[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80787.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1hruA.bssp"
#ERROR : Can't open dsspfile "1jcuA.bssp"
#ERROR : Can't open dsspfile "1k7jA.bssp"

## Summary of PDB Search
:195
    3e-41  34%  1hruA  [d.115.1.1] YRDC GENE PRODUCT
    2e-40  35%  1jcuA  [d.115.1.1] CONSERVED PROTEIN MTH1692
    1e-37  25%  1k7jA  [d.115.1.1] PROTEIN YCIO
:195

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxQEALAKAAETLKGGGLVAFPTDTVWGVLALMEDEAACKRIYEVKGRPEDKPLQVLVADLESALEL
1hruA           -----RDAIAAAIDVLNEERVIAYPTEAVFGVGCDPDSETAVXRLLELKQRPVDKGLILIAANYEQLKPY
1jcuA           ------DVLEEAISVMEGGGIVIYPTDTIYGLGVNALDEDAVRRLFRVKGRSPHKPVSICVSCVDEIPRF
1k7jA           -----QRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAXERICRIRQLPDGHNFTLXCRDLSELSTY


                         .         .         *         .         .         .         .:140
query           VDLGPLEGKFLRLAEAFWPGGLTVVVPGKAIPPWISKDGSVGLRMPDHALLRELLRRVGGHAAATSLNKS
1hruA           IDDTXLTDVQRETIFSRWPGPVTFVFPAPATPRWLTRFDSLAVRVTDHPLVVALCQAYGKPLVSTSANLS
1jcuA           SRPSGDA---MELMERILPGPYTVVLERELIPDVITGSSRVGIRVPDDEICRRIAA--RFPVTATSANIS
1k7jA           SFVDNVA---FRLXKNNTPGNYTFILKGKEVPRRLLQEKTIGXRVPSNPIAQALLEALGEPXLSTSLXLP


                         +         .         .         .         .         *         .:210
query           GEPPVRTEAEARTFAVDFVFPGEAGGLASSVVDLRTGEVLREGAIPKEALLAHLx
1hruA           GLPPCRTVDEVRAQAFPVVPETGGRLNPSEIRDALTGELFR--------------
1jcuA           GKPPSPRLEEIVLDAVDLVL--DAGMEPSTVIDLTVNPVLRRGKGPLDPVLLRG-
1k7jA           GSEFTESDPEEIKDRLEIIHGGYLGQKPTTVIDLTDDVVVREGVGDVKPFL----