[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS80932.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1pzxA.bssp"
#ERROR : Can't open dsspfile "1mgpA.bssp"

## Summary of PDB Search
:283
    5e-38  21%  1pzxA  [c.119.1.1] HYPOTHETICAL PROTEIN APC36103
    2e-26  23%  1mgpA  [c.119.1.1] HYPOTHETICAL PROTEIN TM841
:283

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxVAFVADSTLGLSPEEAKSLGIHVVPQQVLHRGRSFRDLVEIAPGEVLRLLCSGERLTTSQV
1pzxA           ---------IEIITDSGADLPQSYIREHRIAFLPLVVHWNGQDYKDGITIEPKQVYDAMRQGHTVKTAQP
1mgpA           ---------VKILVDSTADVPFSWXEKYDIDSIPLYVVEDGRSEPD--EREPEEIXRIREAGSVPKTSQP


                         .         .         *         .         .         .         .:140
query           APEDLRKLYEALLXXXXXXXXXXXXXXXXXXXDTAKKVAQAFGERVKXXXXXXXXXXXXXXXXXXXXXXX
1pzxA           SPLAMKELFLPYAKENRPCLYIAFSSKLSGTYQTAMAVRSELLDRLTIIDSKCASLGQGLAVMKAVELAK
1mgpA           SVEDFKKRYLKYKEEDYDVVLVLTLSSKLSGTNSAVLASKEVDIPVYVVDTLLASGAIPLPARVAREXLE


                         +         .         .         .         .         *         .:210
query           XXXXWEHLEEALAPYRERVRGYVLPATLDYLHRSGRIGGLQRFVGGLLRILPVLEVREGRVHPGPRVRGF
1pzxA           QNTPYNLLCETIESYCRHMEHIFTVDNLDYLARGGRISN----------IKPLLHVEDGALIPLEKWRGR
1mgpA           NGATIEEVLKKLDERXKNFKAIFYVSNFDYLVKGGRV---------LLKIRVCLHIENGELIPYRKVRGD


                         .         .         .         +         .         .         .:280
query           AEGIRKVAALFRRDFLEEARVYLAHAENPXXXXXXXXXXXXXXVEVLGALPAGAAVSVHTGPGTVAAFxx
1pzxA           KKVLKRMVELMRGDDLQKQTIGISHADDEALELKQMIEETHGCTRFF-LSDIGSAIGAHAGPGTIALF--
1mgpA           KKAIEALIEKLREDTPEKLRVIGVHADNEGVVELLNTLRKSYEVVDEIISPXGKVITTHVGPGTVG----


                         .         *         .         .         .         .         +:350
query           xxx
1pzxA           ---
1mgpA           ---