[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81342.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2jovA1.bssp"

## Summary of PDB Search
:236
    2e-13   9%  2jovA1 [d.349.1.1] HYPOTHETICAL PROTEIN CPE0013 A:1 -- 77
:236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2jovA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHALRE
2jovA1          -----------------------------------------------------------------HKDIF


                         +         .         .         .         .         *         .:210
query           LGVREEPLLLLQNAGAEILPWEAWEECCGFGGLFSVKLPEVSLAMADRKLATLPKAEVLTSTDxxxxxxx
2jovA1          TSVRVRGSKKYNVVPVKSNKPVEISKWIDFSNVLSRLYVGVPTKSGNVVCKNIMNVDIICTKN-------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxx
2jovA1          --------------------------