[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81311.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "1pf4A1.bssp"
#ERROR : Can't open dsspfile "1m3eA1.bssp"
#ERROR : Can't open dsspfile "1e69A.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1bmfA3.bssp"
#ERROR : Can't open dsspfile "1ex6A.bssp"
#ERROR : Can't open dsspfile "1nijA1.bssp"
#ERROR : Can't open dsspfile "2gx8A1.bssp"
#ERROR : Can't open dsspfile "1urjA.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1c4oA1.bssp"
#ERROR : Can't open dsspfile "1khbA1.bssp"
#ERROR : Can't open dsspfile "1mukA.bssp"
#ERROR : Can't open dsspfile "1pv4A3.bssp"
#ERROR : Can't open dsspfile "1kgdA.bssp"
#ERROR : Can't open dsspfile "1t06A.bssp"
#ERROR : Can't open dsspfile "2iqhA1.bssp"
#ERROR : Can't open dsspfile "1i1qA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1ffhA2.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1bgxT2.bssp"
#ERROR : Can't open dsspfile "1mjgM.bssp"
#ERROR : Can't open dsspfile "1xbtA1.bssp"
#ERROR : Can't open dsspfile "1jjvA.bssp"
#ERROR : Can't open dsspfile "1qhdA1.bssp"
#ERROR : Can't open dsspfile "1mi8A.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "2gtlM1.bssp"
#ERROR : Can't open dsspfile "2vnuD1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1ckvA.bssp"
#ERROR : Can't open dsspfile "1dnpA2.bssp"
#ERROR : Can't open dsspfile "1l7lA.bssp"
#ERROR : Can't open dsspfile "1e3mA2.bssp"
#ERROR : Can't open dsspfile "1fl9A.bssp"
#ERROR : Can't open dsspfile "1qhlA.bssp"
#ERROR : Can't open dsspfile "1uouA3.bssp"
#ERROR : Can't open dsspfile "1ovmA2.bssp"
#ERROR : Can't open dsspfile "1mm8A.bssp"
#ERROR : Can't open dsspfile "1afrA.bssp"
#ERROR : Can't open dsspfile "1g6oA.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1atrA1.bssp"
#ERROR : Can't open dsspfile "1cd5A.bssp"
#ERROR : Can't open dsspfile "1zs3A1.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1cr0A.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "2je6I3.bssp"
#ERROR : Can't open dsspfile "1g8yA.bssp"
#ERROR : Can't open dsspfile "1tmkA.bssp"
#ERROR : Can't open dsspfile "1jqjA3.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1em8A.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "2ancF1.bssp"
#ERROR : Can't open dsspfile "1ni3A1.bssp"
#ERROR : Can't open dsspfile "1d6jA.bssp"
#ERROR : Can't open dsspfile "1sbxA.bssp"
#ERROR : Can't open dsspfile "3cddA2.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1f46A.bssp"
#ERROR : Can't open dsspfile "1b77A2.bssp"
#ERROR : Can't open dsspfile "1jbkA.bssp"
#ERROR : Can't open dsspfile "1s9hA.bssp"
#ERROR : Can't open dsspfile "1ohcA1.bssp"
#ERROR : Can't open dsspfile "1vhhA.bssp"
#ERROR : Can't open dsspfile "1j1zA2.bssp"
#ERROR : Can't open dsspfile "1esmA.bssp"
#ERROR : Can't open dsspfile "1t3wA.bssp"
#ERROR : Can't open dsspfile "1dhyA1.bssp"
#ERROR : Can't open dsspfile "1dwmA.bssp"
#ERROR : Can't open dsspfile "1tueA.bssp"
#ERROR : Can't open dsspfile "2gujA1.bssp"
#ERROR : Can't open dsspfile "1poiA.bssp"
#ERROR : Can't open dsspfile "1bs2A1.bssp"
#ERROR : Can't open dsspfile "1l3aA.bssp"
#ERROR : Can't open dsspfile "1ii8.1.bssp"
#ERROR : Can't open dsspfile "1jb1A.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1t9hA2.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1tljA.bssp"
#ERROR : Can't open dsspfile "1f8xA.bssp"
#ERROR : Can't open dsspfile "1g8fA3.bssp"
#ERROR : Can't open dsspfile "1iqrA2.bssp"
#ERROR : Can't open dsspfile "2pa7A1.bssp"
#ERROR : Can't open dsspfile "1a4iA2.bssp"
#ERROR : Can't open dsspfile "1l1oA.bssp"
#ERROR : Can't open dsspfile "2f9hA1.bssp"
#ERROR : Can't open dsspfile "1viaA.bssp"
#ERROR : Can't open dsspfile "2fggA1.bssp"
#ERROR : Can't open dsspfile "2vgmA3.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "1v47A1.bssp"
#ERROR : Can't open dsspfile "1np6A.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1es6A2.bssp"
#ERROR : Can't open dsspfile "1w1wA.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "1q3tA.bssp"
#ERROR : Can't open dsspfile "1ckeA.bssp"
#ERROR : Can't open dsspfile "1tpzA.bssp"

## Summary of PDB Search
:259
    6e-38  32%  1ji0A  [c.37.1.12] ABC TRANSPORTER
    1e-35  25%  1b0uA  [c.37.1.12] HISTIDINE PERMEASE
    7e-30  17%  1sgwA  [c.37.1.12] PUTATIVE ABC TRANSPORTER
    6e-28  25%  1l7vC  [c.37.1.12] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    4e-27  15%  1q3hA  [c.37.1.12] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-23  19%  1pf4A1 [c.37.1.12] TRANSPORT ATP-BINDING PROTEIN MSBA A:321 -- 564
    7e-23   8%  1m3eA1 [c.124.1.2] SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE
    5e-21  13%  1e69A  [c.37.1.12] CHROMOSOME SEGREGATION SMC PROTEIN
    2e-20  30%  1g6hA  [c.37.1.12] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-19   9%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    3e-19   7%  1bmfA3 [c.37.1.11] BOVINE MITOCHONDRIAL F1-ATPASE A:95 -- 379
    3e-19  10%  1ex6A  [c.37.1.1] GUANYLATE KINASE
    1e-18   8%  1nijA1 [c.37.1.10] HYPOTHETICAL PROTEIN YJIA A:2 -- 223
    3e-18  11%  2gx8A1 [c.135.1.1] NIF3-RELATED PROTEIN A:4 -- 373
    2e-16  14%  1urjA  [e.58.1.1] MAJOR DNA-BINDING PROTEIN
    2e-16   8%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    7e-16  11%  1c4oA1 [c.37.1.19] DNA NUCLEOTIDE EXCISION REPAIR ENZYME UVRB A:2
    7e-16   7%  1khbA1 [c.91.1.1] PHOSPHOENOLPYRUVATE CARBOXYKINASE, CYTOSOLIC
    7e-16   9%  1mukA  [e.8.1.4] MINOR CORE PROTEIN LAMBDA 3
    8e-16  11%  1pv4A3 [c.37.1.11] TRANSCRIPTION TERMINATION FACTOR RHO A:129 --
    9e-16   8%  1kgdA  [c.37.1.1] PERIPHERAL PLASMA MEMBRANE CASK
    2e-15   6%  1t06A  [a.118.1.17] HYPOTHETICAL PROTEIN
    2e-15   9%  2iqhA1 [e.75.1.1] NUCLEOCAPSID PROTEIN A:21 -- 489
    2e-15  10%  1i1qA  [d.161.1.1] ANTHRANILATE SYNTHASE COMPONENT I
    3e-15  35%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-15  12%  1ffhA2 [c.37.1.10] FFH A:89 -- 295
    1e-14  13%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    1e-14  12%  1bgxT2 [c.120.1.2] TAQ DNA POLYMERASE T:1 -- 173
    1e-13  10%  1mjgM  [e.26.1.3] CARBON MONOXIDE DEHYDROGENASE ALPHA SUBUNIT
    2e-13  10%  1xbtA1 [c.37.1.24] THYMIDINE KINASE, CYTOSOLIC A:18 -- 150
    2e-13  13%  1jjvA  [c.37.1.1] DEPHOSPHO-COA KINASE
    2e-13   6%  1qhdA1 [a.115.1.2] VIRAL CAPSID VP6 A:1 -- 148 A:333 -- 397
    2e-13  10%  1mi8A  [b.86.1.2] DNAB INTEIN
    1e-12  11%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    2e-12  11%  2gtlM1 [b.61.7.1] HEMOGLOBIN LINKER CHAIN L1 M:102 -- 225
    2e-12   9%  2vnuD1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP44 D:400 -- 494
    3e-12   9%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    3e-12  10%  1ckvA  [d.137.1.1] PROTEIN (PROTEIN B)
    4e-12  11%  1dnpA2 [c.28.1.1] DNA PHOTOLYASE A:1 -- 200
    4e-12  14%  1l7lA  [b.18.1.16] PA-I GALACTOPHILIC LECTIN
    7e-12  12%  1e3mA2 [c.37.1.12] DNA MISMATCH REPAIR PROTEIN MUTS A:567 -- 800
    1e-11  15%  1fl9A  [c.37.1.18] HYPOTHETICAL PROTEIN HI0065
    3e-11  14%  1qhlA  [c.37.1.12] PROTEIN (CELL DIVISION PROTEIN MUKB)
    4e-11  16%  1uouA3 [d.41.3.1] THYMIDINE PHOSPHORYLASE A:374 -- 480
    1e-10  14%  1ovmA2 [c.36.1.5] INDOLE-3-PYRUVATE DECARBOXYLASE A:3 -- 180
    5e-10   9%  1mm8A  [c.55.3.4] TN5 TRANSPOSASE
    5e-10   9%  1afrA  [a.25.1.2] DELTA9 STEAROYL-ACYL CARRIER PROTEIN DESATURASE
    6e-10  15%  1g6oA  [c.37.1.11] CAG-ALPHA
    6e-10  13%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    7e-10  15%  1atrA1 [c.55.1.1] HEAT-SHOCK COGNATE 70 KD PROTEIN A:2 -- 188
    8e-10  11%  1cd5A  [c.124.1.1] PROTEIN (GLUCOSAMINE 6-PHOSPHATE DEAMINASE)
    9e-10  13%  1zs3A1 [a.25.1.1] LACTOCOCCUS LACTIS MG1363 DPSA A:3 -- 173
    1e-09  10%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    1e-09  19%  1cr0A  [c.37.1.11] DNA PRIMASE/HELICASE
    1e-09  13%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    3e-09  21%  2je6I3 [d.51.1.1] EXOSOME COMPLEX RNA-BINDING PROTEIN 1 I:153 --
    3e-09  15%  1g8yA  [c.37.1.11] REGULATORY PROTEIN REPA
    3e-09  20%  1tmkA  [c.37.1.1] THYMIDYLATE KINASE
    3e-09   8%  1jqjA3 [d.131.1.1] DNA POLYMERASE III, BETA CHAIN A:245 -- 366
    4e-09   6%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    5e-09  16%  1em8A  [c.128.1.1] DNA POLYMERASE III CHI SUBUNIT
    5e-09  16%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    6e-09  17%  2ancF1 [c.37.1.1] GUANYLATE KINASE F:3 -- 206
    6e-09  17%  1ni3A1 [c.37.1.8] YCHF GTP-BINDING PROTEIN A:11 -- 306
    7e-09  18%  1d6jA  [c.37.1.4] ADENOSINE-5'PHOSPHOSULFATE KINASE
    8e-09   8%  1sbxA  [a.6.1.4] SKI ONCOGENE
    1e-08  16%  3cddA2 [b.106.1.1] PROPHAGE MUSO2, 43 KDA TAIL PROTEIN A:2 -- 180
    1e-08  11%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    3e-08   8%  1f46A  [d.129.4.1] CELL DIVISION PROTEIN ZIPA
    3e-08  14%  1b77A2 [d.131.1.2] PROTEIN (SLIDING CLAMP) A:111 -- 228
    3e-08  19%  1jbkA  [c.37.1.20] CLPB PROTEIN
    3e-08  14%  1s9hA  [c.37.1.20] REP 40 PROTEIN
    4e-08   7%  1ohcA1 [c.45.1.1] CDC14B2 PHOSPHATASE A:42 -- 198
    5e-08   5%  1vhhA  [d.65.1.2] SONIC HEDGEHOG
    6e-08   9%  1j1zA2 [d.210.1.1] ARGININOSUCCINATE SYNTHETASE A:171 -- 395
    9e-08  13%  1esmA  [c.37.1.6] PANTOTHENATE KINASE
    1e-07   9%  1t3wA  [a.236.1.1] DNA PRIMASE
    1e-07   8%  1dhyA1 [d.32.1.3] 2,3-DIHYDROXYBIPHENYL 1,2-DIOXYGENASE A:1 -- 132
    1e-07  15%  1dwmA  [d.40.1.1] LINUM USITATISSINUM TRYPSIN INHIBITOR
    2e-07  15%  1tueA  [c.37.1.20] REPLICATION PROTEIN E1
    1e-06  14%  2gujA1 [b.106.1.3] PHAGE-LIKE ELEMENT PBSX PROTEIN XKDM A:5 -- 143
    1e-06  12%  1poiA  [c.124.1.2] GLUTACONATE COENZYME A-TRANSFERASE
    2e-06   5%  1bs2A1 [a.27.1.1] PROTEIN (ARGINYL-TRNA SYNTHETASE) A:484 -- 607
    2e-06  10%  1l3aA  [d.18.1.2] P24: PLANT TRANSCRIPTIONAL REGULATOR PBF-2
    2e-06  12%  1ii8.1 [c.37.1.12] RAD50 ABC-ATPASE A:- -- - B:- -- -
    2e-06  16%  1jb1A  [c.91.1.2] HPRK PROTEIN
    3e-06   9%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    5e-06  11%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    5e-06  14%  1t9hA2 [c.37.1.8] PROBABLE GTPASE ENGC A:68 -- 298
    9e-06  11%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    2e-05  10%  1tljA  [d.282.1.1] HYPOTHETICAL UPF0130 PROTEIN SSO0622
    2e-05   5%  1f8xA  [c.23.14.1] NUCLEOSIDE 2-DEOXYRIBOSYLTRANSFERASE
    2e-05   8%  1g8fA3 [c.37.1.15] SULFATE ADENYLYLTRANSFERASE A:390 -- 511
    2e-05   8%  1iqrA2 [c.28.1.1] PHOTOLYASE A:2 -- 171
    2e-05  16%  2pa7A1 [b.82.1.1] DTDP-6-DEOXY-3,4-KETO-HEXULOSE ISOMERASE A:2 --
    3e-05   8%  1a4iA2 [c.58.1.2] METHYLENETETRAHYDROFOLATE DEHYDROGENASE / A:2 --
    3e-05   6%  1l1oA  [b.40.4.3] REPLICATION PROTEIN A 14 KDA SUBUNIT
    4e-05   5%  2f9hA1 [b.161.1.1] PTS SYSTEM, IIA COMPONENT A:3 -- 123
    5e-05  20%  1viaA  [c.37.1.2] SHIKIMATE KINASE
    5e-05   6%  2fggA1 [d.50.5.1] HYPOTHETICAL PROTEIN RV2632C/MT2708 A:4 -- 87
    5e-05  12%  2vgmA3 [d.79.3.2] DOM34 A:278 -- 381
    5e-05  33%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351
    6e-05  12%  1v47A1 [b.122.1.3] ATP SULFURYLASE A:4 -- 135
    7e-05  18%  1np6A  [c.37.1.10] MOLYBDOPTERIN-GUANINE DINUCLEOTIDE BIOSYNTHESIS
    1e-04  10%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    2e-04   8%  1es6A2 [b.31.1.1] MATRIX PROTEIN VP40 A:201 -- 321
    3e-04  30%  1w1wA  [c.37.1.12] STRUCTURAL MAINTENANCE OF CHROMOSOME 1
    4e-04   9%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    4e-04  15%  1q3tA  [c.37.1.1] CYTIDYLATE KINASE
    5e-04  29%  1ckeA  [c.37.1.1] PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
    7e-04  44%  1tpzA  [c.37.1.8] INTERFERON-INDUCIBLE GTPASE
:259

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRVLEVQGVTKRFGGLVAVNQVSLEVNEGEIFSVIGPNGAGKTTFFNLLTGIYTPDEGRILFLGQDITGS
1ji0A           --VLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQDITNK
1b0uA           ---LHVIDLHKRYGGHEVLKGVSLQARAGDVISIIGSSGSGKSTFLRCINFLEKPSEGAIIVNGQNINLV
1sgwA           ---LEIRDLSVGYDKPV-LERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPITK-
1l7vC           --VXQLQDVAEST----RLGPLSGEVRAGEILHLVGPNGAGKSTLLARXAGXT-SGKGSIQFAGQPLEAW
1q3hA           --LEKVSFSHLCLVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIKHSGRVSFCS
1pf4A1          ---VDVKDVTFTYKEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDVRDY
1m3eA1          ---------TKFY---TDAVEAVKDIPNGATVLVGGFGLCGIPENLIGALLKTGVKELTAVSNNAGVDNF
1e69A           -----------YLKGFKSFGRPSLIGFSDRVTAIVGPNGSGKSNIIDAIKWVFGEKFDMIFAGSENLPPA
1g6hA           MEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYFENKDITNK
1e9rA           --GGKLKRMTREKAKQVTVAGVPMPRAEPRHLLVNGATGTGKSVLLRELAYTGLLRGDRMVIVDPNGDM-
1bmfA3          PGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKKKLYCIY
1ex6A           -----------------------------RPIVISGPSGTGKSTLLKKLFAEYPDSFGFSVSSTTRTPRA
1nijA1          --------------------------NPIAVTLLTGFLGAGKTTLLRHILNEQHGYKIAVIENEFGE-VS
2gx8A1          ---------------------------------AGHIGNYSHCTFSSEGTGTFVPQQLRVVRIETIIPAS
1urjA           ----------RALLYLVVTEGFKEAVCINNTFLHLG--GSDKVTIGGAEVHRIPVYPLQLFMPDFSRVIA
1jalA1          ----------------------------GFKCGIVGLPNVGKSTLFNALTKAGPFCTIEPNTGVVPMPDP
1c4oA1          ----RYRGPSPKGDQPKAIAGLVEALRDGERFVTLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQL
1khbA1          ------------LAEHMLVLGITNPEGEKKYLAAAFPSACGKTNLAMMNPSLPGWKVECVGDDIAWMKFD
1mukA           MDETLMRARRHSYSSFSKLLEAYLLVKW-----RMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPM
1pv4A3          ----LFENLTPLHALTARVLDLASPIGRGQRGLIVAPPKAGKTXLLQNIAQSIAYNHPDCVLXVLLI-DE
1kgdA           --------------------------HMRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEE
1t06A           -----------------TVMQELEALGKERTKKIYISNGAHEPVFGVATGAMKPIAKKIKLNQELAEELY
2iqhA1          YDKEEIRRIWRQALTHMMIWHSNLNDATYQRTRALVRTGMDPRM-CSLMQGSTLPRRSGA--AGAAVKGG
1i1qA           TKVDRYSYVMHLVSRVELRHDLDALHAYRACMNMGTLSGAPKVRAMQLIADAEGQRRGSYGG--------
1vplA           ---VVVKDLRKRIGKKEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTLIKPSSGIVTVFGKNV---
1ffhA2          --------------------ARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQR-
1udwA           ---------------------------EPFLIGVSGGTASGKSSVCAKIVQLLQKQVVILSQDSFYRVLT
1bgxT2          ----------------------------------------------RGMLPLFEPKGRVLLVDGHHLA--
1mjgM           TRGIKLTKIKLDLPINFGPAFEGESIRKGDMYVEMGGNRTPAFELVRTVSESEITDGK-IEVIGPDIDQI
1xbtA1          ----------------------------GQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTR
1jjvA           ----------------------------TYIVGLTGGIGSGKTTIANLFTDLGVPL------VDADVVAR
1qhdA1          -----------------YIENWNLQNRRQRTSVLADASETMLANVTS-VRQEYAIPVGPVFPPGMNWTDL
1mi8A           --RVSIKDLLDEKDFEIAINEQTMKLESAKVS-RVFMTGKKLVYILKTRLGRTIKATANHRFLTIDGWKR
2v3jA1          -------------------PVLTSKDKITKRXIVVLAXASLETHKIYVLLNCD-DHQGLLKKXGRDISEA
2gtlM1          AIVTITAAHRKSFFPLRATLSYELDEHDHTVSTTQLRGFYNFGKRELLLAP-LKGQSEGYGVICDFNLGD
2vnuD1          --RIRTRRAAELLDKRIVISIDSWPTTLGHFVRDLGTIESAQAETEALLLEHDVEYR-------------
1n25A           ----------------------VYNIPKKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFE
1ckvA           ---AGIMGLKGKDFADQFFADENQVVHESDTVVLVLKKSDEINTFIEEILLTDYKKNVNPTVNVEDRAGE
1dnpA2          ----------------------------------------------------------------------
1l7lA           -------------------GEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHP--D
1e3mA2          --GIRITEGREQVLNEPFIANPLNLSPQRRXLIITGPNXGGKSTYXRQTALIALXAYIGSYVPAQKVE--
1fl9A           TQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAGKTTLTRGMLQGIGHQGNVKSPTYTLVEEY
1qhlA           ---GKFRSLTLINWN--GFFARTFDL-DELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLLHGKLKAGDT
1uouA3          ----------------------------------------------------------------------
1ovmA2          --VIDSPDICWVGCELNASYAADGYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAA
1mm8A           ----------------------------------------------------------------------
1afrA           --------------PREVHVQVTHSMPPQKIEIFKSLDNWAEENILVHLKPVEKCWQPQDFLPDPASDG-
1g6oA           SFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIXEFIPKEERIISIEDTEEIVF
1yr6A1          ------------------------------IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKE
1atrA1          -------------------KGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGD
1cd5A           AGQVSFKHVVTFNMEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSY
1zs3A1          ----------------------------------------------------------------------
1zp6A1          ---------------------------GGNILLLSGHPGSGKSTIAEALANLPGVPKVHF-----HSDDL
1cr0A           ------ESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVG---LAMLE
1ak2A1          ----------------------------GVRAVLLGPPGAGKGTQAPKLAKNFCVCHLATGDMLRAMVAS
2je6I3          -------------------NGIVIDIMPVKVPRVIGKNKSMYETLTS--KSIFVANNGRIWAFSEEILIE
1g8yA           ---HKPINILEAFAAPPPLDYVLPNMVAGTVGALVSPGGAGKSM--------------------------
1tmkA           ----------------------------GKLILIEGLDRTGKTTQCNILYKKLQPNCKLLKF--------
1jqjA3          -----------------KFRGVRLYVSENQLKITANNPEQEEAEEIL-----------DVTYSGAEMEIG
1grqA           ----------------------------TRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAM-
1em8A           ----------------------------------------------------------------------
1e6cA           -----------------------------EPIFMVGARGCGMTTVGRELARALGYEFVDTDIFMQHTSGM
2ancF1          ---------------------------QGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQEAIEQVLATGV
1ni3A1          ----------------------WGRPGNNLKTGIVGXPNVGKSTFFRAITKSVLGNPANYPYATIDPE--
1d6jA           ------------ASALTRSERTELRNQRGLTIWLTGLSASGKSTLAVELEHQLVRDRRVHAYR-------
1sbxA           ----------------------------------------------------------------------
3cddA2          --VLKAGGKITKIGITRSLEAXSGAFDLEXTYKFLGNDAQYKAFIE------------------------
2yyeA2          ----------------------QSGAQVGQLLILTKPIGTGILIKGLKEGILKEEDINEAIENMLALNDK
1f46A           -------------------------------------------IIMNVAAHHGSELNGELLL--------
1b77A2          ------------------VASVITEIKAEDLQQLLR-----VSRGLQIDTIAITNKDGKIVINGYNKVED
1jbkA           ---AEQGKLDPVIGRDEEIRRTILQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPEGLKGRRV---
1s9hA           -KILELNGYDPQYAASVFLGWATKKFGKRNTIWLFGPATTGKTNIAEAIAHTVPFYGCVNWTNENFPFND
1ohcA1          ------------------------------------------------------DPQDDVYLDITDRLCF
1vhhA           ----------------------------------------------------------------------
1j1zA2          ----------------------------------------------------------------------
1esmA           LPLSRLLNFYISSNAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTA------------------------
1t3wA           -----------------------------------------KRTTXRILIGLQNPELATLVPPLENLD--
1dhyA1          ----------------------------------------------------------------------
1dwmA           ----------------------------------------------------------------------
1tueA           -QFLRYQQIEFI-TFLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISFVNSTSHFW-L
2gujA1          --------------------------------------KKGSDPYFTLQAVLDDQSSGRVTLYDVNFDSA
1poiA           -----------------LKDAIAKYVHSGDHIALGGFTTDRYAAVFEILRQGITDLTGLGGAAGGDWDML
1bs2A1          ----------------------------------------------------------------------
1l3aA           ---------------------------------------------------------GYSIYKGKAALTV
1ii8.1          MKLERV-----TVKNFRSHSDTVVEFKEG-INLIIGQNGSGKSSLLDAILVGLYWPLRIKDIKKDEF---
1jb1A           -----------------SXHGVLVDI-YGLGVLITGDSGVGKSETALELVQRGHRLIADDRV--------
1e2hA           ----------------------------LLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVL----
1lw7A2          -----------------------ARPFFAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEK-
1t9hA2          ----------------------------------------------------LIHTSGGLVADTPGFSSL
2axpA1          ------------------------------LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSG-
1tljA           -------------LREKALNKIYHDKEIGYLDPDILGFLLAFYRNRNDVYT-QSSCSGRITIVDAEMPWD
1f8xA           ----------------------------------------------------------------------
1g8fA3          -------------------------PKQGFSIVLGNSLTVSREQLSIALLSTFLQFGGGRYYKIFEHNN-
1iqrA2          ----------------------------------------------------------------------
2pa7A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1l1oA           -----------------RINAGMLAQFIDKPVCFVGRLEKIHPTG--KMFILSDGEGKNGTIELMEPLDE
2f9hA1          ----------------------------------------------------------------------
1viaA           -----------------------------KNIVFIGFXGSGKSTLARALAKVFLDSD----FLIEQKFNQ
2fggA1          ----------------------------------------------------------------------
2vgmA3          ----------------------------------------------------------------------
1yj5A2          -----------------------------EVVVAVGFPGAGKSTFIQEHLVSA-----------------
1v47A1          ----------------------------------------------------------------------
1np6A           ----------------------------IPLLAFAAWSGTGKTTLLKKLIPALCARGIRPGLIKHT----
2qgmA1          ----------------------------------------------------------------------
1es6A2          ----------------------------------------------------------------------
1w1wA           -------------------GVTKVGFGESNFTSIIGPNGSGKSNMMDAI---------------------
1pgsA2          -------------------------EKAYLRTTISGWGHAKPYDAGSRGCAEWCFRTHTIAINNANT---
1q3tA           ----------------------------TIQIAIDGPASSGKSTVAKIIFGFTYLDTGAMY---RAATYM
1ckeA           ----------------------------APVITIDGPSGAGKGTLCKAMLQWHLLDSGAIYRV-------
1tpzA           -------------------------------VAVTGETGSGKSSFINTLRGIGNEEEG------------


                         .         .         *         .         .         .         .:140
query           TPDKAAKLGIGRTFQNIRLFGAMTVLENILVGRHIHTRVPYLHALLRTPXXXXXXXXXXXXXXXXXXYVG
1ji0A           PAHVINRXGIALVPEGRRIFPELTVYENLXXGAYNRKDKEGIKR---------------DLEWIFSLFPR
1b0uA           RDKDGQLKVLTMVFQHFNLWSHMTVLENVMEAPIQVLGLSKHDARERAL-------------KYLAKVGI
1sgwA           -----VKGKIFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMD------------------ALESV
1l7vC           SATKL-ALHRAYLSQQQTPPFATPVWHYLTLHQHDKTRTELLNDVAG--------------------ALA
1q3hA           QFSWIMPGTIKENIIFGVSYDEYRYKSVVKACQLQQDI--------------------------TKFAEQ
1pf4A1          KLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMP-----------QG
1m3eA1          GLGLLLQSKISSYVGENAEFERQYLAGELEVELTPQGTLAERIRAGG------------AGVPAFYTSTG
1e69A           GSAYVEL-VFEENGEEITVARGLGVDFYSIVGQGQIDRIVNAYQRVNESFNRFISLLFFGGEGRLEISIR
1g6hA           EPAELYHYGIVRTFQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKKWIPKEEEMVEKAFKILEFLKLS
1e9rA           --LSKFGRDKDIILNPYDQRTKGWSFFNEIRNDYDWQRYALSVVPRG---------------KTDEAEEW
1bmfA3          VAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAP-----------YSGCSMGEYFRDNGK
1ex6A           GEVN----GKDYNFVSVDEFKSMIKNNEFIEWAQFSGNYYGSTVASVKQ---------------VSKSGK
1nijA1          VDDQLIGDRATQIKTLTNGCICCSRSNEL------------EDALL-------DLLDNLDKGNIQFDRLV
2gx8A1          LQRKVIKAMVTAHPYEEVAYDVYPLDNKGETLGLGKIGYLQEEM------------------TLGQFAEH
1urjA           EPANHRSIGEKFTYPLPFFNRPLNRLLFEAVVGPA-----------------------------------
1jalA1          RLDALAEIVKPERILPTTME--FVDIAGLVAGASKGEGLGNKFLANIRE--------------TDAIGHV
1c4oA1          AAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTR--------------S
1khbA1          AQGHLRA--INPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSD------------GGVYWEGID
1mukA           LQSTRKY--FAQTLFMAKTVSGLNAIDSALLRLRTLGADK-------------------KALTAQLLMVG
1pv4A3          RPEEVTEXQRLVKGEVVASTFDEPASRHVQVAEXVIEKAKRLV-------------------------EH
1kgdA           NGKNYYFVSHDQMMQDISNNEYLE--YGSHEDAMYGTKLETIRKIH----------------------EQ
1t06A           ATGNYD---AMYFAGIIADPK-AMSESDFDRWIDGAYFYMLSDYVVAVTLSES----------------N
2iqhA1          TMVMELIRMIKRGINRRTRIAYERMCNILKGKFQTAAQRTMVDQVRE-------------SRNPGNAEFE
1i1qA           --------AVGYFTAHGDLDTCIVIRSALVENGIAT----------------------------------
1vplA           ----------------------------------------------------------------------
1ffhA2          ---------PAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVE-----------------------EKA
1udwA           SEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVS-----------------------
1bgxT2          -------------YRTFHALKGLTTSRGEPVQAVYGFAKSLLKALKEDGDAVIVVFD----------AKA
1mjgM           PEGSKLPLGILVDIYGRKMQADFEGVLERRIHDFINYGEGLWHTGQR-------------------NINW
1xbtA1          ALPACLLRDVAQEALGVAVIGIDEGQFFPD-IVEFCEAMANAGKT-----------------------VI
1jjvA           AKDSPLLSKIVEHFGAQILNRAAL-------RERVFNHDEDKLWLNN---------------------LL
1qhdA1          ITNYSP---SREDNLQRVFT-VASIRSMLV----------------------------------------
1mi8A           LDELSLKEHIALPRKSDISW-DSIVSITETGVEEVF----------------------------------
2v3jA1          RPDITHQCLLTLLDSPINKAGKLQVYIQTSRGILIEVNPTVRIPRTFKR---------------FSGLXV
2gtlM1          DDHADCKISSLFVCAHFNAQ--------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1n25A           VAIDQFLVVFEDVKGTGGESRGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFP-------------PGI
1ckvA           VDCDEISELLGRQFNVYDFL-VDVSSTIGRAYT-------------------------------------
1dnpA2          --------------THLVFRQDLRLHDNL---ALAAACR--NSSARV---------------------LA
1l7lA           QGLICHDAFCGALVMKIGNSGTIPV-NTGLFRWVAPNNVQGAITLIY-----------------------
1e3mA2          ----------------------------------------------------------------------
1fl9A           NIA-----GKMIYHFDLYRLADPEELEFMGIRDYFN----------------------------------
1qhlA           INSRHQRVVVGVRLQQVARDRKVDIKPFAIQGLPMSVQ--------------------------------
1uouA3          ----------------------------------------------------------------------
1ovmA2          QQRGE---LLHHTLGDGEFRHFYHMSEPITVAQAVLTEQNACYEIDR-----------------------
1mm8A           -----------SVFSSAALGTARLVNVAAQLAKYSGKSITISSEGSK------------AAQEGAYRFIR
1afrA           ----------------------------------------------------------------------
1g6oA           KHHK----NYTQLFFGGNITSADCLKSCLRXRPDRI----------------------------------
1yr6A1          LPYEPSIDVREFVTVEEIMREGYGPNGAI-----------------------------------------
1atrA1          AAKN------------------------------------------------------------------
1cd5A           GKIHLFMGGVGNDGHIAF----------------------------------------------------
1zs3A1          DEKYAKELDKAEIDHHKPTAGAMLVLSNLFIENGIYAKSPVKCEYLR-------------------EIAQ
1zp6A1          WGYIKHGRIDPWLPQSHQQNRXIXQIAADVAGRYAKEGYFVILDGVVRP----------DWLPAFTALAR
1cr0A           ESVEETAEDLIGLHNRVRLRQSDSLKREII----------------------------------------
1ak2A1          GSELGKK--LKATMDAGKLVSDEMVLELIEKNLETPPCKNGFLL----------DGFPRTVRQAEMLDDL
2je6I3          AIRKIEN---------------------------------------------------------------
1g8yA           ----------------------------------------------------------------------
1tmkA           ----------------------------------------------------------------------
1jqjA3          FNVSYVLDVLNALKCENVRM-MLTDSVSSVQIE-------------------------------------
1grqA           PLKMQSAEGGIEFDADGGVSIGPEFRALEGAWAEGVVAMARAGA----------------------RIII
1em8A           ----------------------------------------------------------------------
1e6cA           TVADVVEGWPGFRRRESEALQAVATPNRVVATGGGM----------------------------------
2ancF1          DVFLDIDWQGAQQIR-------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1sbxA           ----------------------------------------------------------------------
3cddA2          ----------------------------------------------------------------------
2yyeA2          ARNLMLSLDATAGFGLLGHAWNICKNSNIGARIFFE----------------------------------
1f46A           ----NSIQQAGFIFGDMNIYHRHLSPDGSGPALFSLANMVKPGTFDPEM-------------KDFTTPGV
1b77A2          SGLTRPKYSLTLTDYDSNNFNFVINMANMKIQPGNY----------------------------------
1jbkA           ----------------------------------------------------------------------
1s9hA           CVDK----MVIWWEEGKMTAKVVESAKAILGG--------------------------------------
1ohcA1          AIYSRPKSASNVHYFSIDELEYENFYADFGPLNLAMVYCCKINKKLKS--------------------IT
1vhhA           ---------------------------------------------------------------------T
1j1zA2          ----------------------------------------------------------------------
1esmA           ----------------------------------------------------------------------
1t3wA           ------ENKLPGLGLFRELVNTCLSQPGLTTGQLLEHYRGTNNAATL----------------EKLSXWD
1dhyA1          --------------------------------------------------------------------PA
1dwmA           ----------------------------------------------------------------------
1tueA           EPLTDTKVAMLDDATTTCWTYFDTYMRNALDGNPISIDPLI-----------------------------
2gujA1          KIASLDEEEVPFTFEDFDV---------------------------------------------------
1poiA           INGRVKAYINCYTANSGVTNVSRRFRKWFEAGKLTMEDYS------------------------------
1bs2A1          ----------------------------------------------------------------------
1l3aA           EPRS--PEFSPLDSGAFKLSREGMVMLQFAPAAGVRQYDWSRKQVFS------------LSVTEIGSIIS
1ii8.1          ---------------------------------------------------------------------E
1jb1A           ----------------------------------------------------------------------
1e2hA           GASETIANIYTTQHRLDQGEISAGDAAVVMTSAQITMGMPYAVTDAVLAPHIGGEAGSPPPALTLIFDRH
1lw7A2          ----------------------------------------------------------------------
1t9hA2          EFTDIEEEELGYTFPDIREKSSSCKFRGCLHLKEPKCAV--KQAVED---------------------GE
2axpA1          --NEKLFEHFNKLADEDNVIIDRFVYSNLVYAKKFK----------------------------------
1tljA           RKN---STIIFKNHLRITEQDLEDVLSKNQVRRLWLIVQGPIIHIYAK------------NIETGWDILK
1f8xA           ----------------------------------------------------------------------
1g8fA3          ------KTELLSLIQDFIGSGSGLIIPDQWEDDKDSVVG-------------------------------
1iqrA2          --------------------------------------------------------------------GP
2pa7A1          ----------------------------------------------------------------------
1a4iA2          ----------------------------------------------------------------------
1l1oA           EISGIVEVVGRVTAKAT--ILCTSYVQFKEDSHPF-----------------------------------
2f9hA1          ---TEIGKHAIDDSEKXIILFGETATDTLKQHAVIQSFPEKDQV---------------TLAEGDHLKIG
1viaA           KVSEIFEQ--------------------------------------------------------------
2fggA1          --------------------------------------------------------------------IE
2vgmA3          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------------------------------------
1np6A           ----------------------------------------------------------------------
2qgmA1          --------------------------------------------------------------------KS
1es6A2          ------------------LRPGISFHPKLRPILLPNKNSADLTSPEKI-----------QAIMTSLQDFK
1w1wA           ----------------------------------------------------------------------
1pgsA2          FQHQLGALGCSANPINNQSP-GNWTPDRA-----------------------------------------
1q3tA           ALKNQLGVQHPISFGRSETGDQLVFVGDVDITHPIR----------------------------------
1ckeA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LLHRKDELARNLPYGEQRKLEIXXXXXXXXXXXXXXXXXXGMNPKETEALQEFILKIRSEMGLTILLIEH
1ji0A           LKERLKQLGGTLSGGEQQXLAIGRALXSRPKLLXXDEPSLGLAPILVSEVFEVIQKINQE-GTTILLVEQ
1b0uA           DERAQGKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLA-EEGKTMVVVTH
1sgwA           EVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVIISSRE
1l7vC           LDDKLGRSTNQLSGGEWQRVRLAAVVLQITPQANPAGQLLSLDVAQQSALDKILSALC-QQGLAIVXSSH
1q3hA           DNTVLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKL--MANKTRILVT
1pf4A1          LDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQ--KNKTVLVIAH
1m3eA1          YGTLVQEGGSPIKYNKDGSIAIASKPREVREFNGQHFILEEAIRGDFALVKAWKA--DQAGNVTFRKSAR
1e69A           KPGRRDQKLSLLSGGEKALVGLALMEIKPSPFYVLDEVDSPLDDYNAERFKRLLKENSKHT--QFIVITH
1g6hA           --HLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHV-LELKAKGITFLIIEH
1e9rA           ASYGRLLLRETAKKLALIGTPSMRELFHWTTIATFDDLRGFLEGTLAESLFAGSNEASKALTSARFVLSD
1bmfA3          HALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDAFGGGSLTALPVIETQAG
1ex6A           TCILDIDMQGVKSVKAIPELNARFLFIAPPSVEDLKKRLEGRGTETEESINKRLSAAQAELAYDKVIVND
1nijA1          IECTGMADPGPIIQTFFSHEVLCQRYLLDGVIALVDAVHADEQMNQ----FTIAQSQVGYADRILLTKTD
2gx8A1          VKQSLDVKGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHVAHDAMMLGLNIVDPGH
1urjA           ----------------------------------------------------------------------
1jalA1          VRCFENIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELSVMEKILPVLENAGMIRSVG
1c4oA1          LLTRRDVIVVASVSAIYGLGDPREYRARNLVGFVLFPATHYLSP---EGLEEILKEIEKELRVRYFEERG
1khbA1          EPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAWESPEGVPIEGIIFGGRRPAGVPLV
1mukA           LQESEDALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLLPKDGRH----------LNTD
1pv4A3          KKDVIILLDSITRLARAYNTVV------PAVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDT
1kgdA           GLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQR--LQKESDILQRTYAHYFDLTIINN
1t06A           IAQDVADKWIASGDELKMSAGWSCYCWLLGNRKDNAFSESDMLEMVKDTIHHSPERTKSAMNNFLNTVVP
2iqhA1          DLIFLARSALILRGSVAHKSCL-------PACVYGSAVASGYDFEREGYSLVGIDPFRLLQNSQVYSLIR
1i1qA           ----------------------------------------------------------------------
1vplA           ------------------------------------------------------------EGLTILVSSH
1ffhA2          RLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTK
1udwA           --HSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTR-LSRRVLRDISERGRDLEQILS
1bgxT2          PSFRHEAYGGYKAGRAPTPEDFPRQLALIKELVDLLGLAREVPGYEADDVLASLAKKAEKEGYEVRILTA
1mjgM           LRVSKDAVAKGFRFKNYGEILVAKMKEEFPAIVDRVQVTIFTDEAKVKEYMEVAREKYKERDDRMRGLTD
1xbtA1          VAALDGTFQRKPFGAILNLVPL------------------------------------------------
1jjvA           HPAIRERMKQKLAEQTAPYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARS---ANFEQIQRIMNSQV
1qhdA1          ----------------------------------------------------------------------
1mi8A           ----------------------------------------------------------------------
2v3jA1          QLLHKLSIRSEEKLLKVIKNPITDHLPTKCRKVTLSFDAPVIRVQDYIEKLD---DDESICVFVGAXARG
2gtlM1          ----------------------------------------------------------------------
2vnuD1          ----------------------------------------------------------------------
1n25A           VTMNEYSVPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEKRIIQSGIALLLMLIWYRPVAEFAQSIQSR
1ckvA           ----------------------------------------------------------------------
1dnpA2          LYIATPRQWATHNMSPQAELINAQLNGLQIALAEKGIPLLFREVDDFVASVEIVKQVCAENSVTHLFYNY
1l7lA           ----------------------------------------------------------------------
1e3mA2          ----------------------------------------------------------------------
1fl9A           ----------------------------------------------------------------------
1qhlA           ----------------------------------------------------------------------
1uouA3          -------------------------------------------REQEELLAPADGTVELVRALPLALVLH
1ovmA2          ----------------------------------------------------------------------
1mm8A           NPNVSAE--AIRKAGAMQTVKLAQEFPELLAIEDT------TSLSYRHQVAEELGKLGSIQDKSRGWWVH
1afrA           ---------------------------------------------------QICGTIAADEKRHETAYTK
1g6oA           ----------------------------------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1atrA1          ----------------------------------------------------------------------
1cd5A           ----------------------------------------------------------------------
1zs3A1          REVEYFFKISDLLLDENEIVPSTTEEFLKYHKFITEDPKAKYWTDE-----DLLESFIVDFQAQNMFITR
1zp6A1          PLHYIVLRTTAAEAIERCLDRGGDSLSDPLVVADLHSQFADLGAFEHHVLPVSGKDTD-QALQSAINALQ
1cr0A           ----------------------------------------------------------------------
1ak2A1          MEKRKEKLDSVIEFSIPDSLLIRRITGRLIHSDDNKKALKIRLEAYHTQTTPLVEYYSKRGIHSAIDASQ
2je6I3          ----------------------------------------------------------------------
1g8yA           ---------------------------------------------------------------------H
1tmkA           -----------------------------------------------------------------TFMKL
1jqjA3          ----------------------------------------------------------------------
1grqA           DDVFLGGAAAQERWRSFVGDLDVLWVGVRCDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTT
1em8A           ----------------------------------------VDGLSAVEQLVCEIAAERWRSGKRVLIACE
1e6cA           ----------------------------------------------------------------------
2ancF1          ----------------------------------------------------------------------
1ni3A1          ----------------------------------------------------------------------
1d6jA           ----------------------------------------------------------------------
1sbxA           -----------------------------------------LNSVLRDFSLQQINAVCDELHIYCSRCTA
3cddA2          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1f46A           TIFMQVPSYGDELQLFKLMLQSAQHIADEVGGVVLDDQRRMMTPQKLREYQDIIREVKDAN---------
1b77A2          ----------------------------------------------------------------------
1jbkA           ----------------------------------------------------------------------
1s9hA           ----------------------------------------------------------------------
1ohcA1          MLRKK--IVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRGSCNFYITLLDCFH
1vhhA           LGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVT
1j1zA2          ----------------------------------------RVDIVENRFVGMKSRGVYETPGGTILYHAR
1esmA           ---------------------------------------------------------------SIYVDAP
1t3wA           DIADKNIAEQTFTDSLNHXFDS--LLELRQEELIARERTHGLSNEERLELWTLNQELA------------
1dhyA1          WDHFLTKSVGLMAAGSAGDAALYRADQRAWRIAVQPGELDDLAYAGLEVDAAALERMADKLRQAGVAFTR
1dwmA           -----------------------------------------------NMAAATVERENRN-VHAIVLKEG
1tueA           ----------------------------------------------------------------------
2gujA1          ----------------------------------------------------------------------
1poiA           ----------------------------------------------------------------------
1bs2A1          -----QYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRNAI-KTHEPTTVVTY
1l3aA           LGKDSCEFFHDPNKGRSDEGRVRKVLKVEPLPDGSGH---FFNLSVQNKLINLDEN------IYIPVTKA
1ii8.1          RPLTFLSGGERIALGLAFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYL-KKIPQVILVSH
1jb1A           ----------------------------------------------------------------------
1e2hA           PIAALLCYPAARYLMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDRLAKRQRPGERLDLAMLAA
1lw7A2          ----------------------------------------------------------------------
1t9hA2          LKQYRYDHYVEFMTEIDRK---------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1tljA           IAREAGFKHSGILATNQKGVLVELRTGIRMVHLLRESNTERVDKDKIKTLVNVCNEVLAR-GKQKMNLLK
1f8xA           --------AGWFTDRQNKAYKEAMEALKENPTIDLENSYVPLDNQYKGIRVDEHPEYLHDKVWATATYNN
1g8fA3          ----------------------------------------------------------------------
1iqrA2          VVGLVVLDPNNLKTTPRRRAWFLENVRALREAYR------ARGGALWVLEGLPWEKVPEALKAKAVYALT
2pa7A1          ------------------------------------------------------------DCVMMVLASD
1a4iA2          -------------------------------------------AQIRARLKNQVTQLKEQVPGFTPRLAI
1l1oA           ----------------------------------------------------------------------
2f9hA1          DTNYTITKVGSFANSNLQSIAH-------STLIFADAPTDEDDVIRNGVYLTPHQLPKITIGTTIDYL--
1viaA           ----------------------------------------------------------------------
2fggA1          EHDERTRAKARLSWAGRQXVGVGLARL--------------DPADEVAQIGDEIARALSDLANQLFALTS
2vgmA3          ----------------------------------------SDNIAQREEYLKLMDSVE-SNGGKALVLST
1yj5A2          ----------------------------------------------------------------------
1v47A1          ----------------------------------------PVKGFMTREEALSVAHEMRLPTGEVWLLQF
1np6A           ----------------------------------------------------------------------
2qgmA1          IQSQANPLKTIEPSKPFEDLKPLKKXIGNAQYVGLGENTHGSSEIFTXKFRLVKYLVTEXGF-TNFAXEE
1es6A2          IVPIDPT--KNIMGIEVPETLVLKLTGGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASL---
1w1wA           ----------------------------------------------------------------------
1pgsA2          ----------------------------------------------------------------------
1q3tA           ----------------------------------------------------------------------
1ckeA           ----------------------------------------------------------------------
1tpzA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DMRLVMRISDRIAVLDYGSKIAEGKPEEVRTNPRVIEAYLxxxxxxxxx
1ji0A           NALGALKVAHYGYVLETGQIVLEGKASELLDNEXVRKAYL---------
1b0uA           EMGFARHVSSHVIFLHQGKIEEEGDPEQVFGNPQS--------------
1sgwA           ELSY----CDVNENLHKYS------------------------------
1l7vC           DLNHTLRHAHRAWLLKGGKXLASGRREEVLTPPNLAQAY----------
1q3hA           SKMEHLRKADKILILHQGSSYFYGTFSELQSLPDFSSKLM---------
1pf4A1          RLS-TIEQADEILVVDEGEIIERGRHAD---------------------
1m3eA1          NFNLPXCKAAETTVVEVEEIVDIGSFAPEDIHI----------------
1e69A           NKI-VMEAADLLHGVTMVNGVSAIVPVEV--------------------
1g6hA           RLDIVLNYIDHLYVMFNGQIIAEGRGEEELSDPKVVEIYI---------
1e9rA           KLPEHVTMPDGDFSIRSWLEDPNG-------------------------
1bmfA3          D--VSAYIPTNVISITDGQIFLETELFYKGIRPAI--------------
1ex6A           DLDKAYKELKDFIFAE---------------------------------
1nijA1          VAGEAEKLHERLARINARAPVYTVTHGDI--------------------
2gx8A1          NVEMKQGVQKQLQEKVDAKKLNVHIHASLHTDPFIF-------------
1urjA           -------------------------------------------------
1jalA1          LDKEELQAIKSYNFLTLKPTMYIANVNEDGFENNPYLDRV---------
1c4oA1          EV-----------------------------------------------
1khbA1          YEALSW---QHGVFVGAAMRSEAKIIMHDPFAM----------------
1mukA           IPPRMGWLRAILRFLGAGMVMTATGVEDIHGGGRSLGQRF---------
1pv4A3          GSKXDEVIYEEFKGTGNXELHLSRKIAEKRVFPAI--------------
1kgdA           EIDETIRHLEEA-------------------------------------
1t06A           LHEKAVEIAKEVGIVEVKRDNKKSSLLNASES-----------------
2iqhA1          PNENPAHKSQLVWMACHSAAFEDLRVSSFIRGTKVVPRG----------
1i1qA           -------------------------------------------------
1vplA           NMLEVEFLCDRIALIHNGTIVETGTVEELKERYKAQNIE----------
1ffhA2          LDGDAGGAALSARHVTGKPIYFAGLEPFYP--ERLAGRIL---------
1udwA           QYITFVKPAFEEFCLPTK-------------------------------
1bgxT2          DKDLYQLLSDRIHVLHPEGYLITPA------------------------
1mjgM           SCVLCQSFPNHVCIVTPERVGLCGAVSWLDAKASY--------------
1xbtA1          -------------------------------------------------
1jjvA           SQQERLKWADDVINNDAELAQNLPHLQQKVLELH---------------
1qhdA1          -------------------------------------------------
1mi8A           -------------------------------------------------
2v3jA1          KDNFADEYVDEKVGLSNYPLSASVACSKF--------------------
2gtlM1          -------------------------------------------------
2vnuD1          -------------------------------------------------
1n25A           IVEWKERLDKEFSLSVYQFNVAMGIG-----------------------
1ckvA           -------------------------------------------------
1dnpA2          QYEVNERARDVEVERALRNVVCEGFDDSVILPPGAVMTGN---------
1l7lA           -------------------------------------------------
1e3mA2          -------------------------------------------------
1fl9A           -------------------------------------------------
1qhlA           -------------------------------------------------
1uouA3          ELGALRLGVGAELLVDVGQRLRRGTPWLRVH------------------
1ovmA2          -------------------------------------------------
1mm8A           SVLLLEATTFRTVGLLHQEWWMRPDDPADADEKE---------------
1afrA           IVEKLFEIDPDGTVLAFADMMRKKISMP---------------------
1g6oA           -------------------------------------------------
1yr6A1          -------------------------------------------------
1atrA1          -------------------------------------------------
1cd5A           -------------------------------------------------
1zs3A1          AIKLANKEEK-FALAA----GVVELYGYNLQVIRNLAGDL---------
1zp6A1          SGRFRI-------------------------------------------
1cr0A           -------------------------------------------------
1ak2A1          TPDVVFASILAA-------------------------------------
2je6I3          -------------------------------------------------
1g8yA           AVLVNIRWQSYLSSMTSAEAEEWGVDDDQRRFFVRFGV-----------
1tmkA           LDKEIRKGDESITIVDVTNKGIQEVEALIW---QIVEPVL---------
1jqjA3          -------------------------------------------------
1grqA           HKE-SIECAWAIA------------------------------------
1em8A           DEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVE------------
1e6cA           -------------------------------------------------
2ancF1          -------------------------------------------------
1ni3A1          -------------------------------------------------
1d6jA           -------------------------------------------------
1sbxA           DQLEILKVXGILPFSAPSCGLITTDAERLCNALL---------------
3cddA2          -------------------------------------------------
2yyeA2          -------------------------------------------------
1f46A           -------------------------------------------------
1b77A2          -------------------------------------------------
1jbkA           -------------------------------------------------
1s9hA           -------------------------------------------------
1ohcA1          AVKKAMQYG----------------------------------------
1vhhA           EGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLA---------
1j1zA2          RAVESLTLDREVLHQRDMLSPKYAELVYYGFWYAPEREAL---------
1esmA           EDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAI----------
1t3wA           -------------------------------------------------
1dhyA1          GDEA--LMQQRKVMGLLCLQDPFGLPLEIYYGPA---------------
1dwmA           SAMTKDFRCDRVWVIVNDHGVVTSVP-----------------------
1tueA           -------------------------------------------------
2gujA1          -------------------------------------------------
1poiA           -------------------------------------------------
1bs2A1          LFKLTH---QVSSCYDVLWVAGQTEELATARLALY--------------
1l3aA           EFAVLVSAFNFVMPLGWHTAVNSFKPE----------------------
1ii8.1          DEE-LKDAADHVIRISLENGSSKV-------------------------
1jb1A           -------------------------------------------------
1e2hA           IRRVYGLLANTVRYLQCGGSWREDWGQLSGPRPHIGDTLF---------
1lw7A2          -------------------------------------------------
1t9hA2          -------------------------------------------------
2axpA1          -------------------------------------------------
1tljA           D------------------------------------------------
1f8xA           DLNG-IKTNDIMLGVYIPDEEDVGLGMELGYALSQ--------------
1g8fA3          -------------------------------------------------
1iqrA2          SHTPYGRYRDGRVR-----------------------------------
2pa7A1          YYDETDYIRQYDNFKKYIAKIN---------------------------
1a4iA2          LQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPR---------------
1l1oA           -------------------------------------------------
2f9hA1          -------------------------------------------------
1viaA           -------------------------------------------------
2fggA1          SDIEAST------------------------------------------
2vgmA3          LHSLGEELDQLTGI-----------------------------------
1yj5A2          -------------------------------------------------
1v47A1          REKPRVGPGNTVALLHGGERVALLHVAE---------------------
1np6A           -------------------------------------------------
2qgmA1          DWGNGLKLNEYIQTGKGNPREFLKLLYPTDEII----------------
1es6A2          -------------------------------------------------
1w1wA           -------------------------------------------------
1pgsA2          -------------------------------------------------
1q3tA           -------------------------------------------------
1ckeA           -------------------------------------------------
1tpzA           -------------------------------------------------