[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81275.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a8hA2.bssp"
#ERROR : Can't open dsspfile "1f4lA2.bssp"
#ERROR : Can't open dsspfile "1ileA3.bssp"
#ERROR : Can't open dsspfile "1rqgA2.bssp"
#ERROR : Can't open dsspfile "1gaxA3.bssp"
#ERROR : Can't open dsspfile "1ffyA3.bssp"
#ERROR : Can't open dsspfile "1h3nA3.bssp"
#ERROR : Can't open dsspfile "1pxfA.bssp"
#ERROR : Can't open dsspfile "1e7zA.bssp"
#ERROR : Can't open dsspfile "1iq0A2.bssp"
#ERROR : Can't open dsspfile "1a8hA1.bssp"
#ERROR : Can't open dsspfile "1euqA2.bssp"
#ERROR : Can't open dsspfile "1n1bA2.bssp"
#ERROR : Can't open dsspfile "1d2rA.bssp"
#ERROR : Can't open dsspfile "1f9dA.bssp"
#ERROR : Can't open dsspfile "1b70B3.bssp"
#ERROR : Can't open dsspfile "1li5A2.bssp"
#ERROR : Can't open dsspfile "2p84A1.bssp"
#ERROR : Can't open dsspfile "1irxA2.bssp"
#ERROR : Can't open dsspfile "1f4lA1.bssp"
#ERROR : Can't open dsspfile "1rqgA1.bssp"
#ERROR : Can't open dsspfile "1c4kA1.bssp"
#ERROR : Can't open dsspfile "1qmyA.bssp"
#ERROR : Can't open dsspfile "1jfaA.bssp"
#ERROR : Can't open dsspfile "1ileA1.bssp"
#ERROR : Can't open dsspfile "1bs2A2.bssp"
#ERROR : Can't open dsspfile "2bl7A1.bssp"
#ERROR : Can't open dsspfile "1h3nA1.bssp"
#ERROR : Can't open dsspfile "1j1uA.bssp"
#ERROR : Can't open dsspfile "1nzjA.bssp"
#ERROR : Can't open dsspfile "1mijA.bssp"
#ERROR : Can't open dsspfile "1edzA2.bssp"
#ERROR : Can't open dsspfile "1g59A2.bssp"

## Summary of PDB Search
:618
    1e-58  97%  1a8hA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 348
    2e-46  24%  1f4lA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:4 -- 140 A:176 -- 388
    1e-44  21%  1ileA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 197 A:387 -- 641
    1e-43  26%  1rqgA2 [c.26.1.1] METHIONYL-TRNA SYNTHETASE A:1 -- 138 A:174 -- 396
    6e-41  24%  1gaxA3 [c.26.1.1] VALYL-TRNA SYNTHETASE A:1 -- 189 A:343 -- 578
    5e-38  22%  1ffyA3 [c.26.1.1] ISOLEUCYL-TRNA SYNTHETASE A:1 -- 200 A:395 -- 644
    3e-37  21%  1h3nA3 [c.26.1.1] LEUCYL-TRNA SYNTHETASE A:1 -- 225 A:418 -- 686
    5e-36  35%  1pxfA  [b.40.4.4] HYPOTHETICAL PROTEIN YGJH
    6e-33  35%  1e7zA  [b.40.4.4] ENDOTHELIAL-MONOCYTE ACTIVATING POLYPEPTIDE II
    3e-32  11%  1iq0A2 [c.26.1.1] ARGINYL-TRNA SYNTHETASE A:97 -- 466
    8e-32  99%  1a8hA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:349 -- 500
    2e-26  13%  1euqA2 [c.26.1.1] GLUTAMINYL-TRNA SYNTHETASE A:8 -- 338
    1e-25  10%  1n1bA2 [a.128.1.3] (+)-BORNYL DIPHOSPHATE SYNTHASE A:271 -- 598
    2e-25   7%  1d2rA  [c.26.1.1] PROTEIN (TRYPTOPHANYL TRNA SYNTHETASE)
    7e-25   8%  1f9dA  [a.102.1.2] ENDO-1,4-BETA-GLUCANASE F
    3e-24  32%  1b70B3 [b.40.4.4] PHENYLALANYL-TRNA SYNTHETASE B:39 -- 151
    5e-23  14%  1li5A2 [c.26.1.1] CYSTEINYL-TRNA SYNTHETASE A:1 -- 315
    2e-21  12%  2p84A1 [b.172.1.1] ORF041 A:3 -- 135
    1e-20  11%  1irxA2 [c.26.1.1] LYSYL-TRNA SYNTHETASE A:3 -- 319
    2e-18  22%  1f4lA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:389 -- 548
    6e-18  24%  1rqgA1 [a.27.1.1] METHIONYL-TRNA SYNTHETASE A:397 -- 606
    7e-18   8%  1c4kA1 [c.23.1.4] PROTEIN (ORNITHINE DECARBOXYLASE) A:1 -- 107
    3e-17   9%  1qmyA  [d.3.1.2] PROTEASE
    6e-17  10%  1jfaA  [a.128.1.5] TRICHODIENE SYNTHASE
    4e-15  14%  1ileA1 [a.27.1.1] ISOLEUCYL-TRNA SYNTHETASE A:642 -- 821
    8e-12  14%  1bs2A2 [c.26.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:136 -- 483
    5e-11  14%  2bl7A1 [a.29.8.2] ENTEROCINE A IMMUNITY PROTEIN A:3 -- 82
    2e-10  18%  1h3nA1 [a.27.1.1] LEUCYL-TRNA SYNTHETASE A:687 -- 814
    2e-10   9%  1j1uA  [c.26.1.1] TYROSYL-TRNA SYNTHETASE
    1e-08  18%  1nzjA  [c.26.1.1] HYPOTHETICAL PROTEIN YADB
    8e-08  13%  1mijA  [a.4.1.1] PROTEIN PROSPERO
    7e-07  11%  1edzA2 [c.58.1.2] 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE A:3
    6e-06  21%  1g59A2 [c.26.1.1] GLUTAMYL-TRNA SYNTHETASE A:1 -- 305
:618

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
1a8hA2          MEKVFYVTTPIYYVNAEPHLGHAYTTVVADFLARWHRLDGYRTFFLTGTDEHGETVYRAAQAAGEDPKAF
1f4lA2          --KKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIMLKAQQLGITPEQM
1ileA3          -GPRYTVYEGPPTANGLPHVGHAQARSYKDLFPRYKTMRGYYAPRRAGWDTHGLPVELEVEKKLGLKRES
1rqgA2          --VRYMVTSALPYANGPIHAGHLAGAYLPAIFVRYLRLKGEDVVFICGTDEHGTPISFRALKEGRSPREI
1gaxA3          -KPPFVIFMPPPNVTGSLHMGHALDNSLQDALIRYKRMRGFEAVWLPGTDHAGIATQVVVERLLLKEGKT
1ffyA3          GNETFILHDGPPYANGNLHMGHALNKILKDFIVRYKTMQGFYAPYVPGWDTHGLPIEQALTKKGVDRKKM
1h3nA3          -RGKQYVLVMFPYPSGDLHMGHLKNYTMGDVLARFRRMQGYEVLHPMGWDAFGLPAENAALKFGVHPKDW
1pxfA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1iq0A2          -PGVVLVEHTSVNPNKELHVGHLRNIALGDAIARILAYAGREVLVLNYIDDTGRQAAETLFALRHYGLTW
1a8hA1          ----------------------------------------------------------------------
1euqA2          -KHTTVHTRFPPEPNGYLHIGHAKSICLNFGIAQDYKGQCNLRFDDTNPVKEDIEYVESIKNDVEWLGFH
1n1bA2          --WAVGMFEPHQHGYQRKMAATVLATVIDDIYDVYGTLDELELFTFKRWDTESITRLPYYMQLCEHGFFC
1d2rA           ------------QPSGVITIGNYIGALRQFVELQH----EYNCYFCIVDQ-HAITVWQDPHELRQNIRRL
1f9dA           EQESTWETIPQPCWD---EHKFGGQYGFLDLFTKDTGTPAKQFKYTNAPDADARAVQATYW-ADQWAKEQ
1b70B3          ----------------------------------------------------------------------
1li5A2          HAGEVGMYVCGITVYDLCHIGHGRTFVAFDVVARYLRFLGYKLKYVRNITDIDDKIIKRANENGESFVAM
2p84A1          ---------------------------------------------------------REFDRERHRTDYQ
1irxA2          -EKEKYVVESGITPSGYVHVGNFRELFTAYIVGHALRDKGYEVRHIHMWDDYDRFRKVPVPDPWGCHESY
1f4lA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1c4kA1          --------------------SSLKIASTQEARQYFDTDRVVVDAVGSDFTDVGAVIAMDYETDVIDAADA
1qmyA           ----------------ELTLYNGEKKTFYSRPNNHDNAWLFRYVEEPFFDWVYSSPENLTLEAIKQLEDL
1jfaA           DERDQISLVKNYVVSDEISLHEALEKLTQDTLHSSKQMVAKDPQVMDTIECFMHGYVTWH----------
1ileA1          ----------------------------------------------------------------------
1bs2A2          ---IIEFSSP--NIAKPFHAGHLRSTIIGGFLANLYEKLGWEVIRMNYLGDWGGLLAVGFERYGNEEALV
2bl7A1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1j1uA           LKKDEKSAYIGFEPSGKIHLGHYLQIKKMIDLQNA----GFDIIILLADLHAYLN--------QKGELDE
1nzjA           -----YIGRFAPSPSGELHFGSLIAALGSYLQAR-----ARQGRWLVRIEDI-------------DPPRE
1mijA           ----------------------------------------------------------------------
1edzA2          -----------------PVFGNAQDQYLQQVVCKEKDVEGLNHVYYQNLY-HNVRYLDKENRLK------
1g59A2          -----------------PHVGTAYIALFNYAWAR---------------RNGGRFIVRIE---DTDRARY


                         .         .         *         .         .         .         .:140
query           VDRVSGRFKRAWDLLGIAYDDFIRTTEERHXXXXXXXXXXXYEAGDIYYGEYEGLYCVSCERFYTEKELV
1a8hA2          VDRVSGRFKRAWDLLGIAYDDFIRTTEERHKKVVQLVLKKVYEAGDIYYGEYEGLYCVSCERFYTEKELV
1f4lA2          IGEMSQEHQTDFAGFNISYDNYHSTHSEENRQLSELIYSRLKENGFIKNRTISQLYDPEKGMFLPD----
1ileA3          VFTYEKEWEAFTERIAYWVDLAYATLEPTYIESIWWSLKNLFDRGLLYRDHKVVPYCPRCGTPLSSHEVA
1rqgA2          VDEFHEQIKITFQRAKISFDFFGRTELPIHYKLSQEFFLKAYENGHLVKKVTKQAYCEHDKMFLPDR---
1gaxA3          RHDLGREILKQLKRLGASADWEAFTMDEKRSRAVRYAFSRYYHEGLAYRAPRLVNWCPRCETTLSDLEV-
1ffyA3          STAEFREKCKEFALEQIEFNDPYITLKPEYEAAQIRIFGEMADKGLIYKGKKPVYWSPSSESSLAEAEIE
1h3nA3          TYANIRQAKESLRLMGILYDWDVTTCEPEYYRWNQWIFLKMWEKGLAYRAKGLVNWCPKCQTVLANEQVV
1pxfA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1iq0A2          DGKEKYDHFAGRAYVRLHQDPEYERLQPAIEEVLHALERGELREEVNRILLAQMATMHALNARYDLLVWE
1a8hA1          ----------------------------------------------------------------------
1euqA2          WSGNVRYSSDYFDQLHAYAIELINKGLAYV---------------DELTPEQIREYRGTLTQPGKN----
1n1bA2          LQYLRKSVVDLVEAYFHEAKWYYTPSLDEYLNIAKISVASPAIISPTYFTFANASHDTAVIDSLYQYHDI
1d2rA           AALYLAVGIDPTQATLFIQSEVPAHAQAAWMLQCIVYIGELERMTQFKEKSAGAAAAAAGLLTYPPLMAA
1f9dA           GKSVSTSVGKATKMGDYLRYSFFDIGQPSQAGTGYDAAHYLLSWYYAWGGGIDSTWSWIIGSSHNHFGYQ
1b70B3          ----------------------------------------------------------------------
1li5A2          VDRMIAEMHKDFDALNILRPDMEPRATHHI-AEIIELTEQLIAKGHAYVADNGDVMFDVPTDPTYGVLSR
2p84A1          KGMSYAEQQDFDMGFTIWFDHIEDLDLIEKDGTINRIVMMSTGLKDKNVKEESDIVRNLYGELYVVEWL-
1irxA2          AEHFMRKFEEEVEKLGIEV-DLLYASELYKRGEYSEEIRLAFEKRDKIMEILNKYREIAKQPPLPENW--
1f4lA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1c4kA1          TKFGIPVFAVTKDAQAISADELKKIFHIILEFDATVNAREIETAVNNY----------------------
1qmyA           LHEGGPPALVIWNIKHLLHTGIGTASRPSEVCVVDGTDMSLQEHAVFACVTSNGWYAIDDEDFYPWTPDP
1jfaA           ------------LCDRRYRLSEIYEKVKEEKTEDAQKFCKFYEQAANVGAVSPSEWAYPPVAQLAN----
1ileA1          ----------------------------------------------------------------------
1bs2A2          KDPIHHRINKDIEEEGDSIPEYFKRMEDGD----EEALKIWKRFREFSIEKYIDTYAIKYDVYSGESQVS
2bl7A1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1j1uA           IRKIGDYNKKVFEAMGLKAKYVYGSEFQLD-KDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVI
1nzjA           VPGAAETILRQLEHYGLHWDGDVLWQSQRH-DAYREALAWLHEQGLSYYCTC------TRARIQSIGGIY
1mijA           ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1g59A2          VPGAEERILAALKWLGLSYDEGPDVAAPTGPYRQSERLPLYQKYGWAYRA-----FE-TPEELEQIRKEK


                         +         .         .         .         .         *         .:210
query           EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
1a8hA2          EGLCPIHGRPVERRKEGNYFFRMEKYRPWLQEYIQENPDLIRPEGYRNEVLAMLAEPIGDLSISRPKSRV
1f4lA2          --RFVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQE--WFESGLQQWDISRDAP---
1ileA3          YPHCWRCSTPLMYYATESWFIKNTLFKDELIRNNQEIHWVPPHIKEGRYGEWLKNLVDWALSRNRQVELA
1rqgA2          ---FAICGRPISFRDSAHYYIKMQDFAERLKRWIEKQPWKPNVKNMVLS---WIEEGLEERAITRLNWGI
1gaxA3          -ETCSRCGTPIEYAIFPQWWLRMRPLAEEVLKGLRRGDIAFVPERWKKEDCQAVNVPRPERYLEDPTSCE
1ffyA3          YPHDWRTKKPVIFRATEWVISRQRVWGVPLPVFYAENGEIIMTKETVNHVADLFAEHGSIWFEREAKDLL
1h3nA3          ERCWRHEDTPVEKRELEQWYLRITAYAERLLKDLEGLNWPEKVKAMQRAWIGRL----RDWLISRQR---
1pxfA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1iq0A2          ALALLEQSPHVFRPREGKYAGALVMDSPVIPGLEDPFFVLLRSNGTATYYAKDIAFQFWKMGILEGLRFR
1a8hA1          ----------------------------------------------------------------------
1euqA2          ---SPYRDRSVEENLALFEKMRAGGFEEGKACLRAKIDMASPFIVMRDPVLYRIKFAEHHQTGNKWCIYP
1n1bA2          LCLAGIILRLPD-----DLGDVPKTIQCYMKETN------ASEEEAVEHVKFLIREAWKDMPFPDGMVAG
1d2rA           DILLYNTDIVPVGEDQKQHIELTRDLAERFNKRYGELFTIPEARIPKVGAR-IMSLVDPTKKMSKSDPNP
1f9dA           NPFA-------AWVLSTDANFKPKNGASDWAKSLDRQLEFYQWLQSAEGAIAGGATNWNGRYEAVPSGTS
1b70B3          ----------------------------------------------------------------------
1li5A2          QKRNPMDFVLWKMSKEGEPSWPSPWGAGRPGWHIECSAMNCKQLGNHFDIHGGGSDMFPHHENEIAQSTC
2p84A1          -----DGSFVLTEFYNGGYDHYIIDSSTEYEVNIYENPELLEDD--------------------------
1irxA2          WPAMVYCPEHRREAEIIEWDGGWKVKYKCPEGH-----------------------------EGWVDIRS
1f4lA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1qmyA           SDVLV-----------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1bs2A2          KESML---KAIDLFKEKGLT------------HEDKGAVLIDLTKFNKKL--------------------
2bl7A1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1j1uA           YPINDIHYLGVDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGNFIAVDDSPEEIRAKIKKAY
1nzjA           DGHCPDNAAVRIRQQHPVTQFTDQLRGIIHADEKLAREDIHRRDGL------------------------
1mijA           ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1g59A2          GG-YDGRARNIERARRGEPHLKVPRPGTTEVK------DELRGVVYDNQ-------EIPDVVLLKSDGYP


                         .         .         .         +         .         .         .:280
query           PWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
1a8hA2          PWGIPLPWDENHVTYVWFDALLNYVSALDYPEGEAYRTFWPHAWHLIGKDILKPHAVFWPTMLKAAGIPM
1f4lA2          YFGFEIPNAPGKYFYVWLDAPIGYMGSFVSFDEYWKKDSTAELYHFIGKDIVYFHSLFWPAMLEGSNFRK
1ileA3          CACGGTMRRVPYVIDVWYDSGAMPFASLHYPFEEVFRESFPADFIAEGIDQTRGWSLHQLGVMLFGSIAF
1rqgA2          PVPLDEEDMKGKVLYVWFEAPIGYISITIEHFKRINIDGQTRVIHFIGKDNIPFHAIFWPAFLMAYGKYK
1gaxA3          ACGSPRLKRDEDVFDTWFSSALWPLSTLGWPEETDLKAFYPGDVLVTGYDILFLWVSRMEVSGYHFMRPF
1ffyA3          PEGFTHPGSPNGTFTKETDIMDVWFDSGSSHRETRPELSFPADMYLEGSDQYRGWFNSSITTSVATRGSP
1h3nA3          YWGTPIPMSPLEAHPSWYYLRYTDPHNDRLPDPEKANAWMPVDQYIGGVEHAVLHSRFFTKFLHDLGMVK
1pxfA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1iq0A2          PYENPYYPGLRTSAPEGEAYTPKAEETINVVDVRQSHALVRAALALAGEKAHHLAYETVLLEGRQMSGAV
1a8hA1          ----------------------------------------------------------------------
1euqA2          M----------------------------YDFTHCISDALEGITHSLCTLEFQDNRRLYDWVLDNITIPV
1n1bA2          AANIGRVA---QFIYLHGDGTYEHIAGL------------------------------------------
1d2rA           KAYITLLDDAKTIEKKIKSAVTDSEGTIRYDKEAKISNLLNIYSTLSGQSIEELERQYEGKGYGVFKADL
1f9dA           TGYVENPVYADPGSNTWFGMQVWSMQRV------------------------------------------
1b70B3          ----------------------------------------------------------------------
1li5A2          AHDGQYVNYWMHSGMVMVDREKMSKSLGNFF-------TVRDVLKYYDAETVRYFLMSGH----------
2p84A1          ----------------------------------------------------------------------
1irxA2          GNVKLRWRVDWPMRWSH----------------------FGVDFEPAGKDH-----LVAGSSYDTGKEII
1f4lA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1bs2A2          ---GKAIVQKSDGTTLYLTRDVGAAMDRYEKYH------FDKMIYVIASQQDLHAAQFF-EILKQMGFEW
2bl7A1          ---------------------------------------------------------IVHELYNDISISK
1h3nA1          ----------------------------------------------------------------------
1j1uA           CPAGVVEGNPIMEIAKYFL-----------EYPLTIKRPEKFGGDLTVNSYEELESLFK-----------
1nzjA           ----------------------------------------------------------------------
1mijA           ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1g59A2          TYHLANVVD---------DHLMGVTDVIRAEEWLVSTPIHVLLYRAFGWEA-----------------PR


                         .         *         .         .         .         .         +:350
query           YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEADLA
1a8hA2          YRHLNVGGFLLGPDGRKMSKTLGNVVDPFALLEKYGRDALRYYLLREIPYGQDTPVSEEALRTRYEAD--
1f4lA2          PSNLFVHGY-VTVNGAKMSKSRGTFIKASTWLNHFDADSLRYYYTAKSSRIDDIDLNLEDFVQRVNADIV
1ileA3          KNVICHGLILDE-KGQKMSKSKGNVVDPWDIIRKFGADALRWYIYVSAPPEADRRFGPNLVRETV-----
1rqgA2          LPYDIPANEYLTLEGKKFSTSRNWAIWVHEFLDVFPADYLRYYLTTIMPETRDSDFSFSDFKVRINEEL-
1gaxA3          KTVLLHGLVLDEK-GQKMSKSKGNVIDPLEMVERYGADALRFALIYLATGGQDIRLDLRWLEMAR-----
1ffyA3          YKFLLSHGFVMDGEGKKMSKSLGNVIVPDQVVKQKGADIARLWVSS-TDYLADVRISDEILKQTSD----
1h3nA3          FQGLFTQGMVLAWTDFGPVEVEGSVVRLPEPTRIRLEIPESALSLEDVRKMGAELRPHE-----------
1pxfA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1iq0A2          SVDEVLEEATRR-ARAIVEEKNPDHPDKEEAARMVALGAIRFSMVK-TEPKKQIDFRYQEA---------
1a8hA1          --------------------------------------------------------------------LA
1euqA2          HPRQYEFSR-LNLEYTVMSKRKLNLLVTDKHVEGWDDPRMPTISGLRRRYTAASIREFCKRIGVTKQDNT
1n1bA2          ----------------------------------------------------------------------
1d2rA           AQVVI-----------------------------------------------------------------
1f9dA           ----------------------------------------------------------------------
1b70B3          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1irxA2          KEVYGKEAPLSL-MYEFVGIKGQNVILLSDLYEVLEPGLVRFIYAR-HRPNKE-----------------
1f4lA1          ----------------------------------------------------------------------
1rqgA1          ----------------------------------------------------------------------
1c4kA1          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1ileA1          ----------------------------------------------------------------------
1bs2A2          AKDLQHVNFGM---VQGMSTRKGTVVFLDNILEETKEKMHE-----------------------------
2bl7A1          DPKYSDILEVXQKVYLKLEKQKYE-LDPSPLINRL-----VNYLYFTYTNKIRFTEYQEELI--------
1h3nA1          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1mijA           -----------------------NKNNTAQLVKWFSNFREFYYIQXEKYARQAVTESELYRVLNLHYNRN
1edzA2          ----------------------------------------------------------------------
1g59A2          FYHM---PLLRNPDKTKISKRKSHTSLDWYKAEGFLPEALRNYLCL------------------------


                         .         .         .         .         *         .         .:420
query           DDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAKRLRPLVRELKFHVALEEAMAYVKALNRYINE
1a8hA2          ----------------------------------------------------------------------
1f4lA2          N---------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1pxfA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1a8hA1          DDLGNLVQRTRAMLFRFAEGRIPEPVAGEELAEGTGLAGRLRPLVRELKFHVALEEAMAYVKALNRYINE
1euqA2          IEMASLESCIREDL--------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1f9dA           ----------------------------------------------------------------------
1b70B3          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1f4lA1          --VVNLASRNAGFINKRFDGVLASELADPQYKTFTDAAEVIGEAWESREFGKAVREIMALADLANRYVDE
1rqgA1          NNLGNFVHRALTFVNRYFDGVVPEELDREALEEIEKAFKEVGELIMNYRFKDALKRVMSLASFGNRYFDH
1c4kA1          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1ileA1          -NVYSFFVTYANLDRPDLKNPPPPEKRPEMLARMQDLIQRVTEALEAYDPTTSARALRDFVVEDQWYVRR
1bs2A2          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1h3nA1          NRIYRRVAEDREALLETSGVFQAEALEGKDYGKLHETLKKVTEDLEALRFNTAIAALMEFLNALYEYRKD
1j1uA           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1mijA           NH--IEVPQNFRFVVESTLREFFRAIQGGK----------------------------------------
1edzA2          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
1a8hA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1pxfA           ----------------------------------------------------------------------
1e7zA           ----------------------------------------------------------------------
1iq0A2          ----------------------------------------------------------------------
1a8hA1          KKPWELFKKEPEEARAVLYRVVEGLRIASILLTPAMPDKMAELRRALGLKEEVRLEEAERWGLAEPRPIP
1euqA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1f9dA           ----------------------------------------------------------------------
1b70B3          ----------------------------------------------------------------------
1li5A2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1f4lA1          QAPWVVAKQEGRDADAICSMGINLFRVLMTYLKPVLPKLTERAEAFLNTELTWDGIQ---QPLLGHKVNP
1rqgA1          KQPWKTAKEDKVRTGTTVNISLQIVKALGILLEPFLPDASEKIWHLLNLDEVKRWEFRE-LPAGHKVRKP
1c4kA1          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1ileA1          NRRRFWKNEDALDREAAYATLYEALVLVATLAAPFTPFLAEVLWQNLVRSV---RLEAKESVHLADWPEA
1bs2A2          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1h3nA1          RPVTPVYR--------------TAIRYYLQMLFPFAPHLAEELWHWFWPD--------------------
1j1uA           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1mijA           ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           EEAPVLFXXXXXXXXXXXXXXXWIGIEDFAKVELRVAEVLAAEKHPNADRLLVLRLSLGNEERTVVSGIA
1a8hA2          ----------------------------------------------------------------------
1f4lA2          ----------------------------------------------------------------------
1ileA3          ----------------------------------------------------------------------
1rqgA2          ----------------------------------------------------------------------
1gaxA3          ----------------------------------------------------------------------
1ffyA3          ----------------------------------------------------------------------
1h3nA3          ----------------------------------------------------------------------
1pxfA           -----------------------VAYADFARLEMRVGKIVEVKRHENADKLYIVQVDVGQKTLQTVTSLV
1e7zA           -------------------------PIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIARTVVSGLV
1iq0A2          ----------------------------------------------------------------------
1a8hA1          EEAPVLF---------------------------------------------------------------
1euqA2          ----------------------------------------------------------------------
1n1bA2          ----------------------------------------------------------------------
1d2rA           ----------------------------------------------------------------------
1f9dA           ----------------------------------------------------------------------
1b70B3          --------------------------PIPRGV--VFARVLEAHPIPG-TRLKRLVLDAG-RTVEVVSGAE
1li5A2          ----------------------------------------------------------------------
2p84A1          ----------------------------------------------------------------------
1irxA2          ----------------------------------------------------------------------
1f4lA1          FKA-------------------------------------------------------------------
1rqgA1          ETDDQIIYFILNYMAKGNPEGARILLDKYYKRE-DVIRVAKEKFGDEAEVVL------------------
1c4kA1          ----------------------------------------------------------------------
1qmyA           ----------------------------------------------------------------------
1jfaA           ----------------------------------------------------------------------
1ileA1          DPALA-----------------------------------------------------------------
1bs2A2          ----------------------------------------------------------------------
2bl7A1          ----------------------------------------------------------------------
1h3nA1          ----------------------------------------------------------------------
1j1uA           ----------------------------------------------------------------------
1nzjA           ----------------------------------------------------------------------
1mijA           ----------------------------------------------------------------------
1edzA2          ----------------------------------------------------------------------
1g59A2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           KWYRPEELVGKKVVLVANLKPAKLRGIESQGMILAAQEGEALALVTVEGEVPPGAVVK
1a8hA2          ----------------------------------------------------------
1f4lA2          ----------------------------------------------------------
1ileA3          ----------------------------------------------------------
1rqgA2          ----------------------------------------------------------
1gaxA3          ----------------------------------------------------------
1ffyA3          ----------------------------------------------------------
1h3nA3          ----------------------------------------------------------
1pxfA           PYYSEEELMGKTVVVLCNLQKAKMRGETSECMLLCAETDDESVLLTPERMMPAGV---
1e7zA           NHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRI-
1iq0A2          ----------------------------------------------------------
1a8hA1          ----------------------------------------------------------
1euqA2          ----------------------------------------------------------
1n1bA2          ----------------------------------------------------------
1d2rA           ----------------------------------------------------------
1f9dA           ----------------------------------------------------------
1b70B3          NAGVALALPGTELPLGQKVGERVIQGVRSFGMALSPREGGGL-LEFPEDALPPGTPLS
1li5A2          ----------------------------------------------------------
2p84A1          ----------------------------------------------------------
1irxA2          ----------------------------------------------------------
1f4lA1          ----------------------------------------------------------
1rqgA1          ----------------------------------------------------------
1c4kA1          ----------------------------------------------------------
1qmyA           ----------------------------------------------------------
1jfaA           ----------------------------------------------------------
1ileA1          ----------------------------------------------------------
1bs2A2          ----------------------------------------------------------
2bl7A1          ----------------------------------------------------------
1h3nA1          ----------------------------------------------------------
1j1uA           ----------------------------------------------------------
1nzjA           ----------------------------------------------------------
1mijA           ----------------------------------------------------------
1edzA2          ----------------------------------------------------------
1g59A2          ----------------------------------------------------------