[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81141.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "2gk3A1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1oa8A.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1rkbA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1f2t.1.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "1yvuA2.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1o7d.2.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "1xkpA1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1mkyA1.bssp"
#ERROR : Can't open dsspfile "1gm5A1.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "3cddA1.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1g31A.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1bccF.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1xl3C1.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "1wz8A1.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1d8jA.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1v37A.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1iioA.bssp"
#ERROR : Can't open dsspfile "1puoA2.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1e6vC.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1zbsA1.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "2bsqE1.bssp"
#ERROR : Can't open dsspfile "1jqjA2.bssp"
#ERROR : Can't open dsspfile "1tf7A1.bssp"
#ERROR : Can't open dsspfile "1lnzA2.bssp"
#ERROR : Can't open dsspfile "2cxxA1.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"
#ERROR : Can't open dsspfile "1a2nA.bssp"

## Summary of PDB Search
:244
    1e-56  52%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    7e-47  20%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    6e-45  30%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    2e-42  20%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-39  27%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    5e-39  17%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    1e-35  12%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    2e-34  12%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    8e-34  12%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    4e-33   9%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    1e-32  26%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-32  10%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    2e-32  10%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    2e-32  12%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    7e-32  25%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    9e-32  13%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    2e-31   7%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    4e-31  10%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    5e-31   9%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    7e-31  10%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    2e-29  10%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    5e-29  14%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    4e-27  11%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    5e-27  12%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    5e-27  12%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    1e-26   9%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    4e-26   9%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    2e-25  10%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    6e-25  28%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-24  15%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    1e-24   9%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    1e-24  18%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    2e-24  10%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    4e-24   7%  2gk3A1 [c.23.16.9] PUTATIVE CYTOPLASMIC PROTEIN A:8 -- 253
    4e-24  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    1e-23  11%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    3e-23   8%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    3e-23  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    1e-22  16%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    2e-22  13%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    4e-22   9%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    5e-22  13%  1t3wA  [a.236.1.1] DNA PRIMASE
    6e-22  12%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    7e-22  13%  1oa8A  [b.145.1.1] ATAXIN-1
    8e-22  11%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    1e-21  14%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    2e-21  11%  1jbkA  [c.37.1.20] CLPB PROTEIN
    3e-21  10%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    3e-21   8%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    3e-21  12%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    4e-21  12%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    4e-21  12%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    7e-21  11%  1rkbA  [c.37.1.1] PROTEIN AD-004
    2e-20  10%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    2e-20  11%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    2e-20  12%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    3e-20  29%  1f2t.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    6e-20  11%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    7e-20  10%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    1e-19  16%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    4e-19  16%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    4e-19   9%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    4e-19  12%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    5e-19  12%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    6e-19  10%  1jb1A  [c.91.1.2] HPRK PROTEIN
    7e-19  10%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-18  14%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    2e-18  18%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    2e-18   8%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    3e-18   6%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    4e-18  11%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    9e-18  16%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    9e-18  11%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    1e-17   8%  1sbxA  [a.6.1.4] SKI ONCOGENE
    2e-17  18%  1yvuA2 [c.55.3.10] HYPOTHETICAL PROTEIN AQ_1447 A:315 -- 706
    2e-17   9%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    3e-17   8%  1o7d.2 [b.30.5.6] LYSOSOMAL ALPHA-MANNOSIDASE C:488 -- 585 D:603 --
    4e-17  15%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    4e-17  11%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    5e-17  15%  1g6oA  [c.37.1.11] CAG-ALPHA
    8e-17  11%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    9e-17  11%  1xkpA1 [a.243.1.3] PUTATIVE MEMBRANE-BOUND YOP TARGETING PROTEIN
    1e-16  12%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    1e-16  12%  1mkyA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGA A:2 -- 172
    2e-16  11%  1gm5A1 [a.24.21.1] RECG A:7 -- 105
    2e-16  13%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-16  10%  3cddA1 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:181 -- 348
    3e-16  11%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    3e-16  14%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    3e-16  10%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    4e-16  14%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    1e-15  17%  1g31A  [b.35.1.1] GP31
    1e-15   6%  1mi8A  [b.86.1.2] DNAB INTEIN
    2e-15  24%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    2e-15  11%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    7e-15  11%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    3e-14   9%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    3e-14  14%  1bccF  [f.27.1.1] UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
    4e-14  11%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    5e-14   7%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    5e-14  19%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    6e-14  20%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    1e-13  10%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    1e-13  13%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    1e-12  11%  1xl3C1 [a.243.1.1] PROTEIN TYPE A C:2 -- 92
    2e-12   8%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    4e-12  11%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    5e-12  15%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    6e-12  12%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    1e-11  17%  1wz8A1 [c.14.1.3] ENOYL-COA HYDRATASE A:2 -- 264
    1e-11  22%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    2e-11  11%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    2e-11  10%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    3e-11  19%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    7e-11  20%  1d8jA  [a.4.5.18] GENERAL TRANSCRIPTION FACTOR TFIIE-BETA
    1e-10  17%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    2e-10   8%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    4e-10  13%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    1e-09  15%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    2e-09  12%  1v37A  [c.60.1.1] PHOSPHOGLYCERATE MUTASE
    3e-09   7%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    5e-09  12%  1iioA  [a.39.4.1] CONSERVED HYPOTHETICAL PROTEIN MTH865
    1e-08   7%  1puoA2 [a.101.1.1] MAJOR ALLERGEN I POLYPEPTIDE, FUSED CHAIN 2, A:5
    2e-08  16%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    4e-08  20%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    5e-08  10%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    1e-07  12%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    1e-07   9%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    6e-07  13%  1e6vC  [d.58.31.1] METHYL-COENZYME M REDUCTASE I GAMMA SUBUNIT
    7e-07  10%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    9e-07  17%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    4e-06   6%  1zbsA1 [c.55.1.5] HYPOTHETICAL PROTEIN PG1100 A:108 -- 283
    2e-05   4%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    3e-05   6%  2bsqE1 [a.43.1.8] TRAFFICKING PROTEIN A E:2 -- 70
    6e-05  10%  1jqjA2 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:123 -- 244
    1e-04  15%  1tf7A1 [c.37.1.11] KAIC A:14 -- 255
    2e-04  32%  1lnzA2 [c.37.1.8] SPO0B-ASSOCIATED GTP-BINDING PROTEIN A:158 --
    2e-04  40%  2cxxA1 [c.37.1.8] PROBABLE GTP-BINDING PROTEIN ENGB A:2 -- 185
    4e-04  30%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
    5e-04  11%  1a2nA  [d.68.2.2] UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
:244

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEPIIRIRNLHKWFGPLHVLKGIHLEVAPGEKLVIIGPSGSGKSTLIRTINRLEDFQEGEVVVDGLNVKD
1b0uA           ---KLHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINL
1sgwA           ---KLEIRDLSVGYDK-PVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPI--
1ji0A           -DIVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITN
1q3hA           -ELLEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSF-
1l7vC           ------------------RLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXTS-GKGSIQFAGQPLEA
1e69A           ----MRLKKLY--LKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPP
1mukA           -------RARRHSYSSFSKLLEAYLLV-----KWRMCEAREPSVDLLPLCAGIDP-LNSDPFLKMVSVGP
1nijA1          ----------------------------PIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGEVS
1jjvA           -----------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPLDADVVAREVVAKD
1m3eA1          ------------------DAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNFGLGL
1vplA           ----VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNVVE
1e9rA           IVSGGKLKRMTREKAKQVTVAGVPMPRDAEPRHLLVGATGTGKSVLLRELAYTGLLRGDRMVIVD---PN
1urjA           ----TTGEALCRALLYLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSRVI
1khbA1          ------------WLAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKF
1pf4A1          VNGEVDVKDVTFTYKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRD
1ex6A           ------------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSST----T
1t06A           ----------------FKTVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQEL---A
1n25A           --------------VVYDFLKCMVYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNF
2gx8A1          ----------MKKVVVFVPVTHAEEVRKALGDAGAGHIGNYSHCTFSSEGTGTFVPQQLERVEEETIIPA
2yyeA2          --------------------------AQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALND
1bmfA3          APGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYVA
1ohcA1          --------------------------------------------------------PQDDVYLDITDRLC
1pv4A3          ----ILFENLTPLHANSRLVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLIPE
1jalA1          -----------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPD
1bgxT2          ----------------------------------------------MRGMLPLFEPKGRVLLVDG-----
1zs3A1          ----------------------------------------------------------------------
1s9hA           ---ILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFN
1qhlA           ----GKFRSLTLINWN--GFFARTFDL-DELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGV
1g6hA           --EILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITN
1bs2A1          ----------------------------------------------------------------------
2iqhA1          LYDKEEIRRIWRQALTHMMIWHSNLNDATYQRTRALVRTG-MDPRMCSLMQGSTLPRRSGAA--GAAVKG
1ffhA2          --------------------EARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVA-----
1mjgM           ETRGIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGK---IEVIGPDI
2gk3A1          ----------------------------------------------------------------------
1c4oA1          ----FRYRGPSPKGDQPKAIAGLVEALRDGERFVLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQ
1f46A           --------------------------------------------IIMNVAAHHGSELNGELLLNS-----
1kgdA           ----------------------------MRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPE
1tljA           ---------LVWEELREKALNKIYHDKEIGYLDPDILG------FLLAFYRNRNDVYTQSSCSGRITIVD
1xbtA1          -----------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDT
1mm8A           ----------------------------------------------------------------------
2v3jA1          ------------------APPVLTSKDKITKRXIVVLAXASLETHKIYVLLNCDD-HQGLLKKXGRDISE
1t3wA           ------------------------------------------KRTTXRILIGLQNPELATLVPPLENLDE
1dnpA2          ----------------------------------------------------------------------
1oa8A           ----------------------------------------------------------------------
1cd5A           -AGQVSFKHVVTFNMDEYVLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRS
1ni3A1          --------------------KVQWGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPEE
1jbkA           ----AEQGKLDPVIGRDEEIRRTILQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRVLA
1ak2A1          -----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVA
1j1zA2          ----------------------------------------------------------------------
1e6cA           ------------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSG
1udwA           -----------------------------PFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVL
1fl9A           LTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEE
1rkbA           ----------------------------LLPNILLTGTPGVGKTTLGKELASKSGLKYINV---GDLARE
2axpA1          --------------------------------IILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSG
1g8yA           ---THKPINILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAGKSMLALQLAAQIAGGP------------
1l3aA           ----------------------------------------------------------GYSIYKGKAALT
1f2t.1          ----------------------------------------------------------------------
1zp6A1          -----------------------------GNILLLSGHPGSGKSTIAEALANLPGVPKVHF-----HSDD
1esmA           --PLSRLLNFYISSNLVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDG
1viaA           ------------------------------KNIVFIGFXGSGKSTLARALAKDLDFLDSDFLIEQKFNQK
2vgmA3          ----------------------------------------------------------------------
1tmkA           ---------------------------GRGKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKFPERSTRI
1es6A2          ----------------------------------------------------------------------
1e3mA2          -KPGIRITEGRHQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVEI
1jb1A           -----------------RSXHGVLVDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADD----RVDVY
2qgmA1          ----------------------------------------------------------------------
1cr0A           --------SVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGL---AML
1dhyA1          ----------------------------------------------------------------------
2f9hA1          ----------------------------------------------------------------------
1poiA           -------------------KDAIAKYVHSGDHIALGGFTTDRKPAVFEILRQGITDLTGLGGAAGGDWDM
1grqA           -----------------------------TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAM
1atrA1          --------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIG
1np6A           -----------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHTHHE
1sbxA           ----------------------------------------------------------------------
1yvuA2          --------------------KGIKLKIK-GKSLILAQTREEAKEKLIPVINKIKDVD---LVIVFLEFLL
1lw7A2          ------------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFE-
1o7d.2          ----------------------------------------------------------------------
2gtlM1          HAIVTITAAHRKSFFPLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAPLKGQSEGYGVICGDDDHA
1i1qA           LTKVDRYSYVMHLVSRVELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRG-----------
1g6oA           ---FEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIE----DT
3cddA2          -EIVLKAGGKITKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIIKQGQACTVDIGGERVITGYVDDW
1xkpA1          ----------------------------------------------------------------------
1d6jA           -------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYRLDGDNI
1mkyA1          -------------------------------TVLIVGRPNVGKSTLFNKLVKDPVQDTVEWYGKTKLVDT
1gm5A1          ----------------------------------------------------------------------
1ii8.1          ------------------------------------------------------------------EKAK
3cddA1          ----------------------------------------------------------------------
1qhdA1          IKLSGIKFKRINFDNSSEYIENWNLQNRRQRTSVLADASETMLANVTS-VRQEYAIPVGPVFPPGMNWTD
1v47A1          ----------------------------------------------------------------------
1f8xA           ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1g31A           ----------------------------------------------------------------------
1mi8A           -GKRVSIKDLLDEKDFEIWAINEQTMKLESAKVSRVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWK
2fggA1          ----------------------------------------------------------------------
2ancF1          -----------------------------GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATG
1ckvA           ----AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPWIKANGKI-
1l7lA           ----------------------VLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQ
1bccF           ----------------------------------------------------------------------
1em8A           ----------------------------------------------------------------------
1afrA           ---------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPD-----
1uouA3          ----------------------------------------------------------------------
2gujA1          --------------------------------------VKKGSDPYFTLQAVLDDQSSGRVTLYDVNF-D
1vhhA           ----------------------------------------------------------------------
1yj5A2          --------------------------LSPNPEVVVVGFPGAGKSTFIQEHLVSAGYVHVNRDTLGSWQRC
1xl3C1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1ovmA2          LDHVIDSPDICWVGCALNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVG---AP
1ckeA           ---------------------------AIAPVITIDGPSGAGKGTLCKAMAEWHLLDSGAILHHHVDVAS
1t9hA2          EDYRNIGYDVYLTSSKDQDSLADIIPHFQDKTTVFAGQSGVGKSSLLNAISPTRHVESGGLVADTPGFSS
1wz8A1          ----------------------------------------------------------------------
1w1wA           ------------------------VGFGESNFTSIIGPNGSGKSNMMDAISVLKDYQKGLVELMRIISRN
1iqrA2          ----------------------------------------------------------------------
1yr6A1          --------------------------------VVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVK
1dwmA           ----------------------------------------------------------------------
1d8jA           ----------------------------------------------------------------------
1j90A           --------------------------------VLIEGNIGSGKTTYLNHFEKYKNDICTEPVEKWRNVNG
1b77A2          -------------------VASVITEIKAEDLQQLLR-----VSRGLQIDTIAITNKDGKIVINGYNKVE
2vnuD1          -KVRIRTRRAAELLDKRIVISITTHKYPLGHFVRDLGTIESAQAETEALLLEHD----------------
1q3tA           -----------------------------TIQIAIDGPASSGKSTVAKIIAKDFGFTTYMALKNQLGVEE
1v37A           ----------------------------------------------------------------------
1g8fA3          --------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNN
1iioA           ----------------------------------------------------------------------
1puoA2          ----------------------------------------------------------------------
1tueA           WRPIVQLRYQQIEFITLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFWL
2je6I3          ---------------------GIVIDIMPVKVPRVIGKNKSMYETLTSK--SIFVANNGRIWAFSEEI-L
1jqjA3          ------------------KFRGVRLYVSENQLKITANNPEQEEAEEILDV-----------TYSGAEMEI
1l1oA           --------------LPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKM--FILSDGEGKNGTIELMEPLD
1e2hA           ---------------------------PTLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRGASET
1e6vC           ----------------------------------------------------------------------
1heiB1          ----------------------PPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVGSPIT
1odfA           ----------------------------------FSGPQGSGKSFTSIQINHLMEKYGGEKSIGYASIDD
1zbsA1          ----------------------------------------------------------------------
1pgsA2          --------------------------EKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINN---AN
2bsqE1          ----------------------------------------------------------------------
1jqjA2          ----------------------------------------------------------------------
1tf7A1          --------------------------LPIGRSTLVSGTSGTGKTLFSIQFLYNGIIEFDEPGVFVTFEET
1lnzA2          -------------------------------DVGLVGFPSVGKSTLLSVV--------------------
2cxxA1          -------------------------------TIIFAGRSNVGKSTLIYRLT-------------------
1tpzA           --------------------------------VAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTM
1a2nA           ----------------MKLLSQLGAKVERNGSVHIDARDVTMRASIWALGPLVARFGQGQVSLPGIGARP


                         .         .         *         .         .         .         .:140
query           DRALREVRREVGMVFQQFNLFPHMTVLENVTLAPMRVRRWPRXXXXXXXXXXXXRVGILDQARKYPAQLS
1b0uA           VNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERALKYLAKVGIDERAQKYPVHLS
1sgwA           ----TKVKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDAL----ESVEVLDLKKKLGELS
1ji0A           KPAHVINRXGIALVPEGRRIFPELTVYENLXXGAYN-RKDKEGIKRDLEWIFSLFPRLKERLKQLGGTLS
1q3hA           -----------CSQFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDITKFAEQDNTVLGEGGVTLS
1l7vC           WSA-TKLALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAG------ALALDDKLGRSTNQLS
1e69A           AKDIRDRFAGTGLGVDFYSIVGIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIRKPGRRDQKLSLLS
1mukA           M--LQSTRKYFAQTLFMAKTVSGLNAIDSALLRLRTLGADKKALTAQLL-----MVGLQESADALAGKIM
1nijA1          VDD-QLIGDRATQIKTLTNGCICCSRSNELEDALLDL-----LDNLDKGNIQFDRLVIECTGMADPGPII
1jjvA           SPL----LSKIVEHFGAQILNRAALRERVFNHDEDKLWLNN--------------LLHPAIRERMKQKLA
1m3eA1          LLQSKQIKRXISSYVGENAEFERQYLAGELEVELQGTLAERIRAGGAGVPAFYTSTGYGTLVQEGGSPIK
1vplA           EPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSEIEEMVERATE---IAGLGEKIKDRVSTYS
1e9rA           GDMLSKFGRDKDIILNPYDQRTKGWSFFNE-IRNDYDWQRYALSVVPRGKTDEAEEWASYGRLLLRETAK
1urjA           AENANHRSIGEKFTYPLPFFNRPLNRLLFEAVVSRNVDAVARAAAHLAFDENHEGAALPADITFTAFAGG
1khbA1          DA--QGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYGIDEPLASGVTITSWK
1pf4A1          YKLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMPQGLDTVIGENGTSLS
1ex6A           RTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIE-WAQFSGNYYGSTVASVKQVSKSGKTCILDIDMQGVKS
1t06A           EELYATGNYDAMYFAGIIADPKAMSESDFDRWIDGAYFYMLS---DYVVAVTLSESNIAQDVADKWIASG
1n25A           ELVVFEDVKGTGGESRDLPSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVTNEYSVPKTLQ
2gx8A1          SLQRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQEEMTLGQF----AEHVKQSLDVKGARVV
2yyeA2          KSLDATACTDVTGFGLL-GHAWNICKNSNIGA-RIFFEKVPYYQLSENLVKKKIKGAIENLNFVKNYLKS
1bmfA3          IGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYFRDNGKHALIIYDDLSKQA
1ohcA1          FAILSRPKSASNVHYFSIDELEYENFYADFGPLNLAMVYRYCCKINKKLK----SITMLR--KKIVHFTG
1pv4A3          EVTEXQRLVKGEVVASTFDEPASRHVQVAEXVIEKAKRLV---------------EHKKDVIILLDSITR
1jalA1          PR--LDALAEIVKPERILPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVVRCFENIDPLDDI
1bgxT2          ----------HHLAYRTFHALKGLTTSRGEPVGFAKSLLKALKEDGDAVIVVFDAKAPSFRHEAYGGYKA
1zs3A1          ----------KAEIDHHKPTAGAMLVLSNLFIENIRLTQAGYAKSPVKCEYLREIAQREVEYFFKISDLL
1s9hA           DC----VDKMVIWWEEGKMTAKVVESAKAILGSKVRVDQKCKSSAQID------PTPVIVTSNTNMCAVI
1qhlA           CY------SMLDTINSRAGRDRKVDIKPFAIQ-GLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMT
1g6hA           KEPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEYKKWIPKEEEMVEKAFKILEFLKLSHLYDRKAGELS
1bs2A1          ---------------------------------------------------------------YAHSRLR
2iqhA1          GTMVMELIRMIKRGINRRTRIAYERMCNILKGFQTAAQRTMVDQVRESRNPGNAEFEDLIFLARSALILR
1ffhA2          -----ADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESI---------RRRVEEKARLEARDLILVDTA
1mjgM           DQIPEGSKLPLGILVDIYGRKMQADFEGV---LERRIHDFINYGEGLWHTGQRNINWLRVSKDAVAKGFR
2gk3A1          -----------KVLFIGESWHIHXIHSKGYDSFTSEEGATWLLECLRKGGVDIDYXPAHTVQIAFPESID
1c4oA1          LAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVVASV
1f46A           -------IQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEMKDFTTPGVTIFMQPSYGDEL
1kgdA           ENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLET----------IRKIHEQGLIAILDVEPQAL
1tljA           AEMPWDRSTIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGIHIYAKNIETGWDILKIAREAGFKHSGIL
1xbtA1          RALPACLLRDVAQEALGVAVIGIDEGQFFPDIVEFCEAMA----------NAGKTVIVAALDGTFQRKPF
1mm8A           --ALHRAADWAKSVFSSAALGDPRLVNVAAQLASGKSITISSEGSKAAQEGAYRFIRNPNVS--AEAIRK
2v3jA1          ARPDITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTV-RIPRTFKRFSGLXVQLLHKLSIRSEEK
1t3wA           NK--------LPGLGLFRELVNTCLSQPGLTT--GQLLEHYRGTNNAATLEKLSXWDDIADKNIAE--QT
1dnpA2          -----------------VWFRQDLRLHDNLALAAACRNSSAR------------VLALYIATPRQWATHN
1oa8A           ----------------LPPYFMKGSIIQLANGELKKVEDLEISNDLKIDSSTVERIEDSHSPGVAVIQFA
1cd5A           YGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVE
1ni3A1          AKVAVPDER---FDWLCEAYKPKSRVPAFLTVFDIAGLTKGASTGVGLGNAFLSHVRAVDAIYQVVRAFD
1jbkA           LDMGALVAGAKYRGEFERLKGVLNDLAKQEGNVILFIDELHTMVGAMDAGNMLKPALARGELHCVGATTL
1ak2A1          SG--SELGKKLKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLLDGFPRTVRQAEMLDDLMEKLDSVIE
1j1zA2          -------SMDANLLHISYEGGVLEDPWAEPPKGMFRMTQDPEEAPDAPEYVE------VEFFEGDPVAVN
1e6cA           MADVVAAEGWPGFRRRESEALQAVATPNRVVATGGRQFMRAHGTVVYLFAPAEELALRLQASLQAHQRPT
1udwA           TSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPV-----------YDFVSHSRKEETVTVY
1fl9A           YNIAGKMIYHFDLYRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELI
1rkbA           EQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVICDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKK
2axpA1          ---NEKLFEHFNKLADEDNVIIDRFVYSNLVYAFKDYSILTERQLRFIEDKIKAKAKVVLRVRGDEYIEG
1g8yA           ----DLLEVGELPTGPVIYLPAEDPPTAIHHRLHALGAHLSAEERQAVADGLLIQPLIGSLPNIMAPEWF
1l3aA           VE--PRSPEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYSRKQVFSLSVTEIGSIISLGTDSCEFFHDPN
1f2t.1          ------------------------------------------------------RLFVVWEGKERPLTLS
1zp6A1          LWGYIKHGRIDPWLPQSHQQNRXIXQIAADVAGRGYFVILDGVVRPDWLPAFTALARPLHYIVLRTTAAE
1esmA           FLHPNQVLKERGLXKKKGFPESYDXHRLVKFVSDLKSGVPNV----------------------TAPVYS
1viaA           VSEIFEQKRENFFREQEQKXADFFSSCEKACIATGGFVNVSNLEKAGFCIYLKADFEYLEISKRPLFYDE
2vgmA3          ----------------------------------------------------------LLHLNKDDDKAW
1tmkA           GGLINEYLTDDSFQLSDQAIHLLFSA------NRWEIVDKIKKDLLEGKNIVMDRYVYSGVAYSAAKGTN
1es6A2          -------------------LRPGISFHPKLRLPNKNSADLTSPEKIQAIMTSLQDFKIVP--IDPTKNIM
1e3mA2          PIDRIFTRVGFXVEXTETANILHNATEYSLVLXDEIGRGTST--YDGLSLAWACAENLANKIKALTLFAT
1jb1A           QQDEQTIVGAAPPILSHLLEIRGLGIIDVXNLFGAGAEDTTISLIVHLENWTPDQLIFDVPVPKITVPVK
2qgmA1          -------------------------------------------------------KSIQSQANPLKTIEP
1cr0A           EESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWF-------------DELFGNDTFHLYDSFAE
1dhyA1          ------------------------------------------------------VPAWDHFLTKSVGLMA
2f9hA1          ---VTEIGKHAIDDSEKXIILFGETATDTLKQ-HAVIQSFPEKDQVTLAEGDHLKIGDTNYTITKVGSFA
1poiA           IGNGRVKAYINCYTANSGVTNVSRRFRKWFEAGKLTMEDYSQDVIYMMWHAAALGLPFLPGLTDEWGISK
1grqA           ----PLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFV
1atrA1          DKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVSSMVGKTVTNAVVTVPAYFN
1np6A           LRKAGAAQTIVASQQRWALMTETPDEEELDLQFLASRMDTSK------------------LDLILVEGFK
1sbxA           -----------------------------------------------------------------PSDRS
1yvuA2          YDFVKRELLKKXIPSQVILNRTLKFVLLNVAEIPYKLKEIEGKVDA--------FVGI------DISRIT
1lw7A2          KLGGDEQAMQYSDYPQXAL-GHQRYIDYAVRHSHKIAFID-----------------TDFITTQAFCIQY
1o7d.2          ----------------------------------------------------------TQTAERFQVIVN
2gtlM1          DCKIV--VPSSLFVCAHFNAQRY-----------------------------------------------
1i1qA           -----SYGGAVGYFTAHGDLDTCIVIRSALVENG-IATVQAGAGIVLDSVPQSEADETRNKA--------
1g6oA           EEIVFKHHKNYTQLFFGGNITSADCLKSCLRXRPDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSS
3cddA2          VPSYDESTITISVSGRDKTADLVDCSIDYPSGQFNNQTLTQIADIVCKPFGIKVIVNTDVGEPFQRIQIE
1xkpA1          ----------------------------------------------------------------------
1d6jA           RFGLNKDLGFSEADRNENIRRIAEVAKLFADSNSIAITSFIS-----------PYRKDRDTARQLHEVAT
1mkyA1          CGVFDNPQDIISQKXKEVTLNXIREADLVLFVVDGKRGITKEDESLADFLRKSTVDTILV---ANKAENL
1gm5A1          -----------------SSLFLWGEALPTLLEEFLN-EVEKMLKNQVNTRRIHQLLKELDDPLLENKDLE
1ii8.1          DFTEELIEKVKKYKALAREAALSKIGELASEIFAEFTEGKYSEVVVRAEENKVRLFVVWEGKERPLERIA
3cddA1          ------------------------------------------------------ARGRFSWRQRFSKFTI
1qhdA1          ---LITNYSPSREDNLQRVFT-VASIRSML----------------------------------------
1v47A1          ----------------------------------------------------------------------
1f8xA           -------------------------------------------------------------------WFT
2pa7A1          ------------------------------------------------------------HAHKKLEQVL
1g31A           ----------------------------------------------------------------------
1mi8A           RL--DELSLKEHIALPRKSDISWDSIVSITETGVEEVFDLTV----------------------------
2fggA1          ------------------------------------------------------LIEEHDERTRAKARLS
2ancF1          VDVFLDIQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYYLIVNDDFDTA
1ckvA           EVDCDEISELLGRQFNVYDFLVDVSS--------------------------------------------
1l7lA           GL--ICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGA------------ITLIYNDVPGTYGNNS
1bccF           -------KWYYNAAFNKYGLMRDDTIYENDDV-KEAIRRLPENLYDDRMFRIKRALDLNMRQQILP---K
1em8A           ----------------------------------------------------------------------
1afrA           ----------------------------------------------------------------------
1uouA3          ----------------------------------------------------------------------
2gujA1          SAKIASLDEEVPFTFEDFDVPEKL----------------------------------------------
1vhhA           -------------------------------------------------------------GRYEGKITR
1yj5A2          VSSCQAALRQGKRVVIDNTNPDVPSRARYIQCAAGVPCRCFNFCATIEQARHNNRFREXTDPSHAPVSDX
1xl3C1          -------------------YDLSEFMGDIVALVDXRWAGIHDIEHLANAFSLPTPQDLXRMFRLFPLGVF
1a4iA2          ----------------------------------------------------------------------
1ovmA2          GTAAQQRGELLHHTLGDGEFRHFYHMSEPITVAQAVLTEQNA-------CYEIDRVLTTMLRERRPGYLM
1ckeA           EDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVAN-----AASQVAAFPRVREALLRRQRAFR
1t9hA2          LEFTDIEEEELGYTFPDIREKSSSCKFRGCLHLKEPKCA---------VKQAVEDGELKQYRYDHYVEFM
1wz8A1          -----------------------------------------------------------SLEARYPGLAF
1w1wA           GDTSTVSYKDYSIFLENENLVFQGDVEQIAAQSPVELRMFTFDYVSDHLDAIYRELTGNASLTKYHATLS
1iqrA2          -------------------------------------RGDLRLHDHPALLEALARGPVVGLVVLDPNNLK
1yr6A1          ELPYEPSIDVREFVTVREGYGPNGAIVESYDRLMEKFNEYLNKILRLEKENDYVLIDTPGQMETFLFHEF
1dwmA           ----------------------------------------------------------------------
1d8jA           ------------------------------------------------------HPLTLDEILDETQHLD
1j90A           VNLLELMPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNT----
1b77A2          DSGLTRPKYSLTLTDYDGSNNFNFVINMANMKIQPGNYKVMLWGAGDKVAAKFESSQVSYVAMEADSTHD
2vnuD1          ----------------------------------------------------------------------
1q3tA           VEALLALLDQHPISFGRSETGDQLVFVGDVDITH----PIRENEVTNHVSAIAAIPEVREKLVSLQQEI-
1v37A           ---------------------------------------------------------------PELREIH
1g8fA3          KTELIQDFIGSGSGLIIPDQWEDDKDSVVGKQNVYLLDTSS-----------------------------
1iioA           ----------------------------------------------------------------GDVELK
1puoA2          ---VFFAVANGNELLLDLSLTVNATEPERTAM-KKIQDCYVENGLISRVLDGLVMTTISSSK--------
1tueA           ----EPLTDTKVAMLDDATTTCWTYFDTY-----------------------------------------
2je6I3          IEAIRKIENESHI---------------------------------------------------------
1jqjA3          GFNVSYVLDVLNALKCENVRM-MLTDSVSSVQ--------------------------------------
1l1oA           EEI-SGIVEVVGRVTAKATIL-CTSYVQFKEDSH------------------------------------
1e2hA           IANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRHPIAAL
1e6vC           --------------------------------------------------------------------KY
1heiB1          Y---STYGKFLADGGCSGGAYDIIICDECHSTDA------------------------------------
1odfA           FYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQ------------EVLNTIFNQDTVVLPKYDKSQF
1zbsA1          -------------------------------------------------------SPLGYILGDEGSGAV
1pgsA2          TFQHQLGALGCSANPINNQSP-GNWTPDRAGW--------------------------------------
2bsqE1          -------------------------THNAIKFRARAAGRSTEAEIRLILDNIAKAQQTVRLGSMIGQEIG
1jqjA2          -------------------------------------------------------------------RTV
1tf7A1          PQDIIKNARSFGWDLAKLVDEGKLFILD---------------------------ASPDPEGQEVVGGFD
1lnzA2          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1tpzA           ER--------------------------------------------------------------------
1a2nA           VDLHISGLEQLGATIKLEEGYVKASV--------------------------------------------


                         +         .         .         .         .         *         .:210
query           GGQQQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLDVMRDLAQGGMTMVVVTHEMGFAREVADRVVF
1b0uA           GGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIF
1sgwA           QGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEGIVIISSREEL----SYCDVNEN
1ji0A           GGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHYGYV
1q3hA           GGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLMANKTRILVTS-KMEHLRKADKILI
1l7vC           GGEWQRVRLAAVVLQAGQLLLLDEPXNSLDVAQQSALDKILSALCQQGLAIVXSSHDLNHTLRHAHRAWL
1e69A           GGEKALVGLALLFALPSPFYVLDEVDSPLDDYNAERFKRLLKENSK-HTQFIVITHNKIVM-EAADLVTM
1mukA           LQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRHL---------NTDIPPRMGWLRAILRF
1nijA1          QTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQFTIAQSQVGYA---DRILLTKTDVAGEAEKLHERLAR
1jjvA           EQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSANF--EQIQRIMNSQVSQQERLKWADDVIN
1m3eA1          YNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKADQ-AGNVTFRKSARNFNLPXCKAAETTV
1vplA           KGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDRIAL
1e9rA           KLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASALTSARFVLSDKLPEHVTMPDGDFS
1urjA           FEQRLASVMAGDAALASMAVFDEPPTDISAWPLFEARANAVGAYLA-RAAGLVGAMVFSTNSALHLTEVD
1khbA1          NKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLVY--EALSWQHGVF
1pf4A1          GGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDE-LQKNKTVLVIAHRLST-IEQADEILV
1ex6A           VKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELADKVIVNDDLDKAYKELKDFIF
1t06A           DELKMSAGWSWLLGNRKDNAFSESKISDMLEMVKDTIHHSPETKSAMNNFLNTVAPLHEKAVEIAKEVGI
1n25A           ARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRVAEFAQSIQSRIVEWKERLDKEFSL
2gx8A1          GKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMLGLNIVDPGHNVVMKQGVQKQLQE
2yyeA2          NLDNWKLILLSDPVTSGGLLFTINKEKLE------KIDETAKELEVNYWIIGETIAENVLE---------
1bmfA3          VAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPV-IETQAGDVSAYIPTNVIS
1ohcA1          SDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGESYIPFRDAAYGYITLLDCFHAVKKAMQ-------
1pv4A3          LARAYNTVVPAVLTGGVDANALHRPKRFFGAARNVEEGGSLT-----IIATALIDTGSKXDEVIYEEFKG
1jalA1          DTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKIPVLENAGMIRSVGLDKEELQAIKSYNF
1bgxT2          GRAPTPEDFPRQLALIKELVDLGLARLEVPGYEADDVLASLAKKAEKGYEVRILTADKDLYQLLSDRIHV
1zs3A1          LDENEIVPSTTEEFLKYHKFITEDPKAKYWTDLLESFIVDFQAQNMFITRAIKLANKEE-KFALAAGVVE
1s9hA           DGNSTTFEHQQPLQDRMFKFELTRRLDHDFGKVTKQEVKDFFRWAKDHVVEVEHEFYV------------
1qhlA           DYHSLMFDLLRSASDRSKFYRLIEASGGISSAITRSLRDYLL----------------------------
1g6hA           GGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDHLYV
1bs2A1          SVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAIKTHEPTTVVTYLF---KLTHQVSSC
2iqhA1          GSVAHKSCLPACVYGSAVASGYDFEREGYSLVGIDPFRLLQN------SQVYSLIRPNENPAHKSQLVWM
1ffhA2          GRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDKVGVTGLVLTKLDGDARGAALSARH
1mjgM           FKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKDDRMRGLTDETVDTQSFAPNHVCI
2gk3A1          ELNRYDVIVISDIGSNTFLLQNETFYQLKIKPNALESIKEYV--KNGGGLLXIGGYLSFXGIEAKANYKN
1c4oA1          SAIYGLGDPREYRARNLVGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERTLY
1f46A           QLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN----------------------
1kgdA           KVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRT-YAHYFDLTIINNEIDETIRHLEEAV-
1tljA           ATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLARGKQKMNLLKD-------------
1xbtA1          GAILNLVPLAESV---------------------------------------------------------
1mm8A           AGAMQTVKLA----QEFPELLAIEDTTSLSYRHQVAEE-LGKLGSIQDKSRGWWVHSVLLLEATTFRTVG
2v3jA1          LLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLDDDE-----SICVFVGAXARGKDNFAVDEKVG
1t3wA           FTDSLNHXFDSLLELRQEELIARERTHGLSNEERLELWTLNQELA-------------------------
1dnpA2          MSPRQAELINAQLNGLQIALEKGIPLLFREVDDFVASVEIVQVCAENSVTHLFYNYQYEVNERARDVEVE
1oa8A           VGEHRAQVSVEVLVEYP-FFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLK-------------
1cd5A           GCVNHMWTISCLQLHPKAIMVCDEPSTMELKVKTLRYFNELEAENIKGL---------------------
1ni3A1          DAEIIHVEGDVDP--IRDLSIIVDELLIKDAEFVEKHLEGLRKITSRG----------------------
1jbkA           DEYRQYIEKDAALERRFQKVFVAEPSVEDTIAIL------------------------------------
1ak2A1          FSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSRGIHSAIDASQTPDVVFASILAAF-
1j1zA2          GERLSPAALL----QRLNEIGGRHGVGRVDIVENRFVGMKSRGVYETPGTILYHARRAVESLTLDREVLH
1e6cA           LTGRPIAEEMEAVLREREALYQDVAHYVVDAAIVCELMQTMR----------------------------
1udwA           PADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFC
1fl9A           AQTNLGKNIISAFS--------------------------------------------------------
1rkbA           LTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILK------------------------
2axpA1          KDIDSILELYREVXSNAGLHTYSWDTGQWSSD---EIAKDIIFLVE------------------------
1g8yA           DGLKRAAEGRRLMVLDTLRRFHIEEENASGPMAQVIG-RMEAIAADTGCSIVFLHHAVLVNIRWQSYLSS
1l3aA           KGRSDEGRVRKVLKVEPL---PDGSGHFFNLSVQNKLINLDENIYI-----PVTKAEFAVLVSAFNFVMP
1f2t.1          GGERIRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELK-DAADHVIL
1zp6A1          AIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTDQALQSAINALQSGRFRID-------
1esmA           HLIYDVIPDGDKTVVQPDILILEGLNVLQSGXDYPHDPHHVFVSDFVDFSIYVDAPEDLLQTWYINRFLK
1viaA           IKAKKLYNERLSKYEQKANFILNIENKNID-ELLSEIKKVIK----------------------------
2vgmA3          YGEK-EVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKALVLSTLHSLGEELDQLT--
1tmkA           GMDLDWCLQPDVGLLKPDLTLFLSTQFGDERYETVKFQEKVK--------QTFMKLLDKEIRKGDESITI
1es6A2          GIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL----------------
1e3mA2          HYFELTQLPEKXEGVANVHLDALEHGDTIAFXHSVQDGAASKSYGLAVAALAGVPKEIKRARQKLRE---
1jb1A           VGRNLAIIIEVAAXNFRAKSXGYDATKTFEKNLNHLI---------------------------------
2qgmA1          SKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGFTNFAXEEDWGNGLKLNEYIQT
1cr0A           AETDRLLAKLAYMGLGCDVIILDHISI---RKMIDNLMTKLKGFAKSTGVVLVVICDLRALRQLSDTIIA
1dhyA1          AGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDDALERMADKLRQAGVAFTRGDEALM--QQRKVM
2f9hA1          NSNLQSIAHSTLIFADAPTDEDDVIRNGVYLTP------HQLPKITIGTTIDYL----------------
1poiA           EVRKTLDKVPDDKFKYIDNPFKP-----------------------------------------------
1grqA           GDLDVLWV-----GVRCDGAVAEGRETARGDRVAGMAAKQAYVVEGVEYDVEVDTTHKE-SIECAWAIA-
1atrA1          DSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGL------------------------------------
1np6A           HEEIAKIVLFRDGAGHRPEELVIDRHVIAVASDVPLDVALLDINDVEGLADFVVEWMQKQ----------
1sbxA           TERCEGETISCFVVGGEKRLCLPQILNSVLRDFSLQQ--INAVCDELHIYCSRCTADQLEILKVXGILFS
1yvuA2          RDGKTVNAVAFTKIFNSKGELVRYYLTSYPAFGEKLTEKAIGDV--------FSLLEKL-GFKKGSKIVV
1lw7A2          EGKAHPFLDSXIKEYPFDVTILLKNN--------------------------------------------
1o7d.2          PLGRKVDWMVRLPVSKHVYLVKDPGGKIVPSDVVTIPSSDSQELLF-SALVPAVGFSIYSVSQMPRDLVI
2gtlM1          ----------------------------------------------------------------------
1i1qA           RAVLRAIATAH-----------------------------------------------------------
1g6oA           EEAFIRLASNSAARNIKFESLIEGFKDLID----------------------------------------
3cddA2          QGETPHELLARLA-KQRGVLLTSDTFGNLVI---------------------------------------
1xkpA1          -------QFXMLCGLRDALXGRPEL-----AHLSHLVEQALVSMAEQGETIVLGARITPEAYRESQSGVN
1d6jA           PGEETGLPFVEVYVDVPVEAPYEAPANPNYELPVQDAVKIIDYLDTKG---YLPAKK-------------
1mkyA1          REFEREVKPELYSLGFGEPI----PVSAEHNINLDTXLETIIKKLEEKG---------------------
1gm5A1          EKLQAFLDYVK------EIPNLPEARKRYRIQKSLEMIEKLRSW---FLIDYL-----------------
1ii8.1          LGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELK-DAADHVIR
3cddA1          KAAKADVTDSEIGRYRPLIIVNEEVTAEGAAKRGQWERQRSIGKXAEYTVTGWRIPQTGKLWNINTLVPV
1qhdA1          ----------------------------------------------------------------------
1v47A1          ----PALEIGEDERLDL-ENLATGAFFPVKGFEALSVAHEMRLPTGEVWTIPILLFREKPRVGPGNTVAL
1f8xA           DRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNNDLNGIKTNDIMLG
2pa7A1          VCLNGSCRVILDDGNIIQEITLDSPAVGLYVGP--AVWHEMHDFSSDCVMMVLASDYYDETDYIRQYDNF
1g31A           ---------LPIRAVGEYVILVSEPAQAGDEEVTESGLIIGKRQGEVPELCVVHSVGP----DVPEGFCE
1mi8A           ----------------------------------------------------------------------
2fggA1          WAGRQXVGVGLAR-----LDPADEPVAQIGDE-----LAIARALSDLANQLFALTSSDIEA---------
2ancF1          LTDLKTIIRAERLRMSRQKQRHDALISKLL----------------------------------------
1ckvA           ----------------------------------------------------------------------
1l7lA           GSFSVNIGKDQS----------------------------------------------------------
1bccF           EQWTKYEEDVPYLEPYLKEVI-------------------------------------------------
1em8A           --------------KNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRGKRVLIACEDEKQAYRLDEALWA
1afrA           ----SFQERATFISHGNTARQAKEHGDIKLAQICGTIAADE------KRHETAYTKIVEKLFEIDPDGTV
1uouA3          ------------------------------REQEELLAPADGTVLVRALPLALVLHELGALRLGVGAELL
2gujA1          ----------------------------------------------------------------------
1vhhA           NSERFKELTPNY---NPDIIFKDEENTGADRLMTQRCKDKLNAVMNQWPGVKLRVTEGWDEDGHHSEESL
1yj5A2          VXFSYRKQFEPPTLAEGFLEILEIPFRLQEH-LDPALQRLYRQFSEG-----------------------
1xl3C1          SDEEQRQNLLQMCQNAIDMAIESE----------------------------------------------
1a4iA2          ----------------PAEILNGKE---ISAQIRARLKNQVTQLKEQPGFTPRLAILQVGNRDDSNLYIN
1ovmA2          ----------------------------------------------------------------------
1ckeA           ELPGL---IADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQVKGFSVNRLLAEIKLVPAADALVLD
1t9hA2          TEIKDR----------------------------------------------------------------
1wz8A1          AWPRPGVLE---------ITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLLRGEGGVSAGGSFGLI
1w1wA           GGEKTVAALALLFAINSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTM-FEKSDALV-
1iqrA2          TTPRRRAWFLEN------VRALREAYRARGGALWVLEGLPWEAARRLKAKAVYALTSHTPYGRYRDGRVR
1yr6A1          GVRLMENLPYPLVVYISDPEILKKPNDYCFVRFFALLIDLRLGATTINKVDLLSEEEKERHRKYFEDIDY
1dwmA           ------------------------------PELVGMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWV
1d8jA           IGLKQKQWLMTEAVNNPKIEVIDGKYAFKPKYNV------------------------------------
1j90A           -LEEWYKFIEESIHVQADLIIY------------------------------------------------
1b77A2          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1q3tA           AQQGGIVMDGRDIG---TVVLPQAELKIFLVASVDE--RAERRYKENIAKGIETDLE-------------
1v37A           FGALEGALWETLDPRYKEALLRFQGFHPPGGESLSAFQERVFRLEGLKAPAVLFTHG-GVVRAVLRALGE
1g8fA3          ----------------------------------------------------------------------
1iioA           ASDAGQVLTADDFPFSAEEVADTIVNKA------------------------------------------
1puoA2          ----------------------------------------------------------------------
1tueA           ----------------------------------------------------------------------
2je6I3          ----------------------------------------------------------------------
1jqjA3          ----------------------------------------------------------------------
1l1oA           ----------------------------------------------------------------------
1e2hA           LCYPAARYLMGSMTPQAVLAFVALIPPTLPGTHIDRLAKRQRPGERLDLAMLAAIRRV--YGLLANTVRY
1e6vC           MNPNYELKKLREIPDEDIVRLMGHREPGEEYPSVHPPLEEMEEPE----CPIRELVEPTEGAKAGDRIRY
1heiB1          ----------------------------------------------------------------------
1odfA           KGEGDRCPTGQKIKLPVDIFILEGWFLGFNPI--------------------------------------
1zbsA1          LGRLFIGSLLKGQXPE---GLCEAFLQEYGLTSADIIESVYRKPFPN--RFLAGFSPFIAQHLDIPAVYS
1pgsA2          ----------------------------------------------------------------------
2bsqE1          GVELEDVR--------------------------------------------------------------
1jqjA2          ATDGHRLAVCSMPIGQSPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTS--------------
1tf7A1          LSALIERINYAIQKYRARRVSIDSVTSVFSSVVRRELFRLVARLKQIGATTVMTTERIEEYGPIARYGVF
1lnzA2          ----------------------------------------------------------------------
2cxxA1          ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------
1a2nA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           MDGGQIVEEGRPEEIFTRPKEERTRSFLQRVLHH
1b0uA           LHQGKIEEEGDPEQVFGNPQSPRLQQFLKGSLKK
1sgwA           LHKY------------------------------
1ji0A           LETGQIVLEGKASELLDNE---------------
1q3hA           LHQGSSYFYGTFSELQS-LRPDFSSKLMGYDTFD
1l7vC           LKGGKXLASGRREEVLTPP---------------
1e69A           VNGVSAIVPV------------------------
1mukA           LGAGMVMTATGVVDIYLEDIHGGGRSLGQR----
1nijA1          INARAPVYTVDLGLLFNTNGFMLEENVVSTKPRF
1jjvA           NDAELAQNLPHLQQKVLELHQFYLQQAENK----
1m3eA1          VEVEEIVDIGSFAPEDIHIP----KIYVHRLVK-
1vplA           IHNGTIVETGTVEELKERYKAQNIEEVFEEVV--
1e9rA           IRSWLEDPNGGNLFITWREDMGPALRPLISAWVD
1urjA           DAGPAHSKPSFYRFFLVPGTHVAANPQVDREGHV
1khbA1          VGAAMRSEAKIIMHDPFAMRP-------------
1pf4A1          VDEGEIIERGRHAD--------------------
1ex6A           AE--------------------------------
1t06A           VEVKRDNKKSSLLNASESIQKELDRG--------
1n25A           SVYQKMKFN-------------------------
2gx8A1          KVDAKKLNVHIHASLHTDPF--------------
2yyeA2          ----------------------------------
1bmfA3          ITDGQIFLETELFYKGIRPAINVGLSVSRVGS--
1ohcA1          ----------------------------------
1pv4A3          TGNXELHLSRKIAEKRVFPAIDYNRSG-------
1jalA1          LTLKPTMYIANVNEDGFENNPYL-----------
1bgxT2          LHPEGYLIT--PAWLWEK----------------
1zs3A1          LYGY------------------------------
1s9hA           ----------------------------------
1qhlA           ----------------------------------
1g6hA           MFNGQIIAEGRGEEEIKNVLSD------------
1bs2A1          YDVLWVAGQTEELATARLALYGAARQVLYNGMR-
2iqhA1          ACHSAAFEDLRVSSFIRGTKVVPRGKLSTRGVQ-
1ffhA2          VTGKPIYFAGLEPFYPERLAGR------------
1mjgM           VTPERVGLCGAVSWLDAKASYEINHAGPNQ----
2gk3A1          TVLAEVLPVIXLDGDDRVEKPEGICAEAVSPEHP
1c4oA1          DLE-------------------------------
1f46A           ----------------------------------
1kgdA           ----------------------------------
1tljA           ----------------------------------
1xbtA1          ----------------------------------
1mm8A           LLHQEWWMRPDDPADADEKESGKWLAAAATSRLR
2v3jA1          LSNYPLSASVACSKF-------------------
1t3wA           ----------------------------------
1dnpA2          RALRNVVCEGFDDSVILPPGAVMTGNHEMYKVFT
1oa8A           ----------------------------------
1cd5A           ----------------------------------
1ni3A1          ----------------------------------
1jbkA           ----------------------------------
1ak2A1          ----------------------------------
1j1zA2          QRDMLSPKYAELVYYWYAPEREALQAYFDHVARS
1e6cA           ----------------------------------
1udwA           LPTKKIIPRGADNLVAINLIVQHIQDIL------
1fl9A           ----------------------------------
1rkbA           ----------------------------------
2axpA1          ----------------------------------
1g8yA           MTSAEAEEWGVDDDQRRFFVRFGVSKANY-----
1l3aA           YLLGTAVNSFKPE---------------------
1f2t.1          ENGSSKVE--------------------------
1zp6A1          ----------------------------------
1esmA           FREGAFTDPDSYFHNYAKLTKEEAIKTAXTLWKE
1viaA           ----------------------------------
2vgmA3          ----------------------------------
1tmkA           VDVTNKGIQEVEALIW-QIVEPVLSTHIDH----
1es6A2          ----------------------------------
1e3mA2          ----------------------------------
1jb1A           ----------------------------------
2qgmA1          GKGNPREFLKLLYPTDEII---------------
1cr0A           LERNQLVLVRILKCRFT-----------------
1dhyA1          GLLCLQDPFGLPLEIYYGPAEIFHEPFL------
2f9hA1          ----------------------------------
1poiA           ----------------------------------
1grqA           ----------------------------------
1atrA1          ----------------------------------
1np6A           ----------------------------------
1sbxA           APSCGLITKTDAERLCNAL---------------
1yvuA2          HRDGRLYRDEVAA---------------------
1lw7A2          ----------------------------------
1o7d.2          QNEARFDPNT------------------------
2gtlM1          ----------------------------------
1i1qA           ----------------------------------
1g6oA           ----------------------------------
3cddA2          ----------------------------------
1xkpA1          PLQPLRDTYRDAVMGY------------------
1d6jA           ----------------------------------
1mkyA1          ----------------------------------
1gm5A1          ----------------------------------
1ii8.1          ISLENGSSKVE-----------------------
3cddA1          IDEIXGLDEEXLIASILFSEDDAGR---------
1qhdA1          ----------------------------------
1v47A1          LHGGERVALLHVAEAYELDLEALARAV-------
1f8xA           VYIPDEEDVGLGMELGYALSQGKYVLLVI-----
2pa7A1          KKYIAKI---------------------------
1g31A           VGDLTSLPVG---QIRNVPHPFVALGLKQPKEIK
1mi8A           ----------------------------------
2fggA1          ----------------------------------
2ancF1          ----------------------------------
1ckvA           ----------------------------------
1l7lA           ----------------------------------
1bccF           ----------------------------------
1em8A           RPAESFVPHNLAGE--------------------
1afrA           LAFADMMRKKISMPAH------------------
1uouA3          VDVGQRLRRGTPWLRDGPALSGPQSRALQEALV-
2gujA1          ----------------------------------
1vhhA           HYEGRAVDITTSDRDRSKYGMLARLAVEAGF---
1yj5A2          ----------------------------------
1xl3C1          ----------------------------------
1a4iA2          VKLKAAEEIGIKATHIKLPRTTTESEVMKYITSL
1ovmA2          ----------------------------------
1ckeA           STTLSIEQ--------------------------
1t9hA2          ----------------------------------
1wz8A1          EEMRASHEALL-----------------------
1w1wA           ----------------------------------
1iqrA2          E---------------------------------
1yr6A1          LT-ARLKLDPSMQGLMAYKMCSMMTEVLPPV---
1dwmA           IVNDHGVVTSVP----------------------
1d8jA           ----------------------------------
1j90A           ----------------------------------
1b77A2          ----------------------------------
2vnuD1          ----------------------------------
1q3tA           ----------------------------------
1v37A           DGLVPPGS--------------------------
1g8fA3          ----------------------------------
1iioA           ----------------------------------
1puoA2          ----------------------------------
1tueA           ----------------------------------
2je6I3          ----------------------------------
1jqjA3          ----------------------------------
1l1oA           ----------------------------------
1e2hA           LQCGGSWREDWGQLSGPRPHIGDT----------
1e6vC           I---------------------------------
1heiB1          ----------------------------------
1odfA           ----------------------------------
1zbsA1          LVQNSFDDFLVRNVLRYNRPDLPLHFIGSVAFHY
1pgsA2          ----------------------------------
2bsqE1          ----------------------------------
1jqjA2          ----------------------------------
1tf7A1          VSDNVVILRNVLEGERRRR---------------
1lnzA2          ----------------------------------
2cxxA1          ----------------------------------
1tpzA           ----------------------------------
1a2nA           ----------------------------------