFGLxxxxxxxxxxxxxxxxxxxx
1t6sA1          -------------------------------------
1t6sA2          RPLQYGTTEVFLDLFHL--------------------