[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80912.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sf2A.bssp"
#ERROR : Can't open dsspfile "1d7rA.bssp"
#ERROR : Can't open dsspfile "2cfbA1.bssp"
#ERROR : Can't open dsspfile "1gbnA.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1ohvA.bssp"
#ERROR : Can't open dsspfile "1vefA1.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "2gb3A1.bssp"
#ERROR : Can't open dsspfile "1wytB1.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "1v72A1.bssp"
#ERROR : Can't open dsspfile "1iugA.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "1h1cA.bssp"
#ERROR : Can't open dsspfile "1aupA2.bssp"
#ERROR : Can't open dsspfile "1h0cA.bssp"
#ERROR : Can't open dsspfile "1ax4A.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "2j85A1.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1aamA.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "2gmqA1.bssp"
#ERROR : Can't open dsspfile "1m32A.bssp"
#ERROR : Can't open dsspfile "1vk9A.bssp"
#ERROR : Can't open dsspfile "1bs0A.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "1f1rA2.bssp"
#ERROR : Can't open dsspfile "1yd9A1.bssp"
#ERROR : Can't open dsspfile "1lk9A.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "1q16A2.bssp"
#ERROR : Can't open dsspfile "1pixA3.bssp"
#ERROR : Can't open dsspfile "1jg8A.bssp"

## Summary of PDB Search
:427
    9e-57  25%  1sf2A  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    1e-52  22%  1d7rA  [c.67.1.4] PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE
    3e-47  43%  2cfbA1 [c.67.1.4] GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE A:19 --
    1e-39  22%  1gbnA  [c.67.1.4] ORNITHINE AMINOTRANSFERASE
    1e-36  20%  1dtyA  [c.67.1.4] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    8e-36  19%  1ohvA  [c.67.1.4] 4-AMINOBUTYRATE AMINOTRANSFERASE
    1e-34  25%  1vefA1 [c.67.1.4] ACETYLORNITHINE/ACETYL-LYSINE AMINOTRANSFERASE
    6e-31  10%  1b8gA  [c.67.1.4] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    3e-26  10%  1c7nA  [c.67.1.3] CYSTALYSIN
    7e-26   9%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    5e-25   9%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    5e-25  14%  2gb3A1 [c.67.1.1] ASPARTATE AMINOTRANSFERASE A:4 -- 392
    4e-23  16%  1wytB1 [c.67.1.7] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN) B:2
    1e-22  14%  1b5oA  [c.67.1.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    5e-22  14%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    1e-21  13%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    8e-21   9%  1d2fA  [c.67.1.3] MALY PROTEIN
    1e-20  12%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    1e-20  13%  1ecxA  [c.67.1.3] AMINOTRANSFERASE
    5e-20  15%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    3e-19  15%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    5e-19   9%  1bw0A  [c.67.1.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    8e-19  14%  1v72A1 [c.67.1.1] ALDOLASE A:6 -- 350
    1e-18  15%  1iugA  [c.67.1.3] PUTATIVE ASPARTATE AMINOTRANSFERASE
    6e-18  11%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
    6e-17  12%  1h1cA  [c.67.1.1] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    6e-17  14%  1aupA2 [c.58.1.1] NAD-SPECIFIC GLUTAMATE DEHYDROGENASE A:1 -- 192
    2e-16  12%  1h0cA  [c.67.1.3] ALANINE--GLYOXYLATE AMINOTRANSFERASE
    2e-16  17%  1ax4A  [c.67.1.2] TRYPTOPHANASE
    1e-15  13%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    2e-15  12%  2j85A1 [d.321.1.1] STIV B116 A:2 -- 116
    2e-15   9%  1c0nA  [c.67.1.3] PROTEIN (CSDB PROTEIN)
    3e-15  12%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    2e-12  14%  1aamA  [c.67.1.1] ASPARTATE AMINOTRANSFERASE
    9e-11   8%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    2e-09  11%  2gmqA1 [b.122.1.11] HYPOTHETICAL PROTEIN EF0006 A:12 -- 113
    9e-08  13%  1m32A  [c.67.1.3] 2-AMINOETHYLPHOSPHONATE-PYRUVATE
    4e-07   8%  1vk9A  [c.97.1.3] CONSERVED HYPOTHETICAL PROTEIN TM1506
    1e-06  18%  1bs0A  [c.67.1.4] PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)
    1e-06  16%  1qz9A  [c.67.1.3] KYNURENINASE
    3e-06  15%  1f1rA2 [d.32.1.3] HOMOPROTOCATECHUATE 2,3-DIOXYGENASE A:148 -- 323
    1e-05  16%  1yd9A1 [c.50.1.2] CORE HISTONE MACRO-H2A.1 A:6 -- 193
    1e-05  12%  1lk9A  [c.67.1.1] ALLIIN LYASE
    8e-05  13%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    4e-04  15%  1q16A2 [c.81.1.1] RESPIRATORY NITRATE REDUCTASE 1 ALPHA CHAIN A:1
    6e-04   7%  1pixA3 [c.14.1.4] GLUTACONYL-COA DECARBOXYLASE A SUBUNIT A:288 --
    7e-04  19%  1jg8A  [c.67.1.1] L-ALLO-THREONINE ALDOLASE
:427

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILG
1sf2A           --------NKELMQRRSQAIPRGVGQI---------HPIFADRAENCRVWDVEGREYLDFAGGIAVLNTG
1d7rA           ----------TFWRNARQHLVRYGGTF---------EPMIIERAKGSFVYDADGRAILDFTSGQMSAVLG
2cfbA1          -------------------------------------PIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVG
1gbnA           ------PTSDDIFEREYKYGAHNYHPL----------PVALERGKGIYLWDVEGRKYFDFLSSYSAVNQG
1dtyA           --------TTDDLAFDERHIWHPYTSMTSPLP-----VYPVVSAEGCELILSDGRRLVDGMSSWWAAIHG
1ohvA           ---------------MKTEVPGPRSRELMKIQNAEAFFCNYEESRGNYLVDVDGNRMLDLYSQISSIPIG
1vefA1          ------------LLEAEKTLDSGVYNKH---------DLLIVRGQGARVWDAEGNEYIDCVGGYGVANLG
1b8gA           -------------------LSRNATSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQLCFDLLESWLAK
1c7nA           -------------------------------------TKISRKNLGSLKWDLMYSQNPEVGNEVVPLSVA
3bc8A1          --------------EARRAHEH----LIRLLLEQGKCPED-GWDESTLELFLHELAVMDSNNFLGNCGVG
1pmmA           ---------KQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGRQNLATFCQT
2gb3A1          ------------------------SDRVLLTEE----SPIRKLVPFAEXAKKRGVRIHHLNIGQPD---L
1wytB1          ------------FERSRKGRRGLVKAVPKAEDLIEVPPRLPEVDELTLVRHYTGLSRRQVGVDTTFYPLG
1b5oA           -----------------------LSRRVQAMKP----SATVAVNAKALELRRQGVDLVALTAGEPDF---
1u08A           --------------------------PLIPQSKLPQLGT---TIFTQMSALAQQHQAINLSQGFPD---F
1fc4A           -------------------------------------ERIITSAQQADITVADGSHVINFCANNYL--GL
1d2fA           ---------------------------------------------------------------------F
1agxA           --------------------------------KVPVDALIKAVPQVNDLANITGIQALQVASES---ITD
1ecxA           -------------------------------------------------------VYFDN------NATT
2bwnA1          -------LDKAIQKLHDEGRY-------RTFIDIEREKGAFPKAQWNR-PDGGKQDITVWCGNDYLG--M
1lc5A           -------------------------------------AHGGNIREPATVLGISPDQLLDFSANINP---L
1bw0A           -----------------SNHAGLVFNPIRTSDNAKPSPPIIKLSVG----------------DPTLDKNL
1v72A1          --------------------------------------------------------------------IA
1iugA           ----------------------------------------------------------DWLLTPGP---V
1vp4A           -----------------KIGQNXKSSIIREILKFAADKDAISFGGGVPDPETFPRKELEIIEKEYHYTLQ
1h1cA           ----------------------------------------------AYPYETEKRDKTYLALNENPF---
1aupA2          ------------------------------------------------------SKYVDRVIA-EVEKKY
1h0cA           -----------------------------------------------------PKALLKPLSIPNQLLLG
1ax4A           ----------------------------------------------------------------------
1b9hA           ---------------------------------------------------------------------F
2j85A1          ----------------------------------------------------------------------
1c0nA           -------------------------------------VDAVRADFPVLSREVNGLPLAYLDSAA----SA
1mdoA           -------------------------------------------------------------------FLP
1aamA           ------------------------------FENITAAPADPILGLADLFRADERPGKINLGIGVYKDETG
2fn6A1          --------------------------------------------------------------------FA
2gmqA1          ----------------------------------------------------------------------
1m32A           --------------------------------------------------------YLL--LTPGPL---
1vk9A           ----------------------------------------------------------------------
1bs0A           ----------------------------------------------------------------------
1qz9A           ----------------------------------------------------------------------
1f1rA2          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1lk9A           ----------------------------------------------------------------------
2e7iA1          ----------------------------------------------------------------------
1q16A2          -----------------LSLIGGTCLSFYDWYCDLPPASPQTWGEQTDVPESADWYNSSYIIAWG-SNVP
1pixA3          ----------------------------------------------------------------------
1jg8A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           HAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTNRPYI
1sf2A           HLHPKVVAAVEAQLKKTCFQVLAYEPYLELCEIMNQKVPFAKKTLLVTTGSEAVENAVKIARAATKRSGT
1d7rA           HCHPEIVSVIGEYAGKHLFSGMLSRPVVDLATRANITPPGLDRALLLSTGAESNEAAIRMAKLVTGKYEI
2cfbA1          HAHPEVIDALHAALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKV
1gbnA           HCHPKIVNALKSQVDKLTSRAFYNNVLGEYEEYI-TKLFNYHKVLPMNTGVEAGETACKLARIQKYKAKI
1dtyA           YNHPQLNAAMKSAMSHVMFGEITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALKGEARDRF
1ohvA           YSHPALVKLVQQPQNVSLGILPPENFVEKLRESLLSVAPGMSQLITMACGSCSNENAFKTIFMWYRSKEI
1vefA1          HGNPEVVEAVKRQAETLMAQTLPTPMRGEFYRTLTAILPPLNRVFPVNSGTEANEAALKFARAHTGRKKF
1b8gA           NPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMFDPNHLVLTAGATSANETFIFCLADPGEA--V
1c7nA           DMEFKNPPELIEGLKKYLDETVLGYYKKTVKKWMKDRHQQTDWIINTAGVVPAVFNAVREFTKPG--DGV
3bc8A1          EREGRVASALVARRHYRFIHGIGRQITNSLVLNVIKLAHSVASCFVVPMATGMSLTLCFLTLRHKRPKAK
1pmmA           WDDENVHKLMDLSINKNWIDKEEAAIDLRCVNMVADLWNGQAVGTNTIGSSEACMLGGMAMKWRWRKRME
2gb3A1          KTPEVFFERIYENKPEVVYYSHSAELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDE
1wytB1          SCTMKYNPKLHEEAARLFADLHPYRLMWELGEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHEDRGV
1b5oA           DTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFVTPEETIVTVGGSQALFNLFQAILDPGDEVIV
1u08A           DGPRYLQERLAHHVAQGANQYAPMALREAIAQKTERLYGYQSDITVTAGATEALYAAITALVRNGDEVIC
1fc4A           ANHPDLIAAAKAGXDSHGFGXASVCGTQDSHKELEQKLAGXEDAILYSSCFDANGGLFETLLGAEDAIIS
1d2fA           ATAPCIIEALNQRLMHGVFGYSRWEFLAAIAHWFSTQHYTAIDSQTVVYGPSVIYMVSELIRQWSETGEG
1agxA           KELLSLARQVNDLVKKPSVNGHGTDTMEETAFFLNLVHTDKPITALSADGPLNLYSAVALASEAKNKGVM
1ecxA           RVDDRVLEEMIVFYREKYGNPNSALHMEKAREKVAKVLGSPSEIFFTSCATESINWILKVAETFEKRKRT
2bwnA1          GQHPVVLAAMHEALEAVGAGSGGTAYHRRLEAEIAGLHQ-KEAALVFSSAYNANDATLSTLRVL---FPG
1lc5A           GMPVSVKRALIDNLDCIERYPDAFHLHQALARHHQVPA---SWILAGNGETESIFTVASGLKPRR----A
1bw0A           LTSAAQIKKLKEAIDSQECNGYFPTVG--SPEAREAVATWWRNSFVHKEELKSTIVKDNVVLCSGGSHGI
1v72A1          GASPEVAQALVKHSSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLVPTGTAANALCLSAMTPPWG--NI
1iugA           RLHPKALEALARPQLHHRTEAAREVFL-KARGLLREAFRTGEVLILTGSGTLAMEALVKNLFAPGER--V
1vp4A           YSTTEGDPVLKQQILK------------LLERXYGITGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVL
1h1cA           PFPEDLVDEVFRRLNSDALRIYYDSPDEELIEKI-LSYLDTDFLSKNNVSVGNGADEIIYVXXLXFDRSV
1aupA2          ADEPEFVQTVEEVLSSLGVVDAHPEYEEVALLERMVIPERVIEFRVPWEDDNGKVHVNTGYRVQFNGAIG
1h0cA           NLPPRIMAAGGLQMIGSMSKDMY-QIMDEIKEGIQYVFRNPLTLVISGSGHCALEAALVNVLEPGDSF--
1ax4A           ---------------------AGSRNYYDLKDKAKELFNY-DYIIPAHQGRGAENILFPVLLKYKQKAKN
1b9hA           PAWPQYDDAERNGLVRALEWWRMGGDEVNSFEREFAAHHGAAHALAVTNGTHALELALQVMGVGPGT-EV
2j85A1          ----------------------------------------------------------------------
1c0nA           QKPSQVIDAEAEFYRHGYAAVHAGEKMENVRKRASLFINSAEELVFVRGTTEGINLVANSWGNSNVRANI
1mdoA           FSRPAXGAEELAAVKTVLDSGWTGPKNQELEAAFCRLTG-NQYAVAVSSATAGXHIALXALGIGEGDEVI
1aamA           KTLTSVKKAEQYLLENETTKNYLGIDELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRV
2fn6A1          YSEPCLDKEDKKAVLEVLNSKTQGKRSLLFEEALCEFLG-VKHALVFNSATSALLTLYRNFSEFSADRNE
2gmqA1          ---------IAIQEKDLTLQWRGN--TGKLVKVR-LKNTRAXEXWYNKQITEE------------NIQEI
1m32A           TTSRTVKEAXLFDSCTWDDDYNIGVVEQIRQQLTALASEGYTSVLLQGSGSYAVEAVLGSALGPQDK--V
1vk9A           ----------------------------------------------------------------------
1bs0A           ----------------------------------------------------------------------
1qz9A           ----------------------------------------------------------------------
1f1rA2          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1lk9A           ----------------------------------------------------------------------
2e7iA1          QTGGKLTEEARQALLEWP------PIHDFIHNQLPKFLG-CDVARVTNGAREAKFAVMHSLAKKDAW--V
1q16A2          QTRTPDAHFFTEVRYKGTKT-------VAVTPDYAEIAKLCDLWLAPKQGTDAAMGHVMLREFHLDNPSQ
1pixA3          ----------------------------------------------------------------------
1jg8A           KPTEEMRKAMAQA-EVGDDVYGEDPTINELERLAAETFGKEAAL-FVPSGTMGNQVSI---MAHTQRGDE


                         +         .         .         .         .         *         .:210
query           VKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPXXXXXXXXXXXXXIAAIIFEP
1sf2A           IAFSGAYHGRTHYTLALTGKVNPY--SAGMGLMPGHVYRALYPCPLHGIIHRIFKNDAAPEDIAAIVIEP
1d7rA           VGFAQSWHGMTGAAASAKGVGPAAVGSFAIPAPFTYRPRFERNGAYDYDYAFDLIDRQSSGNLAAFIAEP
2cfbA1          IKFEGCYHGHAATLTAPYNDLE----------------AVSRLFEQYPND------------IAGVILEP
1gbnA           VFAAGNFWGRTL-------SAISSSTDPTSYDGFGPFMPGFDIIPYNDL--PALERALQDPNVAAFMVEP
1dtyA           LTFRNGYHGDTFGAMSVCDPDNSMHSLPENLFAPAPQSRMDGEWDERDVGFARLMAAHRHEIAAVIIEPI
1ohvA           LSFMGAFHGRTMGCLATTHSKAIHKIDPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKVAGIIVEP
1vefA1          VAAMRGFSGRTMGSLSVTWEPKYREPFL----------PLVEPVEFIPYNDVEALKRAVDEETAAVILEP
1b8gA           LIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETALEEAYQ---------EAEKRNLRVKGVLVTN
1c7nA           IIITPVYYPFFMAIKNQERKIIECELLEKDGYYTIDFQKLEKLSKDK---------------NNKALLFC
3bc8A1          YIIWPRIDQKSCFKSMVTAG-------------FEPVVIENVLEGDELRTDLKAVEAKIQELGPEHILCL
1pmmA           AAGKPTDKPNL----VCGPVQICWHKFARYWDVELREIPMRPGQLFMDP---KRMIEACDENTIGVVPTF
2gb3A1          ILVLEPFYANYNAFAKIAGVKLIPVTRRXEEGFAIPQNLESFINE----------------RTKGIVLSN
1wytB1          VLVPDSAHGSNPATASMAGYQVREIPSGPEGEVDLEALKREL-----------------GPHVAALMLTN
1b5oA           LSPYWVSYPEMVRFA-----GG-------------VVVEVETLPEEGFVPDPERVRRAITPRTKALVVNS
1u08A           --FDPSYDSYAPAIAL-SGGIVKRMALQPPHFRVDWQEFAALLSE----------------RTRLVILNT
1fc4A           D---ALNHASIIDGVRLCKAKRYRYANN----------------DXQELEARLKEAREAGARHVLIATDG
1d2fA           VVIHTPAYDAFYKAIEGNQRTVMPVALEKQADGWFCDMGKLEAVLAKPE--------------CKIMLLC
1agxA           VLMNDSIFAARDVTKGINIHTHAFVSQWNSEFNIEKIQGDALPGVQIVYGSDNMMPDAYQAFAKAGVKAI
1ecxA           IITTPIEHKAVLETMKYLSMKGFKVKYVPVD--SRGVVKLEELEKLVDED------------TFLVSIMA
2bwnA1          LIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPAAPK----------------LIAFES
1lc5A           MIVTPGFAEYGRA--------------LAQSGCEIRRWSLR---EADGWQLTDAILEALTPDLDCLFLCT
1bw0A           LMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPE--NDWEADLDEIRRLKDDKTKLLIVTN
1v72A1          YCHPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKVG---------DVHTTQPACVSI
1iugA           LVPVYGKFSERFYEIALE-------------------AGLVVERLDYPYGDTPRPEDVAKEGYAGLLLVH
1vp4A           --DDPAYLGAINAFRQ-----------YLANFVVVPLEDDGXDLNVLERKLSEFDKNGKIKQVKFIYVVS
1h1cA           F-FPPTYSCYRI--------FAKAVGAKFLEVPLTKDLRIPEVNVGE---------------GDVVFIPN
1aupA2          PYLGGRFAPSVNLSIMKFLGFEQAFKD-SLTTLPMGGAKGGSDFDPNGKREVMRFCQAFMTELYRHIGPD
1h0cA           LVGANGIWGQRAVDIG-ERIGVHPMTKDPGGHYTLQEVEEGLAQH----------------KPVLLFLTH
1ax4A           PVFISNHFDTTAAHVELNGCKAINIVTEKAFD-SETYDDWKGDFDIKK--LKENIAQHGADNIVAIVSTV
1b9hA           IVPAFTFISSSQAAQR---LGAVTVPVDVDAATY-----------NLDP----------EAVAAAVTPRT
2j85A1          ----------------------------------------------------------------------
1c0nA           IISQMEHHANIVPWQMLCARV--------------GAELRVIPLNPDGTLQLETLPTLFDAATRLLAITH
1mdoA           T-PSXTWVSTLNXIVLLGANP-VXVDVDRDTLXVTPEHI-----------------------EAAITPQT
1aamA           WVSNPSWPNHKSVFNS-AGLEVREYAYYDAENHTLDFDALINSLNEAQAG-------------DVVLFHG
2fn6A1          IITTPISFVATANMLLESGYTPVFAGIKNDGNIDELALE------------------------KLINERT
2gmqA1          TTLNIIKNGKSLALE--VYPEKSIYVKPRINVPVF-----FIKTPINR----------------------
1m32A           LIVSNGAYGARXVEXAG-LXGIAHHAYDCGEVARPDVQAIDAILNADPT--------------ISHIAXV
1vk9A           -------------------------------------------VEKNLLRSALKIFEKKDLSLLAYSGRS
1bs0A           -----------------------------------------------------------------VVTEG
1qz9A           ----------------------------------------------------------------------
1f1rA2          --------------------------------------------------------------HDTALTGG
1yd9A1          ---------------------------------------------------------------LKSIAFP
1lk9A           ----------------------------------------------------------------------
2e7iA1          VMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKR---------------GEVVLA
1q16A2          Y-FTDYVRRYTDMPMLVMLEERDGYYAAGRMLRAAD----------------------------------
1pixA3          --------------------------------------------------------------PEYKAAGS
1jg8A           VILEADSHIFWY----EVGAMAVLSGV-MPHPVPGKNGAMDP----DDVRKAIRPRNIHFPRTSLIAIEN


                         .         .         .         +         .         .         .:280
query           VVGNAGVLVPTEDFLKALHEAREFGVLLIADEVMTGFRLAFGGATELLGLKPDXXXXXXXXXXXXXXXXX
1sf2A           VQGEGGFYASSPAFMQRLRACDEHGIMLIADEVQSGARTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGV
1d7rA           ILSSGGIIELPDGYMAALKRCEARGMLLILDEAQTGVRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAI
2cfbA1          VVGNAGFIPPDAGFLEGLRETKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAY
1gbnA           IQGEAGVVVPDPGYLMGVRECTRHQVLFIADEIQTGLRTGRWLAVDYENVRPDVLLGKALSGGLYPVSAV
1dtyA           VQGAGGMRMYHPEWLKRIRKCDREGILLIADEIATGFRTGKLFACEHAEIAPDLCLGKALTGGTMTLSAT
1ohvA           IQSEGGDNHASDDFFRKLRDSRKHGCAFLVDEVQTGGSTGKFWAHEHWGLDDPADVMTFSKKMMTGGFF-
1vefA1          VQGEGGVRPATPEFLRAAEITQEKGALLILDEIQTGMGRTGKFAFEHFGIVPDILTLAKALGGGVPLGVA
1b8gA           PSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDRNCDENSEVWQRVHVVY
1c7nA           SPHNPVGRVWKKDELQKIDIVLKSDLMLWSDEIHFDLIMPGYEHTVFQSIDEQLADKTITFTAPSKTFNI
3bc8A1          HSTTACFAPRVPDRLEELAVCANYDIPHVVNNAYGLQSSKCMIQQGARVGRIDAFVQSLDXNFMVPVGGA
1pmmA           GVTYTGNYEFPQDALDKFQADTGIDIDMHIDAASGGFLAPFVADFRLPRVKSISASGHKFGLAPLGCGWV
2gb3A1          PCNPTGVVYGKDEXRYLVEIAERHGLFLIVDEVYSEIVFR-GEFASALSIESDVVIDSVSXKFSACGARV
1wytB1          PNTLGLFERRILEISRL---CKEAGVQLYYDGANLNAIMGWLNLHKTFTVPHGGGGPGSGPVGVKAHLAP
1b5oA           PNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRI
1u08A           PHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHERAVAVSSFGKTYHMTGWKV
1fc4A           VFSXDGVIANLKGVCDL---ADKYDALVXVDDSHAVVGENGRGSHEYCDVXGDIITGTLGKALGGASGGY
1d2fA           SPQNPTGKVWTCDELEIMADCERHGVRVISDEIHMDMVWGEQPHIPWSNVARGDWALLTSGSKSFNIPAL
1agxA           IHAGTGNGSMANYLVPEVRKHDEQGLQIRSSRVAQGF---------------------------------
1ecxA           ANNEVGTIQPVEDVTRIVKK-KNKETLVHVDAVQ--TIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITY
2bwnA1          VYSMDGDFGPIKEICDIAEEF---GALTYIDEVHAVGMYGPRGVAERDGLMHRIDIFNGTLAXAYGVFGG
1lc5A           PNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPGLR
1bw0A           PSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFPRVILGGTAXNLVVPGWRLGWL
1v72A1          TQATEVGSIYTLDEIEAIGDCKSSSLGLHMDGSRFANALVSLGCSPAEMTWKALSFGATKNGVLAAEAIV
1iugA           SETSTGALADLPALAR-AFKEKNPEGLVGADMVTSLL--VGEVALEAMGVDAAASGSQXGLMCPPGLGFV
1vp4A           NFHNPAGVTTSLEKRKALEIAEKYDLFIVEDDRYEGETVDPIFKIGGPERVVLLNTFSKVLAPGLRIGXV
1h1cA           PNNPTGHVFEREEIERILKT----GAFVALDEAYYEFGESYVDFLKKYENLAVIRTFSKAFSLAAQRVGY
1aupA2          IDVPAGDLGVGAR---------------------------------------------------------
1h0cA           GESSTGVLQPLDGFGEL---CHRYKCLLLVDSVASLGGTPLYMDRQ--GIDILYSGSQKALNAPPGTSLI
1ax4A           TCNSAGGQPVSMSNLKEVYEAKQHGIFVVMDSAFIKARDPKYKNATIKEVIFDMSAKXDPLLNIGGLVAI
1b9hA           KVIMPVHMAGLMADMDALAKSADTGVPLLQDAAHAHGARWQGKRVGELSIATFSFQNGKLMTAGEGGAVV
2j85A1          ----------------------------------------------------------------------
1c0nA           VSNVLGTENPLAEM---ITLAHQHGAKVLVDGAQAVMHHPVVQALDCDFYVFSGHKLYGPTGIGILYVKE
1mdoA           KAIIPVHYAGAPADLDAIYAGERYGIPVIEDAAHATGTSYKGRHIGARGTAIFSFHAIKNITCAEGGIVV
1aamA           CCHNPTGIDPTLEQWQTLAQSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGL
2fn6A1          KAIVSVDYAGKSVEVESVQKCKKHSLSFLSDSSALGSEYQNKKVGGFALASVFSFHAIKPITTAEGGAVV
2gmqA1          ----------------------------------------------------------------------
1m32A           HSETTTGXL--NPIDEVGALAHRYGKTYIVDAXSSFGGIPXDI--AALHIDYLISSANKCIQGVPGFAFV
1vk9A           IFESKDS---GLKPVVELFKFDNLEGSLVIDKXVGKAAASFLLKXKPDHIHAKVISKPALKLXNEYGQSF
1bs0A           VFSMDGDSAP----LAEIQQTQQHNGWLMVDDAHTGVIGEQGGSCWLQKVKPELLVVTFGKGFGVSGAAV
1qz9A           ----------------------------------------------------------------------
1f1rA2          NGPRMHHVAFATHEKHNIIQIDKMGALRISDRIERGPRHGVSNAFYLYILDPDGHRIEIYTQDYYTGDPD
1yd9A1          SIGSGRNGFPKQTAAQLILKASSYMSSSIKTVYFVLF---------------------------------
1lk9A           ----------------------------------------------------------------------
2e7iA1          LITYPDGNYGNLPDVKKIAKVSEYDVPLLVNGAYAIGRMPV----SLKEIGADFIVGSGHKSMAASGPIG
1q16A2          ----------------------------------------------------------------------
1pixA3          VGIGGKLYRQGLVKMEFVTLCARDRLPIVWIQDTTGI---------------------------------
1jg8A           THNRSGGRVVPLENIKEICTAKEHGINVHIDG--------------------------------------


                         .         *         .         .         .         .         +:350
query           XXRREIMEKVAPLGPVYQAGTLSGNPXXXXXXXXXXXXXXXNPGYYRYLEDLGARLERGLKEVLAQKGIP
1sf2A           TGRAEVMDA---VAPGGLGGTYAGNP-IACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEI
1d7rA           VTSAAIEERAHELGYLFY-TTHVSDP-LPAAVGLRVLDVVQRDGLVARANVMGDRLRRGLLDLMERFDCI
2cfbA1          GGRAEIMKMVAPAGPTLSGNPLAM------TAGIKTLEILSRPGSYEHLDRITGKLVQGLLDAAREFGHE
1gbnA           LCDDDIMLT---IKPGEHGSTYGGNP-LGCRVAIAALEVLEEENLAENADKLGIILRNELMK--LPSDVV
1dtyA           LTTREVAETISDGEAFMHGPTFMGNP-LACAAANASLAILESGDWQQQVADIEVQLREQLAP-ARDAEMV
1ohvA           -----HKEEFRPNAPYRIFNTWLGDP-SKNLLLAEVINIIKREDLLSNAAHAGKVLLTGLLDLQARYPQF
1vefA1          VMREEVARS---MPKGGHGTTFGGNP-LAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPSPKIRE
1b8gA           SLSKDLGLPGFRVGAIYMSSFGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGIS
1c7nA           AGMGMSNPDIRERFTKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVNHPEI
3bc8A1          IIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRK-LLKERKEMFVYLSTQLKKLAEAHNER
1pmmA           IWRDEEALPGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFIC
2gb3A1          GCLITRNEELISHAXKLAQGRLAPPLLEQIGSVGLLNLDD--SFFDFVRETYRERVETVLKKLEEHGLKR
1wytB1          YLEEGFYLDFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEG--LKKAAALAVLNARYLKELLKEKGYR
1b5oA           GYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASRAFVEMAREAYRRRRDLLLEGLTALGLK
1u08A           GYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPE---HYLALPDFYRQKRDILVNALNESRLE
1fc4A           TAARKEVVEWLRQRSRPYLFSNSLAP----AIVAASIKVLEXVEAGSELRDRLWANARQFREQXSAAGFT
1d2fA           TGAYGINSSSRDAYLSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRIYLKDNLTYIADKMNAAFPE
1agxA           ----------------------------------------------------------------------
1ecxA           IRKGVPIRPLIHGGRGLRSGTQNVPGIVGAARAMEIAVEELSE-AAKHMEKLRSKLVSGLMN-LGAHIIT
2bwnA1          YIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRD-AQQMHAKVLKMRLKALGMP
1lc5A           LGYLVNSDDAAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLLTVYP
1bw0A           LYVDPHGNGPSFLEGLKRVMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIG-ECIGL
1v72A1          LFNTSLATEMSY-RRKRAGHLSSKMRFLSAQI-------------DAYLTD-DLWLRNARKANAAAQRLA
1iugA           ALSPRALERLKPRLKAQKEGESAWTPAINLVLAVAAVLEEVLPEEHLALKAWQNALLYGVGEE---GGLR
1vp4A           AGSKEFIRKIV---QAKQSADLCSPA----ITHRLAARYLERYDLLEQLKPTIELYRRKRTNALEEYFSD
1h1cA           VVASEKFID----AYNRVRLPFNVSYVSQXFAKVALDHREIFEERTKFIVEERERXKSALRE----XGYR
1aupA2          ----------------------------------------------------------------------
1h0cA           SFSDKAKKKMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTILENSWRQHREAAAY-LHGRLQALGLQ
1ax4A           RDNEEIFTLARQRCVPMEGFTYGGLAGRDMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLRE----AGIP
1b9hA           FPDGETEKYERDDRRYFHKIAGSNMRLNEFSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQG
2j85A1          -------------GKVFLTNAFSINXLKEFPTTITIDKLD-EEDFCLKLELRLEDGTL-----INAIGHD
1c0nA           ALLVSLSEGTTWTKAPWRFEAGTPNT-GGIIGLGAALEYVSALGLNNIAEYEQNLMHY-ALSQLESVPDL
1mdoA           TDNPQFADKLRSLKFHGLGVDQAEVLAPGYKYNLPDLNAAIALAQLQKLDALNARRAXADLPFQPLSLPS
1aamA           YNERTVDRAFSQMKAAIDANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLFVNTLQEKGAN
2fn6A1          TNDSELHEKMKLFRSHGMLKKGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPYFTPLH
2gmqA1          ----------------------------------------------------------------------
1m32A           IAREQKLAACKGHSRSLSLD-----LYAQWRCXEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQ
1vk9A           SYDEKIPFVLGKDGK--SXCPFEKLV--------------------------------------------
1bs0A           LCSSTVADYLLQFARHLIYST-SMPPAQAQALRASLAVIRSDEGDAR-REKLAALITR-FRAGVQDLPFT
1qz9A           ------------------------------------------ASLRRKSLALTDLFIELVEQRCAAHELT
1f1rA2          NPTITWDV------HDNQRRDWWGNP--------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1lk9A           --------------------------------------------GFKKLRERWVNITALLDQSDRFSYQE
2e7iA1          VMKEEWAEIVLRRSEKYKNKELGCTARGATIITLMASFPHVRERIKRWDEEVEKA--RRFAAEMEKLGIK
1q16A2          ----------------------------------------------------------------------
1pixA3          ----------------------------------------------------------------------
1jg8A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           HAVNRVGSMVTVFFTEGPVVTFQDAKRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHTEEDVEKTL
1sf2A           GDVRGLGAMIAIELFEDG-----DHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLPLTIEDAQIRQGL
1d7rA           GDVRGRGLLLGVEIVK-DRRTKEPADGLGAKITRECMLGLSMNIVQLPGMGGVFRIAPLTVSEDEIDLGL
2cfbA1          VCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIYLAPSQFEAGFTSLAHTEADIERTI
1gbnA           TAVRGKGLLNAIVIKE-----------TKDWDAWKVCLRLRDNGLLAKPTHGDIIRFPLVIKEDELRESI
1dtyA           ADVRVLGAIGVVETTHP-------------VNMAALQKFFVEQGVWIRPFGKLIYLPPYIILPQQLQRLT
1ohvA           ISRVRGRGTFCSFDT------------PDESIRNKLISIARNKGVMLGGCGDKSIRFRPVFRDHHAHLFL
1vefA1          V--RGMGLMVGLEL--------------KEKAAPYIARLEKEHRVLALQAGPTVIRFLPPIEKEDLERVV
1b8gA           CLNGNAGLFCWVDMRHLLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFALPERTLDLAM
1c7nA           KAPLIEGTYLQWID----FRALKMDHKAMEEFMIHKAQIFFDEGYIFGDGGIGFERINLAAPSSVIQESL
3bc8A1          LLQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLVSGARAVPLGNVQTVSGHTFRGFMAIGMKMQDVDLFI
1pmmA           TGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATIVVMRIMCRRGFEMDFAELLL
2gb3A1          FTKPSGAFYITAELPVEDAEEFARWXLTDFNXDGETTXVAPLRGFYLTPGLGKKEIIACVLEKDLLSRAI
1wytB1          VPYDGPSMHEFVAQPPEGFRALDLAKGLLE-------LGFHPPTVYFPLIVKEALMVEPTEAKETLEAFA
1b5oA           AVRPSGAFYVLMDTSP------------IAPDEVRAAERLLEAGVAVPGTDFAAFRLSYATSEENLRKAL
1u08A           ILPCEGTYFLLVDYSAVS---TLDDVEFCQWLTQEHGVAAIPLSVFCADPFPHKLILCFAKKESTLLAAA
1fc4A           LAGAD-HAIIPVXLGDA-------------VVAQKFARELQKEGIYVTGFFYPVVPKSAAHTPEQITRAV
1d2fA           LNWQIPQSTYLAWLD---LRPLNIDDNALQKALIEQEKVAIMPGYTYGEEGRGFVRLNAGCPRSKLEKGV
1agxA           ----------------------------------------------------------------------
1ecxA           PLEISLPNTLSVSFPNIRGSTLQNLLSGYGIYVSTHVLDAMGVDRRIAQGAIRISL-CKYNTEEEVDYFL
2bwnA1          I-IDHGSHIVPVVIGDPVHTK------------AVSDMLLSDYGVYVQPINFPTVTPSPVHDLKQIDGLV
1lc5A           G-----RANYLLLRCEREDIDLQ--RRLLTQRI------LIRSCANYPG--LDSRYYRVARSAAQNERLL
1bw0A           APTMPRGAMYLMSRIDLEKYRDIKTDV------EFFEKLLEEENVQVLPGTIFHARLTTTRPVEVYREAV
1v72A1          QGLEGLGGVEVLGGTEANILFC--------RLDSAMIDALLKAGFGFYHDRWGPNVVSFATTAEDVDHLL
1iugA           PVPKRFSPAVAAFYLP------------EGVPYARVKEAFAQRGAVIAGGQGPLKGLMGAYDRYEALGVA
1vp4A           IPGVKWVKSEGGLFIWLTLPEGFDTWEXFEYAKRKKVFYVPGRVFKVYDEPSPSXRLSFCPPDEKIVEGI
1h1cA           I-TDSRGNFVFVF--------------XEKEEKERLLEHLRTKNVAVRS--FREGVRITIGKREENDXIL
1aupA2          ----------------------------------------------------------------------
1h0cA           LFVKDPALRLPTVTTVAVPAGYDWRDIVS-YVIDHFDIEIMGGLGPSTGKVLRIGLLGCNATRENVDRVT
1ax4A           IQYPTGGHAVFV----------------------------------------------------------
1b9hA           GDVRADRNSHYMAMFRIPGLTEERRNALVDRLVEAGLP-AFAAFRAIYRTDAFWELGAPDESVDAIARRC
2j85A1          STINLVNTLCGTQLQKNRVEVKXNE---GDEALIIXISQRLEEGKVLSDKEIKDXYRQGKISFYEV----
1c0nA           TLYGPQARLGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLANTHEEVDRLV
1mdoA           WEHIHAWHLFIIRVDEARRDALXASLKTKGIGTGLHFRAAHTQKYYRERFPTLTLPDTEWNTESDFDRVI
1aamA           RDFSFIIKQNGMFSFSGL----------TKEQVLRL---REEFGVYAVAS---GRVNVAGMTPDNMAPLC
2fn6A1          PLLKSSNHLYPILMHQKFFTCKKLILESLHKILAQVHYKPIYQYQLYQQLFNTAPLCHANLNLESVQNIA
2gmqA1          ----------------------------------------------------------------------
1m32A           RYQQNQRSLVAGXRALGPIITAFYSPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSDNIGEVYAADITALL
1vk9A           ----------------------------------------------------------------------
1bs0A           LADS-----------CSAIQPLIDNSRA-----LQLAEKLRQQGCWVTAIRPPTVTLTAAHEMQDIDRLL
1qz9A           LVTPREHAKRGSHVSF------------EHPEGYAVIQALIDRGVIGDYRIMRFGFTPLYTTFTEVWDAV
1f1rA2          ----------------------------------------------------------------------
1yd9A1          ----------------------------------------------------------------------
1lk9A           LPQSEYCNYFRRMRPPSPSYAWVKCEWEEDKDCYQT---FQNGRINTQNVGFEASSLSLIKTQDDFDQLM
2e7iA1          QLGDNPHNHDLMFFHAEVLYEISKKAKGGRFFL---YRELKSRKIHGIKPGLTRYFKTYGLSDEEVDYVL
1q16A2          ----------------------------------------------------------------------
1pixA3          ----------------------------------------------------------------------
1jg8A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           EALGEAL
1sf2A           EIISQCF
1d7rA           SLLGQAI
2cfbA1          AAARTVL
1gbnA           EIINKTI
1dtyA           AAVNRAV
1ohvA           NIFSDIL
1vefA1          EAV----
1b8gA           QRLKAFV
1c7nA           ERLNKAL
3bc8A1          KRLDKCL
1pmmA           EDYKASL
2gb3A1          DVLXEGL
1wytB1          EAMGALL
1b5oA           ERFARVL
1u08A           ERLRQ--
1fc4A           EAFTRIG
1d2fA           AGLINAI
1agxA           -------
1ecxA           KKIEEIL
2bwnA1          HAMDL--
1lc5A           AALRNVL
1bw0A           ERIKAFC
1v72A1          NQVRLA-
1iugA           GMFREVL
1vp4A           KRLREVV
1h1cA           RELEV--
1aupA2          -------
1h0cA           EALRAAL
1ax4A           -------
1b9hA           PNTDAIS
2j85A1          -------
1c0nA           TGLQRIH
1mdoA           TALHQIA
1aamA           EAIVAVL
2fn6A1          HSVLKTF
2gmqA1          -------
1m32A           TAIRTA-
1vk9A           -------
1bs0A           EVLHGN-
1qz9A           QILGEIL
1f1rA2          -------
1yd9A1          -------
1lk9A           YYLKDMV
2e7iA1          NAFKEII
1q16A2          -------
1pixA3          -------
1jg8A           -------