[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80819.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1z6mA1.bssp"
#ERROR : Can't open dsspfile "2ajtA1.bssp"
#ERROR : Can't open dsspfile "1a2jA.bssp"
#ERROR : Can't open dsspfile "1v57A1.bssp"
#ERROR : Can't open dsspfile "1r4wA.bssp"
#ERROR : Can't open dsspfile "1eejA1.bssp"
#ERROR : Can't open dsspfile "1uc7A.bssp"
#ERROR : Can't open dsspfile "1a0rP.bssp"
#ERROR : Can't open dsspfile "1fo5A.bssp"
#ERROR : Can't open dsspfile "2dlxA1.bssp"
#ERROR : Can't open dsspfile "1aiuA.bssp"
#ERROR : Can't open dsspfile "1z5yE1.bssp"
#ERROR : Can't open dsspfile "2b5xA1.bssp"
#ERROR : Can't open dsspfile "1a8lA2.bssp"
#ERROR : Can't open dsspfile "1hyuA4.bssp"
#ERROR : Can't open dsspfile "1lu4A.bssp"
#ERROR : Can't open dsspfile "2b5eA1.bssp"

## Summary of PDB Search
:211
    4e-24  22%  1z6mA1 [c.47.1.13] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 172
    5e-21  11%  2ajtA1 [b.43.2.2] L-ARABINOSE ISOMERASE A:329 -- 498
    2e-17  14%  1a2jA  [c.47.1.13] DISULFIDE BOND FORMATION PROTEIN
    4e-08  15%  1v57A1 [c.47.1.9] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBG A:62 --
    1e-06  15%  1r4wA  [c.47.1.13] GLUTATHIONE S-TRANSFERASE, MITOCHONDRIAL
    2e-05  17%  1eejA1 [c.47.1.9] THIOL:DISULFIDE INTERCHANGE PROTEIN A:61 -- 216
    4e-05  13%  1uc7A  [c.47.1.1] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBD
    6e-05  16%  1a0rP  [c.47.1.6] PHOSDUCIN
    2e-04  18%  1fo5A  [c.47.1.1] THIOREDOXIN
    3e-04  14%  2dlxA1 [c.47.1.24] UBX DOMAIN-CONTAINING PROTEIN 7 A:1 -- 147
    3e-04  19%  1aiuA  [c.47.1.1] THIOREDOXIN
    3e-04  36%  1z5yE1 [c.47.1.10] THIOL:DISULFIDE INTERCHANGE PROTEIN DSBE E:49 --
    3e-04  12%  2b5xA1 [c.47.1.10] YKUV PROTEIN A:1 -- 143
    5e-04  24%  1a8lA2 [c.47.1.2] PROTEIN DISULFIDE OXIDOREDUCTASE A:120 -- 226
    7e-04  22%  1hyuA4 [c.47.1.2] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:103 --
    8e-04  15%  1lu4A  [c.47.1.10] SOLUBLE SECRETED ANTIGEN MPT53
    8e-04  21%  2b5eA1 [c.47.1.2] PROTEIN DISULFIDE-ISOMERASE A:365 -- 504
:211

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDPAEGARFALGREDAPVVVVDFSNYLCPHCQNHALNVLPR
1z6mA1          ------------------------------------GLHIGESNAPVKXIEFINVRCPYCR-KWFEESEE
2ajtA1          ---------------------------------------IAVEEKPILDVGIGGKDDPARLIFNTQTGPA
1a2jA           ------------------------------------TTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHIS
1v57A1          ---------------------------------QSHWLLDGKKDAPVIVYVFADPFCPYCKQF-WQQARP
1r4wA           ----------------------------------------------------------------------
1eejA1          -----------------------------LNALEKEMIVYKAPQEKHVITVFTDITCGYCHKL-HEQMAD
1uc7A           -----------------------------IKTVDELNQALVEAKGKPVMLDLYADWCVACKEFE-KYTFS
1a0rP           ----------------------------------------------TIVVHIYEDGIKGCDALN-SSLIC
1fo5A           ----------------------------------------------------------------------
2dlxA1          ----------------------------------------------------------------------
1aiuA           -----------------------------IESKTAFQEALDAAGDKLVVVDFSATWCGPCK-MIKPFFHS
1z5yE1          ----------------------------------------------------------------------
2b5xA1          ---------------------------------NGEVTREQLIGEKPTLIHFWSISCHLCKEA-MPQVNE
1a8lA2          ----------------------------------------------VRILVFVTPTCPYCPLAV-RMAHK
1hyuA4          ----------------------------------------------------------------------
1lu4A           ----------------------------------------------------------------------
2b5eA1          ----------------------------------------------DVLVLYYAPWCGHCK-RLAPTYQE


                         .         .         *         .         .         .         .:140
query           LKAEYIDTGKVRYLFRDFPFPGQANVIRXXXXXXXXXXQGRYYDYHEVLFRAAAGWGNLTGEALDRYLVD
1z6mA1          LLAQSVKSGKVERIIKLFDKEKESLQRGNVXHHYIDYSAPQALSALHKXFATQDEWGNLTLEEVATYALG
2ajtA1          IVASLIDLGDRYRLLVNCIDTVKTSLPKLPVANALWKAQPDLPTASEAWILAGGAHHTFSHALNLNDMRQ
1a2jA           DNVKKKLPEGVKMTKYHVNFMGGDLGKD---LTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRD
1v57A1          WVDSGKVQLRTLLVGVIKPESPATAAAI-----LASKDPAKTWQQYEASGGKLKLN--------------
1r4wA           ---------------------------------------EMLEKVSRELWMR--IWSRDEDITESQNILS
1eejA1          YNALGITVRYLAFPRQGLDSDAEKEMK----------------------------------AIWCAKDKN
1uc7A           DPQVQKALADTVLLQANVTANDAQDVALLKHLNVLGLPTILFFDGQGQEHPQARVTGFMDAETFSAHLRD
1a0rP           LAAEYPMVKFCKIKASNTGAGDRFSS--------------------------------------------
1fo5A           ----------------------------------------------------------------------
2dlxA1          ----------------------------------------------------------------------
1aiuA           LSEKYSNVIFLEVDVNDCQDVASECEVK------------------------------------------
1z5yE1          ----------------------------------------------------------------------
2b5xA1          FRDKYQDQLNVVAVHMPRSEDDLD----------------------------------------------
1a8lA2          FAIENTKAGKGKILG-------------------------------------------------------
1hyuA4          ----------------------------------------------------------------------
1lu4A           ----------------------------------------------------------------------
2b5eA1          LADTYANATSD-----------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LAGQIGLDEGAFAACLASGRHREEVLADQKLATDLGLTGTPTFFIAGEKHTGFLPYEEWKRLLDEALAKA
1z6mA1          LKEQKDAT---------------LVSAVIAEANAAHIQFVPTIIIGEYIFDESVTEEELRGYIEK-----
2ajtA1          FAEMHDIEITVIDNDTRLPAFKDALRWNEVYY--------------------------------------
1a2jA           VFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKQGMDTSNMDVFVQQYADTVKYL
1v57A1          ------------VPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSQQAVGLPDQKTLNIIMG------
1r4wA           AAEKAGMATAQAQHLLNKISTELKLRETTGAACKYGAFGLPTTVAHVDGKTYMLFGSDRMELLAYLLGEK
1eejA1          KAFDDVMAGKSVAPASCDVDIAD----HYALGVQLGVSGTPVVLSNGTLVPGYQPPKEMKEFLDEHQKMT
1uc7A           R---------------------------------------------------------------------
1a0rP           ----------------------------------------------------------------------
1fo5A           ---------------------------NPQKAMEYGIMAVPTIINGDVEFIGAPTKEALVEAIKKRL---
2dlxA1          ---------------------------GQRYIQFYKLGDFPYVSILDLVEWHQLDVSSFLDQVTGFLGEH
1aiuA           ----------------------------------------------------------------------
1z5yE1          ---------------------------DGMLGLDLGVYGAPTFLIDGNRHAGDLNPRVWEEEIKPLWEKY
2b5xA1          ----------------------------------------------------------------------
1a8lA2          ----------------------------------------------------------------------
1hyuA4          --------------------------TFQNEITERNVMGVPAVFVNGKFGQGRMTLTEIVAKVDTG----
1lu4A           --------------------------ADGVIWARYNVPWQPAFVFFVNNPTAAMSQDELSGRVAA-----
2b5eA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           E
1z6mA1          -
2ajtA1          -
1a2jA           S
1v57A1          -
1r4wA           -
1eejA1          -
1uc7A           -
1a0rP           -
1fo5A           -
2dlxA1          -
1aiuA           -
1z5yE1          S
2b5xA1          -
1a8lA2          -
1hyuA4          -
1lu4A           -
2b5eA1          -