[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81487.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1x42A1.bssp"
#ERROR : Can't open dsspfile "1cqzB1.bssp"
#ERROR : Can't open dsspfile "2gfhA1.bssp"
#ERROR : Can't open dsspfile "2hszA1.bssp"
#ERROR : Can't open dsspfile "1aq6A.bssp"
#ERROR : Can't open dsspfile "2hdoA1.bssp"
#ERROR : Can't open dsspfile "2fdrA1.bssp"
#ERROR : Can't open dsspfile "1lvhA.bssp"
#ERROR : Can't open dsspfile "2g80A1.bssp"
#ERROR : Can't open dsspfile "1fezA.bssp"
#ERROR : Can't open dsspfile "1cqzA1.bssp"
#ERROR : Can't open dsspfile "1u7oA.bssp"
#ERROR : Can't open dsspfile "2hcfA1.bssp"
#ERROR : Can't open dsspfile "2go7A1.bssp"
#ERROR : Can't open dsspfile "1judA.bssp"
#ERROR : Can't open dsspfile "2c4nA1.bssp"
#ERROR : Can't open dsspfile "2ah5A1.bssp"
#ERROR : Can't open dsspfile "2fi1A1.bssp"
#ERROR : Can't open dsspfile "1qyiA.bssp"
#ERROR : Can't open dsspfile "2b0cA1.bssp"
#ERROR : Can't open dsspfile "1ynsA1.bssp"
#ERROR : Can't open dsspfile "2o2xA1.bssp"
#ERROR : Can't open dsspfile "1f5sA.bssp"
#ERROR : Can't open dsspfile "1wviA.bssp"
#ERROR : Can't open dsspfile "2fprA1.bssp"
#ERROR : Can't open dsspfile "1te2A.bssp"
#ERROR : Can't open dsspfile "2feaA1.bssp"
#ERROR : Can't open dsspfile "1pw5A.bssp"
#ERROR : Can't open dsspfile "2g7jA1.bssp"
#ERROR : Can't open dsspfile "1xpjA.bssp"
#ERROR : Can't open dsspfile "1rkuA.bssp"
#ERROR : Can't open dsspfile "1g61A.bssp"
#ERROR : Can't open dsspfile "2bduA1.bssp"
#ERROR : Can't open dsspfile "2gmwA1.bssp"
#ERROR : Can't open dsspfile "1yj5A1.bssp"
#ERROR : Can't open dsspfile "1nrwA.bssp"
#ERROR : Can't open dsspfile "1ymqA1.bssp"

## Summary of PDB Search
:219
    1e-27  24%  1x42A1 [c.108.1.1] HYPOTHETICAL PROTEIN PH0459 A:1 -- 230
    5e-27  26%  1cqzB1 [c.108.1.2] EPOXIDE HYDROLASE B:4 -- 225
    9e-25  24%  2gfhA1 [c.108.1.6] HALOACID DEHALOGENASE-LIKE HYDROLASE DOMAIN A:1
    3e-23  24%  2hszA1 [c.108.1.6] NOVEL PREDICTED PHOSPHATASE A:1 -- 224
    1e-22  25%  1aq6A  [c.108.1.1] L-2-HALOACID DEHALOGENASE
    2e-20  24%  2hdoA1 [c.108.1.6] PHOSPHOGLYCOLATE PHOSPHATASE A:1 -- 207
    4e-19  15%  2fdrA1 [c.108.1.6] CONSERVED HYPOTHETICAL PROTEIN A:3 -- 224
    2e-17  21%  1lvhA  [c.108.1.6] BETA-PHOSPHOGLUCOMUTASE
    2e-16  11%  2g80A1 [c.108.1.22] PROTEIN UTR4 A:17 -- 241
    4e-16  16%  1fezA  [c.108.1.3] PHOSPHONOACETALDEHYDE HYDROLASE
    7e-16  29%  1cqzA1 [c.108.1.2] EPOXIDE HYDROLASE A:4 -- 225
    5e-15  21%  1u7oA  [c.108.1.17] MAGNESIUM-DEPENDENT PHOSPHATASE-1
    7e-15  18%  2hcfA1 [c.108.1.6] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY A:2
    1e-14  17%  2go7A1 [c.108.1.6] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY A:3
    2e-14  19%  1judA  [c.108.1.1] L-2-HALOACID DEHALOGENASE
    3e-14  12%  2c4nA1 [c.108.1.14] PROTEIN NAGD A:1 -- 250
    1e-13  24%  2ah5A1 [c.108.1.6] COG0546: PREDICTED PHOSPHATASES A:1 -- 210
    2e-13  14%  2fi1A1 [c.108.1.3] HYDROLASE, HALOACID DEHALOGENASE-LIKE FAMILY A:4
    5e-13  23%  1qyiA  [c.108.1.13] HYPOTHETICAL PROTEIN
    8e-13  21%  2b0cA1 [c.108.1.2] PUTATIVE PHOSPHATASE A:8 -- 204
    1e-11  13%  1ynsA1 [c.108.1.22] E-1 ENZYME A:4 -- 256
    3e-11  24%  2o2xA1 [c.108.1.19] HYPOTHETICAL PROTEIN A:8 -- 216
    1e-10  18%  1f5sA  [c.108.1.4] PHOSPHOSERINE PHOSPHATASE (PSP)
    5e-10  30%  1wviA  [c.108.1.14] PUTATIVE PHOSPHATASES INVOLVED IN N-ACETYL-
    5e-10  20%  2fprA1 [c.108.1.19] HISTIDINE BIOSYNTHESIS BIFUNCTIONAL PROTEIN
    1e-09  21%  1te2A  [c.108.1.6] PUTATIVE PHOSPHATASE
    7e-09  13%  2feaA1 [c.108.1.20] 2-HYDROXY-3-KETO-5-METHYLTHIOPENTENYL-1- A:2 --
    2e-08  28%  1pw5A  [c.108.1.14] NAGD PROTEIN, PUTATIVE
    6e-08  11%  2g7jA1 [d.198.5.1] PUTATIVE CYTOPLASMIC PROTEIN A:1 -- 112
    2e-07  10%  1xpjA  [c.108.1.18] HYPOTHETICAL PROTEIN
    2e-07  12%  1rkuA  [c.108.1.11] HOMOSERINE KINASE
    3e-07   9%  1g61A  [d.126.1.1] TRANSLATION INITIATION FACTOR 6
    8e-07  15%  2bduA1 [c.108.1.21] CYTOSOLIC 5'-NUCLEOTIDASE III A:7 -- 297
    9e-07  12%  2gmwA1 [c.108.1.19] D,D-HEPTOSE 1,7-BISPHOSPHATE PHOSPHATASE A:24
    3e-06  35%  1yj5A1 [c.108.1.9] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:144 --
    4e-04  32%  1nrwA  [c.108.1.10] HYPOTHETICAL PROTEIN, HALOACID DEHALOGENASE-LIKE
    7e-04  22%  1ymqA1 [c.108.1.10] SUGAR-PHOSPHATE PHOSPHATASE BT4131 A:2 -- 261
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVRALTFDVGNTLILASPRFWLLPLLEARGLRPRGDVRKAALEAFRFYEENHLKARDLETALGLWREFHR
1x42A1          -IRAVFFDFVGTLLGEAKTHLKIXEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPIRDIEEEVXR
1cqzB1          --RVAAFDLDGVLALPSIAGAFRRSEEALAL-PRDFLLGAYQTEFPEGPTEQLMKGKITFSVPLMDESYR
2gfhA1          -VRAVFFDLDNTLI-DTAGASRRGMLEVIKLLQSKYHYKEEAEIICDKVQVKLSKECFHCITDVRTSHWE
2hszA1          --KLIGFDLDGTLVNSLP-----------------DLALSINSALKDVNLPQASENLVXTWIGNGADVLS
1aq6A           MIKAVVFDAYGTLFVQSVADATERAYPGRGEYITQVWRQKQLE----YSWLRALMGRYADFWGVTREALA
2hdoA1          --QALXFDIDGTLTNSQP-----------------AYTTVXREVLATYGKPFSPAQAQKTFPXAAEQAXT
2fdrA1          --DLIIFDCDGVLVDSEI-----------------IAAQVESRLLTEAGYPISVEEXGERFAGXTWNILL
1lvhA           MFKAVLFXLDGVITDTAEFRAWKALAEEIGINGVDRQFNE-----------QLKGVSREDSLQKILDLAD
2g80A1          -YSTYLLDIEGTVCPISFVKE-----TLFPYFTNKVPQLVQQDTRDSPVSNILSQFHIDNKEQLQAHILE
1fezA           -IEAVIFDWAGTTVFAPLEVFMVAITAEEARKPMGLLKIDHVRALTEMPRIASEWNRVFRQLPTEADIQE
1cqzA1          ----------------------------------------------------------------------
1u7oA           ----------------------------------------------------------------------
2hcfA1          --TLVLFDIDGTLL-----------------KVESXNRRVLADALIEVYGTEGSTDFSGKXDGIYEVLSN
2go7A1          --TAFIWDLDGTLLDSYE-----------------AILSGIEETFAQFSIPYDKEKVREFIFKYSVQDLL
1judA           -IKGIAFDLYGTLFDVHS-------VVGRCDEAFPGRGREISALWRQKQLEYTWLRSLMNRYVNFQQATE
2c4nA1          -IKNVICDIDGVLMHDNVAVPFLHGIMDKGLPLNRFATAGVDVPDSVFYTSAMATADFLRRQEGKKAYVV
2ah5A1          -ITAIFFDLDGTLVDSSI-----------------GIHNAFTYTFK---ELGVPSPDAKTIRGFXGPPLE
2fi1A1          -YHDYIWDLGGTLL-----------------DNYETSTAAFVETLALYGITQDHDSVYQALKVSTPFAIE
1qyiA           -------------------------------------KNNIYAALEEFATTELHVSDATLFSLLAQEVYQ
2b0cA1          ----YIFDLGNVIV-DIDFNRVLGAWSD--------LTRIPLASLKKSFHMGEAFHQHERGEISDEAFAE
1ynsA1          EVTVILLDIEGTTTENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASVDDLQQMIQAVVD
2o2xA1          ----------------------------------------------------------------------
1f5sA           KKKLILFDFDSTLVNNETIDEIA---REAGVEEEVKKITKEAMEGKLNFEQSLRKRVSL-----LKDLPI
1wviA           ----------------------------------------------------------------------
2fprA1          ----------------------------------------------------------------------
1te2A           -ILAAIFDXDGLLIDSEP-----------------LWDRAELDVXASLGVDISRRNELPDTLGLVVDLWY
2feaA1          ----------------------------------------------------------------WXALKD
1pw5A           -----------------------------------------------------------------QDYVR
2g7jA1          ----------------------------------------------------------------------
1xpjA           ----------------------------------------------------------------------
1rkuA           -MEIACLDLEGVLVPEIWIA----FAEKTGIDALKATTRDIPDYDVLMKQ------RLRILDEHGLKLGD
1g61A           ----------------------------------------------------------------------
2bduA1          ------TDFDXTLSRFSYNGKRCPIIDNCKLVTDECRRKLLQLKEQYYAIEVDPVLTVEEKFPYXVEWYT
2gmwA1          --------------------------------------------------------DRDGTINVDHGYVH
1yj5A1          ----------------------------------------------------------------------
1nrwA           ----------------------------------------------------------------------
1ymqA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RLLVGMGLEDHAEALSRELVARWKDPATWPLVPGAEATLKALKAKGYPLAVVSNWDATLPEILEVVGLGR
1x42A1          KLAEKYGFK-YPENFWE--IHLRXHQRYGELYPEVVEVLKSLKGK-YHVGXITDSDEYLXAHLDALGIKD
1cqzB1          K---------SSKACGANLPENFSISQIFSQAMAARSAAIALKKKGFTTCIVTNGDKRDSLAQMMCELSQ
2gfhA1          EAIQETKGGADNRKLAEECYFLWKSTRLQHMIDDVKAMLTELR-KEVRLLLLTNGDRQTQRKIEACACQS
2hszA1          QRAVDWACKQAEKELTEDEFKYFKRCNISRLYPNVKETLEALKAQGYILAVVTNKPKHVQPILTAFGIDH
1aq6A           YTLGTLGLE-PDESFLADMAQAYN---RLTPYPDAAQCLAELA--PLKRAILSNAPDMLQALVANAGLTD
2hdoA1          ELGIAASEFDHFQAQYEDVXASHYDQI--ELYPGITSLFEQLPSE-LRLGIVTSQRRNELEGXRSYPFXX
2fdrA1          QVESEASIPLSASLLDKEKLLDXRLERDVKIIDGVKFALSRLTTPRCICSNSSSHRLDXXLKVGLKPYFA
1lvhA           KKVSAEEFKELAKRKNDNYVKMIQDVSPADVYPGILQLLKDLRSNKIKIALASASK-NGPFLLERMNLTG
2g80A1          LVAKDVKDPILKQLQGYVWAHGYES---GQIKAPVYADAIDFIKRKKRVFIYSSGSVKAQKLLHDSLDLN
1fezA           -------MYEEFEEILFAILPRYASP-----INAVKEVIASLRERGIKIGSTTGYTREMMDVAKEAALQG
1cqzA1          --------------------------AARSINRPMLQAAIALKKKGFTTCIVTNGDKRDSLAQMMCELSQ
1u7oA           ---------------SSDGTVRDRRGQNIQLYPEVPEVLGRLQSLGVPVAAASRTSEGANQLLELFDLGK
2hcfA1          VGLERAEIADKFDKAKEALFRERARREDITLLEGVRELLDALSSRDVLLGLLTGNFASGRHKLKLPGIDH
2go7A1          VRVAEDRNLDVEVLNQVRAQSLAEKNAQVVLXPGAREVLAWADESGIQQFIYTHKGNNAFTILKDLGVES
1judA           DALRFTCRHLGLDLDARTRSTLCDAYLRLAPFSEVPDSLRELKRRGLKLAILSNGSQSIDAVVSHAGLRD
2c4nA1          GEGALIHELYKAGFTITDVNPDFVIVGETRSYNWDMMHKAAYFVANGARFIATNDTHGRGFYPACGALCA
2ah5A1          SSFATCLSKDQISEAVQIYRSYYKAKGIYQLFPQIIDLLEELSSS-YPLYITTTKDSTAQDXAKNLEIHH
2fi1A1          TFAP-----NLENFLEKYKENEARELEHPILFEGVSDLLEDISNQGGRHFLVSHRNDQVLELEKTSIAAY
1qyiA           EWYLGSKLYEDVEKIARTTFKTYQEIILRP-VDEVKVLLNDLKGAGFELGIATGRYTETVVPFENLGLLP
2b0cA1          ALC-----HEMALPLSYEQFSHGWQAVFVALRPEVIAIMHKLREQGHRVVVLSNTNRLHTTFWEYPEIRD
1ynsA1          NVCWQMSLDRKTTALKQLQGHMWRGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSEAQKLLFGHSTEGD
2o2xA1          -----------------------SDPAEIVLRPQXLPAIATANRAGIPVVVVTNQSGIARELLREEGVFV
1f5sA           EKVEKAIKRIT-------------------PTEGAEETIKELKNRGYVVAVVSGGFDIAVNKINRLIVKD
1wviA           ----------------------------------------------------------------------
2fprA1          ----------------------------LAFEPGVIPQLLKLQKAGYKLVMITNQDGLGTQSQIFTSQGV
1te2A           ARQPWNGPSRQEVVERVIARAISLVEETRPLLPGVREAVALCKEQGLLVGLASASPLHXLKVLTXFDLRD
2feaA1          GVLKTLSIKEGVGRXFGLLPSSLKELEDAKIREGFREFVAFINEHEIPFYVISGGDFFVYPLLEGIVNDY
1pw5A           KLRXGVDVPDDAVVTSGEITAEHRFGRCRIFLLGTPQLKKVFEAYGHPDFVVLGFDATHPDINCPSKEGP
2g7jA1          -------YRRGENYVYVNREARMGRTALIIH-PRLKDRSSSLADPASDIKTCDHYQYLGGETHEHYGIPH
1xpjA           ----------------------------VLPRLDVIEQLREYHQLGFEIVISTANMRTYEGNVGKINIHT
1rkuA           IQEVIA---------------------TLKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLGFPT
1g61A           -----------------------------EIIKSKNTALGNLILTNDKGALISPVEVEIGTIAELPTVGS
2bduA1          K----SHGLLIEQGIPKAKLKEIVADSDVXLKEGYENFFGKLQQHGIPVFIFSAIGDVLEEVIRQAGVYH
2gmwA1          EIDNFEFIDGVIDAMRELKKMGFALVVTNQSGIARGKFTEAQFETLTEWMDWSLADRDDLDGIYYCPHHP
1yj5A1          -----------------------TSPSDWILYPEIPKKLQELAAEGYKLVIFTNFKGKVEAVLE--KLGV
1nrwA           ----------------------------------------------------------------------
1ymqA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           YFDHLSVSALSGYAKPDPRLFREALEALGVSPEEAVHVGDAEADLLGAEAVGMRALLFDPLGENPKALPR
1x42A1          LFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDPVKDCGGSKNLGXTSILLDRKGEKREFWDK
1cqzB1          HFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVH---NTASALRE
2gfhA1          YFDAIVIGGEQKEEKPAPSIFYHCCDLLGVQPGDCVMVGDTETDIQGGLNAGLKATVW------------
2hszA1          LFSEXLGGQSLPEIKPHPAPFYYLCGKFGLYPKQILFVGDSQNDIFAAHSAGCAVV--------------
1aq6A           SFDAVISVDAKRVFKPHPDSYALVEEVLGVTPAEVLFVSSNGFDVGGAKNFGFSVARVARLSQ-------
2hdoA1          RXAVTISADDTPKRKPDPLPLLTALEKVNVAPQNALFIGDSVSDEQTAQAANVDFGLXDPNADHQKVAHR
2fdrA1          PHIYSAKDLGADRVKPKPDIFLHGAAQFGVSPDRVVVVEDSVHGIHGARAAGXRVIGFTGASHTYPSH--
1lvhA           YFDAIADPAEVAASKPAPDIFIAAAHAVGVAPSESIGLEDSQAGIQAIKDSGALPIGVGRPEDLGDDIVI
2g80A1          SYIDGYFDINTSGKKTETQSYANILRDIGAKASEVLFLSDNPLELDAAAGVGIATGLASRPGNAPVPDGQ
1fezA           YKPDFLVTPDDPAGRPYPWMCYKNAMELGVYPNHMIKVGDTVSDMKEGRNAGMWT---------------
1cqzA1          HFDFLIESCQVGMIKPEPQIYNFLLDTLKAKPNEVVFLDDFGSNLKPARDMGMVTILVHNTAS---ALRE
1u7oA           YFIQREI-----YPGSKVTHFERLHHKTGVPFSQMVFFDDENRNIIDVGRLGVTCIHIR-----------
2hcfA1          YFPFGAFADDALDRNELPHIALERARRANYSPSQIVIIGDTEHDIRCARELDARSIAVATGNFTXEELAR
2go7A1          YFTEILTSQSGFVRKPSPEAATYLLDKYQLNSDNTYYIGDRTLDVEFAQNSGIQSINFLESTYEGNHR--
1judA           GFDHLLSVDPVQVYKPDNRVYELAEQALGLDRSAILFVSSNAWDATGARYFGFPTCWINRTGNVFEEM--
2c4nA1          GIEKISGRKPFYVGKPSPWIIRAALNKMQAHSEETVIVGDLRTDILAGFQAGLETILVLSGVSSLDDIDS
2ah5A1          FFDGIYGSSPEAPHKADV--IHQALQTHQLAPEQAIIIGDTKFDXLGARETGIQKLA-------------
2fi1A1          FTEVVTSSS---GFKRKPNPESMLYLREKYQISSGLVIGDRPIDIEAGQAAGLDTHLFTSIVNLRQVL--
1qyiA           YFEADFIATASPLGKPNPFSYIAALYGNNVNKDDVFIVGDSLADLLSAQKIGATFI--------------
2b0cA1          AADHIYLSQDLGMRKPEARIYQHVLQAEGFSPSDTVFFDDNADNIEGANQLGITSILVKDKTTIPDYFAK
1ynsA1          ILELVDHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAE---------------------
2o2xA1          AGVGPLAIPDHPXRKPNPGXLVEAGKRLALDLQRSLIVGDKLADXQAGKRAGLAQGW-------------
1f5sA           GKLTGDVEGEVLKENAKGEILEKIAKIEGINLEDTVAVGDGANDISMFKKAGLK----------------
1wviA           -------------GKPEAVIMNKALDRLGVKRHEAIMVGDYLTDITAGIKNDIATLLVTTGFTKPEEVPA
2fprA1          QFDEVLICPHLPADEDCRKPKVKLVERYLMDRANSYVIGDRATDIQLAENMGINGLRYDRETLNWPMI--
1te2A           SFDALASAEKLPYSKPHPQVYLDCAAKLGVDPLTCVALEDSVNGXIASKAARXRSIVVPA----------
2feaA1          IHIDWPHSCKGTCSNQCGCCKPSVIHELSEPNQYIIXIGDSVTDVEAAKLSDLCF---------------
1pw5A           VPDAGSIXAAIEASKPNPLVVDVISEKFGVPKERXAXVGDLYTDVKLGKNAGIVSILVLTGETTPEDLER
2g7jA1          GFSSR-IALERYLNGLFG----------------------------------------------------
1xpjA           LPIITEWLDEILVGKPWCGHDGFYIDDRAVRPSEFASNLEEIHQLFEK----------------------
1rkuA           LLCHKLEIDDSDYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTMLSEAHA-----------------
1g61A           NAVVTNKGCL-THPLVEDDELEFLKSLFKVEYIGKGTANKGTTSVGACIIANSKGAV-------------
2bduA1          SNVKVGFKGELIHVFNKHDGALKNTDYFSQLKDNIILLGDSQGDLRXADGVAN-----------------
2gmwA1          QGSVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITPE--
1yj5A1          PFQVLVATHAGLNRKPVSHLQEQANEGIPISVEDSVFVGDAAADRLFALNVGLP----------------
1nrwA           ---------------------KRLAKQLNIPLEETAAVGDSLNDKSXLEAAG------------------
1ymqA1          --------------------IDEIIRHFGIKLEETMSFGDGGNDISMLRHAA------------------


                         .         .         .         +         .         .         .:280
query           LERVLDYLx
1x42A1          CDFIVS---
1cqzB1          LEKVT----
2gfhA1          ---------
2hszA1          ---------
1aq6A           ---------
2hdoA1          FQKPLDIL-
2fdrA1          ---------
1lvhA           ---------
2g80A1          KYQVYKNF-
1fezA           ---------
1cqzA1          LEKVTG---
1u7oA           ---------
2hcfA1          HK-------
2go7A1          ---------
1judA           ---------
2c4nA1          MPFRPSW--
2ah5A1          ---------
2fi1A1          ---------
1qyiA           ---------
2b0cA1          V--------
1ynsA1          ---------
2o2xA1          ---------
1f5sA           ---------
1wviA           LPIQPDF--
2fprA1          ---------
1te2A           ---------
2feaA1          ---------
1pw5A           AETKPDF--
2g7jA1          ---------
1xpjA           ---------
1rkuA           ---------
1g61A           ---------
2bduA1          ---------
2gmwA1          ---------
1yj5A1          ---------
1nrwA           ---------
1ymqA1          ---------