[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81022.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1qzwA2.bssp"
#ERROR : Can't open dsspfile "2ffhA2.bssp"
#ERROR : Can't open dsspfile "1mfqC.bssp"
#ERROR : Can't open dsspfile "1uf2A.bssp"
#ERROR : Can't open dsspfile "1f3uA.bssp"
#ERROR : Can't open dsspfile "1dulA.bssp"
#ERROR : Can't open dsspfile "1wruA2.bssp"
#ERROR : Can't open dsspfile "1wgwA.bssp"
#ERROR : Can't open dsspfile "1a82A.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1ffhA1.bssp"
#ERROR : Can't open dsspfile "1w36D1.bssp"
#ERROR : Can't open dsspfile "1j8mF1.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1gg4A4.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"
#ERROR : Can't open dsspfile "1ftsA1.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1f48A1.bssp"
#ERROR : Can't open dsspfile "1cp2A.bssp"
#ERROR : Can't open dsspfile "1o94D.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1g3qA.bssp"
#ERROR : Can't open dsspfile "2p67A1.bssp"
#ERROR : Can't open dsspfile "1g3uA.bssp"
#ERROR : Can't open dsspfile "1xm8A.bssp"

## Summary of PDB Search
:434
    1e-36  34%  1qzwA2 [a.36.1.1] SIGNAL RECOGNITION 54 KDA PROTEIN A:295 -- 432
    2e-36  83%  2ffhA2 [a.36.1.1] PROTEIN (FFH) A:319 -- 418
    9e-32  29%  1mfqC  [a.36.1.1] SIGNAL RECOGNITION PARTICLE 54KDA PROTEIN
    7e-28  12%  1uf2A  [e.28.1.2] CORE PROTEIN P3
    6e-25  19%  1f3uA  [b.65.1.1] TRANSCRIPTION INITIATION FACTOR IIF, BETA
    2e-21  45%  1dulA  [a.36.1.1] SIGNAL RECOGNITION PARTICLE PROTEIN (FIFTY-FOUR
    1e-20  11%  1wruA2 [b.106.1.1] 43 KDA TAIL PROTEIN A:3 -- 176
    4e-16  22%  1wgwA  [a.24.13.1] 'SIGNAL RECOGINITION PARTICLE 54
    4e-15  13%  1a82A  [c.37.1.10] DETHIOBIOTIN SYNTHETASE
    6e-15  80%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    4e-12  75%  1ffhA1 [a.24.13.1] FFH A:2 -- 88
    1e-11  19%  1w36D1 [c.37.1.19] EXODEOXYRIBONUCLEASE V ALPHA CHAIN D:2 -- 360
    2e-11  19%  1j8mF1 [a.24.13.1] SIGNAL RECOGNITION 54 KDA PROTEIN F:3 -- 86
    4e-10  16%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    3e-09  14%  1gg4A4 [c.72.2.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6- A:99
    4e-08  25%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586
    2e-07  16%  1ftsA1 [a.24.13.1] FTSY A:201 -- 284
    4e-07  28%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 --
    1e-06  21%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-06  28%  1f48A1 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:1 -- 296
    4e-05  28%  1cp2A  [c.37.1.10] NITROGENASE IRON PROTEIN
    5e-05  14%  1o94D  [c.26.2.3] ELECTRON TRANSFER FLAVOPROTEIN ALPHA-SUBUNIT
    6e-05  25%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    8e-05  32%  1g3qA  [c.37.1.10] CELL DIVISION INHIBITOR
    8e-05  17%  2p67A1 [c.37.1.10] LAO/AO TRANSPORT SYSTEM KINASE A:1 -- 327
    3e-04  24%  1g3uA  [c.37.1.1] THYMIDYLATE KINASE
    7e-04  17%  1xm8A  [d.157.1.2] GLYOXALASE II
:434

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xFQQLAARLQEAIDRLRGRGRITEEDLKGTLREIRRALIEADVNLXXXXXXXXXXXXXXLGRKVLESLTP
1qzwA2          ----------------------------------------------------------------------
2ffhA2          ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1uf2A           --------------------------------------------------------------TEEGGYSK
1f3uA           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
1wruA2          --------------------TVTLRADGRLFTGWTSVSVTRSIE---SVAGYFELGVNVPPGTDLSGLAP
1wgwA           ---DLGRKITSALRSLSNATIINEEVLNAMLKEVCTALLEADVNIKLVKQLRENVKSAIDLEEMASGLNK
1a82A           ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1ffhA1          -FQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVTRDFVERVREEALGKQVLESLTP
1w36D1          --VSEIGELQNWEECLLASQAVSRGDEPTPMILCGDRLYERTVARFFNEVNHAIEVDEALLAQTLDKLFP
1j8mF1          ----LLDNLRDTVRKFLTGSSSYDKAVEDFIKELQKSLISADVNVKLVFSLTNKIKERLKNEKPPTYIER
1eg7A           --------------------------------------------------------------ELARGLGI
1gg4A4          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1ftsA1          -LLKTKENLGSGFISLFRGKKIDDD----LFEELEEQLLIADVGVETTRKIITNLTEGASRKQL----RD
1bifA1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1f48A1          ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
1o94D           ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g3qA           ----------------------------------------------------------------------
2p67A1          -------------------------------------------------------------ATLAQAMTL
1g3uA           ----------------------------------------------------------------------
1xm8A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           AEVVLATVYEALKEALGGEPKHPQLKDRNVWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1qzwA2          ----------------------------------------------------------------------
2ffhA2          ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1uf2A           PPNVKKLMFSDFLSFLDSHKSDYRPPLLTVPITIGLNNLGETNSNTLRMRSEAIDEYFSSYVGAQILVPI
1f3uA           ---------------------------------------------------------------------A
1dulA           ----------------------------------------------------------------------
1wruA2          GKKFTLEIGGQIVCTGYID--SRRRQMTADSMKITVAGRDKTADLIDCAAVYSWKNRTLEQIARDLCAPY
1wgwA           RKMIQHAVFKELVKVKVYSGP-------------------------------------------------
1a82A           ----------------------------KRYFVTGTDEVGKTVASCALLQAAKAAGYRTAGYKPVASGSE
1ffhA2          ------------------EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPA
1ffhA1          AEVILATVYEALKEALGG----------------------------------------------------
1w36D1          VSDEINWQKVAAAVALTR----------RISVISGGPGTGKTTTVAKLLAALMADGERCRIRLAAPTGKA
1j8mF1          REWFIKIVYDELSNLFGG----------------------------------------------------
1eg7A           QEDEVELYGKYKAKISLDVYRRLKDKPLVTAITPTPAGEGKTTTSVGLTDALARLGKRVMVCLREPSLGP
1gg4A4          -------------------------------RVVALTGSGKTSVKEXTAAILSQCGNTLYTAGNLNNDIG
1f48A2          ------------------RPDIPSLSAHGLIMLMGKGGVGKTTMAAAIAVRLADMGFDVHLTTSDPAAHL
1ftsA1          AEALYGLLKEEMGEILAKVDE-------------------------------------------------
1bifA1          --------------------------------MVGLPARGKTYISKKLTRYLNFIGVPTREFNVGQYRRD
1yr6A1          -----------------------------IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKEL
1f48A1          -------------------------------FFTGKGGVGKTSISCATAIRLAEQGKRVLLVSTDPASNV
1cp2A           -------------------------------------GIGKSTTTQNLTSGLHAMGKTIMVVGCDPKADS
1o94D           ----------------------------------------------------------------------
1odfA           ------TVLDYTIEFLDKEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHLMGGEKSIGYASIDDFYLT
1g3qA           -------------------------------------GTGKTTVTANLSVALGDRGRKVLAVDGDLTMAN
2p67A1          VESRHPRHQALSTQLL--DAIMPYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSNDL
1g3uA           ----------------------------------GVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQS
1xm8A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AREQLRVLGEKVGVPVLEVQDGESPESIXXXXXXXXXXXXXXXXXXXTAGRLQIDERLMEELVRLKAALR
1qzwA2          ----------------------------------------------------------------------
2ffhA2          ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1uf2A           NVVDTRVYTSELRNFFGDVVIRDDPFDVWDGVKATYIPIGVHGVRLDPNGD-------------------
1f3uA           ERGELDLTGAKQNTGVWLVKVP--KYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNEDLANIHDIGA
1dulA           ----------------------------------------------------------------------
1wruA2          GVTVRWELSDKESSAAFPGF-TLDHSETVYEALVRASRARGVLMTSNAAGELVFS---------------
1wgwA           ----------------------------------------------------------------------
1a82A           KTPEGLRFAEPTSPHIISAQEGRPIESLVMSAGLRALEQQADWVLVEGAGGWFTPLSDTFTFADWVTQEQ
1ffhA2          AREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLG
1ffhA1          ----------------------------------------------------------------------
1w36D1          AARLTESLGKALRQLPLTDEQKKRIPEDASTLHRLLHAGNPLHLDVLEASMIDLPSRLIDALPDHRDQLA
1j8mF1          ----------------------------------------------------------------------
1eg7A           SF---GIKGGAAGGGYAQVVPMEDINLH------------------------------------------
1gg4A4          VPXTLLRLTPEYDYAVIEL-----GANHQGEIAWTVSLTRPEAALVNNLASL---AGVAKAKGEIFSGLP
1f48A2          NNLQVSRIDPHEETERY-----------------------------------------------------
1ftsA1          ----------------------------------------------------------------------
1bifA1          M---------------------------------------------------------------------
1yr6A1          PYEPSI----------------------------------------------------------------
1f48A1          GQVFSQTIGNTISVPGLSALE-------------------------------------------------
1cp2A           TRLLLGGLAQKSVLDTL-----------------------------------------------------
1o94D           -----------------------------------------------GSSIDFDPDVFEASVSALIAAHN
1odfA           HEDQLKL---------------------------------------------------------------
1g3qA           LSLVLGVDDPDVTL--------------------------------------------------------
2p67A1          ARAE------------------------------------------------------------------
1g3uA           VAADIA----------------------------------------------------------------
1xm8A           --------------------------------------------------------------------LH


                         .         .         .         +         .         .         .:280
query           PDEVLLVLDAMTGQEALSVAQAFDERVGVTGLVLTKLDGDARGGAALSARRVTGKPIYFAGVSERPEGLE
1qzwA2          ----------------------------------------------------------------------
2ffhA2          ----------------------------------------------------------------------
1mfqC           ----------------------------------------------------------------------
1uf2A           ----------------------------------------------------------------------
1f3uA           PREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRP-----------------------------
1dulA           ----------------------------------------------------------------------
1wruA2          ----------------------------------------------------------------------
1wgwA           ----------------------------------------------------------------------
1a82A           LPVILVVGVKLGCINHAMLTAIQHAGLTLAGWVANDVTPPGKRHAEYMTTLTRMIPAPLLGEI-------
1ffhA2          PDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGLEP------
1ffhA1          ----------------------------------------------------------------------
1w36D1          SVEAGAVLDICAYANAGFTAERARQLSRLTGTHVPAGTGTEAASLRDS----------------------
1j8mF1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1gg4A4          ENGI------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1ftsA1          ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1f48A1          ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
1o94D           PSVVLLPHSVDSLGYASSLASKTGYGFATDVYIV-----EYQGDELVATRGGYQKVNVEVDFPGKSTVVL
1odfA           ----------------------------------------------------------------------
1g3qA           ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------
1xm8A           DEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGGNLELKDRYGAKVIGSAMDKDRIPGID


                         .         *         .         .         .         .         +:350
query           PFYPDRLAGRILGMGDVATLAEKVRQAGLEAEAPKSAKELTLEDFLKQMQNLKRLGSFSELLKLLPGVGR
1qzwA2          --------------GDIESILEKVKGLEEYDKIQKKMEDVTLRDVYAQIIALRKMGPLSKVLQHIPGLGI
2ffhA2          --------------------------------------ELSLEDFLKQMQNLKRLGPFSEILGLLPGVPQ
1mfqC           --------------------------------------QFTLRDMYEQFQNIMKMGPFSQILGMIPGFNE
1uf2A           ----------------------------------------------------------------------
1f3uA           ----------------------------------------------------------------------
1dulA           ----------------------------------------------------------------------
1wruA2          ----------------------------------------------------------------------
1wgwA           ----------------------------------------------------------------------
1a82A           PWLAENPENAATGKYINLAL--------------------------------------------------
1ffhA2          -FYPERLAGRILGMG-------------------------------------------------------
1ffhA1          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1j8mF1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1gg4A4          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1ftsA1          ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1f48A1          ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
1o94D           TIRPSVFKPLEGAGSPVVSNVDA-----------------------------------------------
1odfA           ----------------------------------------------------------------------
1g3qA           ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------
1xm8A           MALKDGDKWMFAGHE-------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ALPQGFQVDERAFKRLEAIVLSMTPEERKDPRILNASRRRRIAKGSGTTVQEVNRLVKAFEETKALMKSL
1qzwA2          MLPTQLKIGEEKIRRWLAALNSMTYKELENPNIIDKSRMRRIAEGSGLEVEEVRELLEWYNNMNRLLKMV
2ffhA2          GL----KVDEKAIKRLEAIVLSMTPEERKDPRILNGSRRKRIAKGSGTSVQEVNRFIKAFEEMKALMKSL
1mfqC           ------QESMARLKKLMTIMDSMNDQELDSTDGAQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKM
1uf2A           ----------------------------------------------------------------------
1f3uA           ----------------------------------------------------------------------
1dulA           ------FLEQKVLVRXEAIINSXTXKERAKPEIIKGSRKRRIAAGSGXQVQDVNRLLKQFDDXQRXXK--
1wruA2          ----------------------------------------------------------------------
1wgwA           ----------------------------------------------------------------------
1a82A           ----------------------------------------------------------------------
1ffhA2          ----------------------------------------------------------------------
1ffhA1          ----------------------------------------------------------------------
1w36D1          ----------------------------------------------------------------------
1j8mF1          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1gg4A4          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1ftsA1          ----------------------------------------------------------------------
1bifA1          ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1f48A1          ----------------------------------------------------------------------
1cp2A           ----------------------------------------------------------------------
1o94D           ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1g3qA           ----------------------------------------------------------------------
2p67A1          ----------------------------------------------------------------------
1g3uA           ----------------------------------------------------------------------
1xm8A           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           ERRKxxxxxxxxxx
1qzwA2          --------------
2ffhA2          EK------------
1mfqC           GGIK----------
1uf2A           --------------
1f3uA           --------------
1dulA           --------------
1wruA2          --------------
1wgwA           --------------
1a82A           --------------
1ffhA2          --------------
1ffhA1          --------------
1w36D1          --------------
1j8mF1          --------------
1eg7A           --------------
1gg4A4          --------------
1f48A2          --------------
1ftsA1          --------------
1bifA1          --------------
1yr6A1          --------------
1f48A1          --------------
1cp2A           --------------
1o94D           --------------
1odfA           --------------
1g3qA           --------------
2p67A1          --------------
1g3uA           --------------
1xm8A           --------------