[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81265.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2dsyA1.bssp"

## Summary of PDB Search
:342
    7e-07  46%  2dsyA1 [d.304.1.2] HYPOTHETICAL PROTEIN TTHA0281 A:3 -- 82
:342

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xGVLTRYLEETMAKARYDLVSPGRYVGELAEFGLRVEGENxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dsyA1          -GTLTRYLEEAXARARYELIADEEYYGEIPDLGVWATGKS------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dsyA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dsyA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dsyA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2dsyA1          --------------------------------------------------------------