[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81497.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1vk3A2.bssp"
#ERROR : Can't open dsspfile "1vk3A1.bssp"
#ERROR : Can't open dsspfile "1t3tA6.bssp"
#ERROR : Can't open dsspfile "1t3tA4.bssp"
#ERROR : Can't open dsspfile "1vk3A3.bssp"
#ERROR : Can't open dsspfile "1t3tA7.bssp"
#ERROR : Can't open dsspfile "2z1eA1.bssp"
#ERROR : Can't open dsspfile "2z1eA2.bssp"
#ERROR : Can't open dsspfile "1t3tA5.bssp"
#ERROR : Can't open dsspfile "2yyeA1.bssp"
#ERROR : Can't open dsspfile "1cliA1.bssp"
#ERROR : Can't open dsspfile "1o22A.bssp"
#ERROR : Can't open dsspfile "1cliA2.bssp"
#ERROR : Can't open dsspfile "1vqvA2.bssp"
#ERROR : Can't open dsspfile "1vqvA1.bssp"
#ERROR : Can't open dsspfile "1t3tA1.bssp"
#ERROR : Can't open dsspfile "2yyeA2.bssp"
#ERROR : Can't open dsspfile "1nqyA.bssp"
#ERROR : Can't open dsspfile "2qgmA1.bssp"
#ERROR : Can't open dsspfile "1vk3A2.bssp"
#ERROR : Can't open dsspfile "1vk3A1.bssp"
#ERROR : Can't open dsspfile "1t3tA6.bssp"
#ERROR : Can't open dsspfile "1vk3A3.bssp"
#ERROR : Can't open dsspfile "1t3tA7.bssp"
#ERROR : Can't open dsspfile "2z1eA1.bssp"
#ERROR : Can't open dsspfile "1t3tA5.bssp"
#ERROR : Can't open dsspfile "2yyeA1.bssp"
#ERROR : Can't open dsspfile "1cliA1.bssp"
#ERROR : Can't open dsspfile "1vqvA1.bssp"

## Summary of PDB Search
:725
    4e-44  39%  1vk3A2 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    4e-40  51%  1vk3A1 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II A:2
    7e-36  22%  1t3tA6 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:430
    2e-34  33%  1t3tA4 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:221
    3e-29  47%  1vk3A3 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II
    5e-28  16%  1t3tA7 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:817
    3e-27  23%  2z1eA1 [d.79.4.1] HYDROGENASE EXPRESSION/FORMATION PROTEIN HYPE
    2e-25  19%  2z1eA2 [d.139.1.1] HYDROGENASE EXPRESSION/FORMATION PROTEIN HYPE
    5e-25  18%  1t3tA5 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:617
    2e-24  19%  2yyeA1 [d.79.4.1] SELENIDE, WATER DIKINASE A:1 -- 154
    5e-21  26%  1cliA1 [d.79.4.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE A:5 -- 170
    4e-18  21%  1o22A  [d.238.1.1] ORPHAN PROTEIN TM0875
    6e-16  12%  1cliA2 [d.139.1.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE A:171 --
    2e-12  21%  1vqvA2 [d.139.1.1] THIAMINE MONOPHOSPHATE KINASE A:138 -- 300
    1e-10  24%  1vqvA1 [d.79.4.1] THIAMINE MONOPHOSPHATE KINASE A:1 -- 137
    5e-10  45%  1t3tA1 [a.5.10.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE
    5e-06  14%  2yyeA2 [d.139.1.1] SELENIDE, WATER DIKINASE A:155 -- 336
    6e-04  31%  1nqyA  [d.113.1.1] COA PYROPHOSPHATASE (MUTT/NUDIX FAMILY PROTEIN)
    8e-04  12%  2qgmA1 [c.150.1.3] SUCCINOGLYCAN BIOSYNTHESIS PROTEIN A:33 -- 445
    5e-16  21%  1vk3A2 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II(query 22->160)
    1e-09  25%  1vk3A1 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II A:2(query 430->544)
    1e-08  21%  1t3tA6 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:430(query 604->702)
    2e-07  19%  1vk3A3 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II(query 593->703)
    1e-06  20%  1t3tA7 [d.139.1.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:817(query 576->702)
    9e-12  17%  2z1eA1 [d.79.4.1] HYDROGENASE EXPRESSION/FORMATION PROTEIN HYPE(query 430->548)
    8e-09  14%  1t3tA5 [d.79.4.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE A:617(query 56->166)
    6e-19  23%  2yyeA1 [d.79.4.1] SELENIDE, WATER DIKINASE A:1 -- 154(query 33->185)
    2e-08  23%  1cliA1 [d.79.4.1] PROTEIN (PHOSPHORIBOSYL-AMINOIMIDAZOLE A:5 -- 170(query 425->544)
    2e-07  20%  1vqvA1 [d.79.4.1] THIAMINE MONOPHOSPHATE KINASE A:1 -- 137(query 90->161)
:725

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxEYREIVQRLGREPNRVELLLFKVMWSEHCAYKNSRPLLKALPKEGEAVLQGPGENAG
1vk3A2          ----------------------------------------------------------------------
1vk3A1          -------------YLNILKEKLGREPTFVELQAFSVXWSEHCGYSHTKK------YIRRLPKTGFEGNAG
1t3tA6          ----------------------------------------------------------------------
1t3tA4          -------------------------------------------------------KDNAAVMEGADHNTG
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          -------------------------------------------------------------------DGA
2z1eA2          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          -----------------------------------------------------------ALPQKYREPVL
1o22A           ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------
1t3tA1          --------------LQEAFTKLGRNPNDIELYMFAQANSEHCRHK-------------------------
2yyeA2          ----------------------------------------------------------------------
1nqyA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vk3A2          ---------------------PGKIPEFKRVEFEEV---------NAREVFEQYDHXGTDTVVPPGFGAA
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
1t3tA5          -------------------------------------------------------DQMVGPWQVPVADCA
2yyeA1          --------------------------------LLKLVRSSGCAAKVGQEILKGFNIYTESTLVSIGDDAG
1cliA1          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIMSMGARPIALLDSLRFGPPEEARSRYLLKG
1vk3A2          ----------------------------------------------------------------------
1vk3A1          VVNLDDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAXGARPTAIFDSLHXSR--------IIDG
1t3tA6          ----------------------------------------------------------------------
1t3tA4          RYDFHEPAHILMKVETHNHPTAISPWPGAATGSGGEIRDATGRGAKPKAGLVGFSVSPERIVTALDIMTE
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          TIPFGDKHIVFTIDGHTVKPLFFPGGDIGRLAVSGTVNDLAVMGAEPIALANSMIIGEGLDME---VLKR
2z1eA2          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          VSGVGTKLRLAMDLKRHDTI--------GIDLVAMCVNDLVVQGAEPLFFLDYYATGKLDVDT----ASA
1o22A           ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1nqyA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vk3A2          VXRIKRDGGYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYGDPDVDPVG--LSA
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
1t3tA5          VTTLDSYYGEAMSIGERAPVALLDFAASARLAVGEALTNIAATQIGDIRIKLSANWMAAAPGEDAGLYDA
2yyeA1          VYEHNGIIWVY--TVDIITPVVNDPYLWGAISTANALSDVYAMGGIPVNALAISCFNNCE--LDIEIFRE
1cliA1          ----------------------------------------------------------------------
1vqvA1          -------------------LRSYIPEAVGWKAISVNVSDVIANGGLPKWALISL--NLPEDLEVSY-VER


                         +         .         .         .         .         *         .:210
query           VVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAMCLGLLREEHLKRSRASLGRPIYYAGAKTGRDGIG
1vk3A2          ----------------------------------------------------------------------
1vk3A1          IIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDXLVDS---------------------
1t3tA6          -----------------------------------------------------GAKLIVLGGPAMNIGFA
1t3tA4          GPLGGAAFNNEFGRPALTGYFRTYEGYH-KPIMLAGGIGNIRADHVQKG---------------------
1vk3A3          -----------------------------------------------------GQVIVIFGGATGRDGTK
1t3tA7          -------------------------------------------------LSTEDNALLLIDLGKGHNALG
2z1eA1          VLKSMDETAREVPVPIVTGDTKVVEDK-IEMFVITAGIGIAE----------------------------
2z1eA2          ---------------------------------------------VSDAGAKVGDAVLV----SGTIGDH
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          VISGIAEGCLQSGCSLVGGETAEMPGYHGEDYVAGFCVGVVEKSEI------------------------
1o22A           ----------------------------------------------------------------------
1cliA2          ---------------------------------------------------------------LGSSGPH
1vqvA2          --------------------------------------------FVGRDGARLGDSVFV----SGTLGDS
1vqvA1          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2yyeA2          ---------------------------------------------------------------TKPIGTG
1nqyA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vk3A2          XXTALKNACEFSGVPVASGN--------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
1t3tA5          VKAVGEELCPQLGLTIPVGKDSMSMK--------------------------------------------
2yyeA1          VIRGALDKLREAKTVLLGGHTIDDKE----PKFGLSVAGICPEGK-------------------------
1cliA1          ----------------------------------------------------------------------
1vqvA1          FYIGVKRACEFYKCEVVGGNI-------------------------------------------------


                         .         .         .         +         .         .         .:280
query           GAAFASRELKEEKAEDRPAVQVGDPFLGKLLMEATLEAIELDLVEGVQDMGAAGLTSSLSELAHKSGLGV
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ------------------SVQRDNPEMERRCQDRCWQLGDANPILFIHDVGAGGLSNAMPELVSDGGRGG
1t3tA4          ----------------------------------------------------------------------
1vk3A3          LS-----------------IQVGDPFAEKXLIEAFLEXVEEGLVEGAQDLGAGGVLSATSELVAKGNLGA
1t3tA7          ATALA----QVYRQLGDKPADVRDVAQLKGFYDAMQALVAARKLLAWHDRSDGGLLVTLAEMAFAGHCGV
2z1eA1          ----------------------------------------------------------------------
2z1eA2          GIALM----SHREGIAFETELKSDVAPIWDVVKAVAETIGWENIHAMKDPTRAGLSNALNEIARKSNVGI
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----------------------------------------------------------------------
1o22A           ----------------------------------------------------------------------
1cliA2          SNGYSLKILEVSGCDPQTTELDGKPLADHLLVKSVLELIEKVDVHAIAHLTGGGFWENIPRVL-PDNTQA
1vqvA2          RAGLELLLXEKEEYEPFELALIQRHLRPTARIDYVKHIQ--KYANASXDI-SDGLVADANHLAQRSGVKI
1vqvA1          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2yyeA2          ILIKGLKE-----GILKEEDINEAIENMLALNDKARNLMLSLDATACTDVTGFGLLGHAWNICKNSNIGA
1nqyA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           ELHLDLVPTREEGMTPEELLLSESQERMVLVPKEGKEKALEEVFGRWGLDCVPVARTIPERVFRVLFRGE
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          KFELRDILSDEPGMSPLEIWCNESQERYVLAVAADQLPLFDELCKRERAPYAVIGDATEEQHLSLNHFDN
1t3tA4          ----------------------------------------------------------------------
1vk3A3          IVHLDRVPLREPDXEPWEILISESQERXAVVTSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVXYRND
1t3tA7          QVDIAALG-----DDHLAALFNEELGGVIQVRAE-DRDAVEALLAQYGLCVHYLGQALAGDRFVITANDQ
2z1eA1          ----------------------------------------------------------------------
2z1eA2          LVREADIPIRPEVRAAISPYDVANEGKVVMVVAREYAEEALEAMTEKGRNAAIIGEVIADYRGKVLLETG
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----------------------------------------------------------------------
1o22A           ------------------------------------EKKXKEIFNETGVSLEPVNSELIGRKISVLEEGE
1cliA2          VIDESSWQWPEVNVEHHEMYRTNCGVGMIIALPAPEVDKALALLNANGENAWKIGIIKASDSEQRV----
1vqvA2          EILSEKLPLSNEGKNPIEYALFGGEDQLLFHPKERWNPFLD-----------------------------
1vqvA1          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2yyeA2          RIFFEKVPYYQLSENLVKKKIPVTSGGLLFTINKEKLEKIDETAKELEVNYWIIGETIAENVLEVL----
1nqyA           ----------DAGETPTQAALREAQEEVALDPAAVTLGELDDVFTPVGFHVTPVLGRIAPEALDTLRVTP
2qgmA1          --------------------------KGIIDEKLYPYVAGQFLKERLDNNYVTIGSTT--------TEGN
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VVAEVPTEALAEAPTYVRVGREDPEVRRLRETPIPPLEADPQEVLRRLLASPNLASREAVYERYDHQVGT
1vk3A2          ----------------------------------------------KRVEFEEVNARE-VFEQYDHXVGT
1vk3A1          ----------------------------------------------------------------------
1t3tA6          QPIDLPLDVLLKTPKMTR----------------------------------------------------
1t3tA4          ----------------------------------------------------------------------
1vk3A3          LVXEVPVQLLANAPEE------------------------------------------------------
1t3tA7          TVFSESRTTLRVW---------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
2z1eA2          IGGKRFMEPPEGDP--------------------------------------------------------
1t3tA5          ------------------------------GDALNRADITIADAVKRVLHLPTVAEKTFLVTIGDRTVTG
2yyeA1          --------------------------------------------LLKLVRSSGCAAKQEILKGFNIYTDE
1cliA1          ----------------------------------------------------------------------
1o22A           EVPSFAIKALTPK---------ENAVDLPDWTDLKNVFVEEIDYLDSYGDXKILSEKNKIYVPYSSVKKK
1cliA2          ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1nqyA           EVAQIITPTLAEAVPLVRERRTLPDGTEVP----------------------------------------
2qgmA1          FTLYSEYGKITTD---TIPQDVKSFNYTLGKVPYKXFLLDLKGQAEKWVKAKRPLLSIGGQIVYFD----
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           RTALLPGKGDAAVLWIKGTRLGVAAKVDQNPRYSRLHPRLGAMHALAEACRNVSVVGAKPLAYTDGLNLG
1vk3A2          DTVVPPG-FGAAVXRIKRDG-GYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYG
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA4          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1t3tA5          MVARDQMVGDCAVTTASDSYYGEAMSIGERAPVALLDFAASARLAVGEALTNIAATQIGDIKRKLSANWM
2yyeA1          STLVSIG-DDAGVYEHNGIIW--VYTVDIITPVVND-PYLWGAISTANALSDVYAMGGIPVNALAISCFN
1cliA1          ----------------------------------------------------------------------
1o22A           NRNELVE-EFXKYFFEKGWNPGEY----------------------------------------------
1cliA2          ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1vqvA1          --------DDTAPV---SKKLLLTTDVLNEGVHFLRSPEAVGWKAISVNVSDVIANGGLPKWALISLNL-
1t3tA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1nqyA           ----------------------------------------------------------------------
2qgmA1          --TSLLEQFD-IIFHIRKTS--------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ---------NAGVVNL-DDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAXGARPTAIFDSLHXS
1t3tA6          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ---------DGATIPFGDKHI-VFTIDGHTVKPLFFPGGDIGRLAVSGTVNDLAVMGAEPIALANSMIIG
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----LGGFGALCALPQKYREPVLVSGTDGVGTKLRLAHDTIGIDLVAMCVNDLVVQGAEPLFFLDYYATG
1vqvA1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           SPETPEGYHELAETIAGLKEASEALGVPVVSGNVSLYNESGGKRIPPTAMVGVVGVLEVDKRAxxxxxxx
1vk3A2          DPDVDPV--GLSAXXTALKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGXLGKVNPQK---------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA4          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1t3tA5          AAAGPGEDAGLYDAVAVGEELCPQLGLTIPVGKDSMSMK--TRWQEGNEQREMTSPLSLVISA-------
2yyeA1          NCELDIEI--FREVIRGALDKLREAKTVLLGGHTIDDKEP----KFGLSVAGIC----------------
1cliA1          ----------------------------------------------------------------------
1o22A           ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1vqvA1          PEDLEVSY--VERFYIGVKRACEFYKCEVVGGNISKSEKIG-----------------------------
1t3tA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1nqyA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1vk3A1          --------RIIDGIIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVV----------------
1t3tA6          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          EGLDME---VLKRVLKSMDETAREVPVPIVTGDTKVVEDKIE----MFVITAGIGIAE------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          KLDVD----TASAVISGIAEGCLQSGCSLVGGETAEMPGHGEDYDVAGFCVGVV----------------
1vqvA1          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxASEVLYLLTGKEFGHPPRLDLGREKAVQEAIRDLIQRGLTRTAHDVXXXXXXXXX
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA4          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----------------------------------------------------------------------
1o22A           ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1nqyA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          -------------------------------------------DRCWQLGDANPILFIHDVGAGGLSNAM
1vk3A3          --------------------------------VGDPFAEKXLIEAFLEXVEEGLVEGAQDLGAGGVLSAT
1t3tA7          ---------------ATALAQVYRQLGDKPADVRDVAQLKGFYDAMQALVAARKLLAWHDRSDGGLLVTL
2z1eA1          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           XXMTFPYGVGATVEVREEGLEALFGEAPSRVLFTVEKTRLQEATLLLEERGLPYRVLGETGGKSLTVLTP
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          ----------------------------------------------------------------------
1t3tA4          ----------------------------------------------------------------------
1vk3A3          ----------------------------------------------------------------------
1t3tA7          ----------------------------------------------------------------------
2z1eA1          ----------------------------------------------------------------------
2z1eA2          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----------------------------------------------------------------------
1o22A           ----------------------------------------------------------------------
1cliA2          ----------------------------------------------------------------------
1vqvA2          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------
1t3tA1          ----------------------------------------------------------------------
2yyeA2          ----------------------------------------------------------------------
1nqyA           ----------------------------------------------------------------------
2qgmA1          ----------------------------------------------------------------------
1vk3A2          ----------------------------------------------------------------------
1vk3A1          ----------------------------------------------------------------------
1t3tA6          PELVSDGGRGGKFESDEPGMEIWCNESQERYVLAVAADQLPLFDELCKRERAPYAVIGDTEEQHLSLHDN
1vk3A3          SELVAKGNLGAIVHLDREPWEILISESQERXAVVTSPQKASRILEIARKHLLFGDVVAEIEEPVYRVXYR
1t3tA7          AEMAFAGHCGVQVDLGDDHLAALFNEEL-GGVIQVRAEDRDAVEALLAQYGLAVHYLGQALAGDRFVITA
2z1eA1          ----------------------------------------------------------------------
1t3tA5          ----------------------------------------------------------------------
2yyeA1          ----------------------------------------------------------------------
1cliA1          ----------------------------------------------------------------------
1vqvA1          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           GGVxxxxxxxxxxxxxxxxxxxxxx
1vk3A2          -------------------------
1vk3A1          -------------------------
1t3tA6          -------------------------
1t3tA4          -------------------------
1vk3A3          -------------------------
1t3tA7          -------------------------
2z1eA1          -------------------------
2z1eA2          -------------------------
1t3tA5          -------------------------
2yyeA1          -------------------------
1cliA1          -------------------------
1o22A           -------------------------
1cliA2          -------------------------
1vqvA2          -------------------------
1vqvA1          -------------------------
1t3tA1          -------------------------
2yyeA2          -------------------------
1nqyA           -------------------------
2qgmA1          -------------------------
1vk3A2          -------------------------
1vk3A1          -------------------------
1t3tA6          HF-----------------------
1vk3A3          NDL----------------------
1t3tA7          ND-----------------------
2z1eA1          -------------------------
1t3tA5          -------------------------
2yyeA1          -------------------------
1cliA1          -------------------------
1vqvA1          -------------------------