[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81529.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gpmA2.bssp"
#ERROR : Can't open dsspfile "1wl8A1.bssp"
#ERROR : Can't open dsspfile "1a9xB2.bssp"
#ERROR : Can't open dsspfile "1qdlB.bssp"
#ERROR : Can't open dsspfile "2ghrA1.bssp"
#ERROR : Can't open dsspfile "1o1yA.bssp"
#ERROR : Can't open dsspfile "1q7rA.bssp"
#ERROR : Can't open dsspfile "1jvnA2.bssp"
#ERROR : Can't open dsspfile "1i1qB.bssp"
#ERROR : Can't open dsspfile "1gpwB.bssp"
#ERROR : Can't open dsspfile "1gpmA3.bssp"
#ERROR : Can't open dsspfile "1l9xA.bssp"
#ERROR : Can't open dsspfile "1t3tA2.bssp"
#ERROR : Can't open dsspfile "1ka9H.bssp"
#ERROR : Can't open dsspfile "1jgtA1.bssp"
#ERROR : Can't open dsspfile "1fy2A.bssp"
#ERROR : Can't open dsspfile "1gpmA1.bssp"
#ERROR : Can't open dsspfile "1j42A.bssp"
#ERROR : Can't open dsspfile "1q15A1.bssp"
#ERROR : Can't open dsspfile "2c5sA1.bssp"
#ERROR : Can't open dsspfile "1aa7A.bssp"
#ERROR : Can't open dsspfile "1xngA1.bssp"
#ERROR : Can't open dsspfile "1k92A1.bssp"
#ERROR : Can't open dsspfile "1ni5A1.bssp"
#ERROR : Can't open dsspfile "1sy7A1.bssp"
#ERROR : Can't open dsspfile "1wy5A1.bssp"
#ERROR : Can't open dsspfile "1vbkA1.bssp"
#ERROR : Can't open dsspfile "1xr4A2.bssp"
#ERROR : Can't open dsspfile "1surA.bssp"
#ERROR : Can't open dsspfile "1yqeA1.bssp"
#ERROR : Can't open dsspfile "2pg3A1.bssp"

## Summary of PDB Search
:503
    5e-36  41%  1gpmA2 [c.23.16.1] GMP SYNTHETASE A:3 -- 207
    1e-35  37%  1wl8A1 [c.23.16.1] GMP SYNTHASE [GLUTAMINE-HYDROLYZING] SUBUNIT A
    5e-35  24%  1a9xB2 [c.23.16.1] CARBAMOYL PHOSPHATE SYNTHETASE (SMALL CHAIN)
    4e-34  26%  1qdlB  [c.23.16.1] PROTEIN (ANTHRANILATE SYNTHASE (TRPG-SUBUNIT))
    1e-31  18%  2ghrA1 [c.23.16.8] HOMOSERINE O-SUCCINYLTRANSFERASE A:17 -- 297
    1e-30  22%  1o1yA  [c.23.16.1] CONSERVED HYPOTHETICAL PROTEIN TM1158
    2e-29  19%  1q7rA  [c.23.16.1] PREDICTED AMIDOTRANSFERASE
    4e-29  21%  1jvnA2 [c.23.16.1] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN A:-3
    1e-28  24%  1i1qB  [c.23.16.1] ANTHRANILATE SYNTHASE COMPONENT II
    7e-27  15%  1gpwB  [c.23.16.1] AMIDOTRANSFERASE HISH
    2e-24  62%  1gpmA3 [d.52.2.1] GMP SYNTHETASE A:405 -- 525
    5e-22  11%  1l9xA  [c.23.16.1] GAMMA-GLUTAMYL HYDROLASE
    6e-22  17%  1t3tA2 [c.23.16.1] PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE
    4e-21  19%  1ka9H  [c.23.16.1] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    1e-20  13%  1jgtA1 [c.26.2.1] BETA-LACTAM SYNTHETASE A:210 -- 508
    2e-19  10%  1fy2A  [c.23.16.4] ASPARTYL DIPEPTIDASE
    2e-16  43%  1gpmA1 [c.26.2.1] GMP SYNTHETASE A:208 -- 404
    1e-15  11%  1j42A  [c.23.16.2] RNA-BINDING PROTEIN REGULATORY SUBUNIT
    2e-14  12%  1q15A1 [c.26.2.1] CARA A:206 -- 501
    1e-13  15%  2c5sA1 [c.26.2.6] PROBABLE THIAMINE BIOSYNTHESIS PROTEIN THII A:174
    2e-13   5%  1aa7A  [a.95.1.1] INFLUENZA VIRUS MATRIX PROTEIN
    3e-13  18%  1xngA1 [c.26.2.1] NH(3)-DEPENDENT NAD(+) SYNTHETASE A:3 -- 257
    6e-13  13%  1k92A1 [c.26.2.1] ARGININOSUCCINATE SYNTHASE A:1 -- 188
    8e-13  14%  1ni5A1 [c.26.2.5] PUTATIVE CELL CYCLE PROTEIN MESJ A:0 -- 226
    4e-11   9%  1sy7A1 [c.23.16.3] CATALASE 1 A:553 -- 736
    2e-08  21%  1wy5A1 [c.26.2.5] HYPOTHETICAL UPF0072 PROTEIN AQ_1887 A:1 -- 216
    5e-08  11%  1vbkA1 [c.26.2.6] HYPOTHETICAL PROTEIN PH1313 A:176 -- 307
    3e-07  15%  1xr4A2 [c.124.1.2] PUTATIVE CITRATE LYASE ALPHA CHAIN/CITRATE-ACP
    2e-06  17%  1surA  [c.26.2.2] PAPS REDUCTASE
    3e-04  12%  1yqeA1 [c.56.7.1] HYPOTHETICAL UPF0204 PROTEIN AF0625 A:1 -- 278
    5e-04  27%  2pg3A1 [c.26.2.1] QUEUOSINE BIOSYNTHESIS PROTEIN QUEC A:1 -- 230
:503

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVLVLDFGSQYTXXXXXXXXXXXXFSLILPGDAPLEEVLKHRPQALILSGGPRSVFDPDAPRPDPRLFSS
1gpmA2          -ILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRDFNPSGIILSGGPESTTEENSPRAPQYVFEA
1wl8A1          MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTPLEEIKAMNPKGIIFSGGPSLENTGNCEKVLEHYDEF
1a9xB2          -VVAYDFGAKRNILRMLVDRGC--RLTIVPAQTSAEDVLKMNPDGIFLSNGPGDPAPCDAITAIQKFLET
1qdlB           LTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDESIKGIERIDPDRLIISPGPGTPEKREDIGVSLKYLGK
2ghrA1          ---------------------------------TFRDIENEKFDGLIITGAPVETLSFEEVDYWEELKTN
1o1yA           -VLAIRHVEIEDLGXXEDIFREKNWSFYLDTPKGEKLERPLEEYSLVVEKYPF---LKYEFQLIEEILKK
1q7rA           -IGVLGLQGAVREHVRAIEACGAEAVIVKKSEQL------EGLDGLVLPGGESTTXRRLIDRYGKQFAAA
1jvnA2          VVHVIDVESGNLQSLTNAIEHLGYEVQLVKSP---KDFNISGTSRLILPGVGDNLFNRGFEKPIREYIES
1i1qB           -ILLLDNIDSFTWNLADQLRTNGHNVVIYRNHIPIDRLATMKNPVLMLSPGPGVPSEAGCMPELLTRLRG
1gpwB           -IGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRN-DLYDLLFIPGVGHFGEGMRRLRENDKHVED
1gpmA3          ----------------------------------------------------------------------
1l9xA           -NKVMKNYGRYYIAASYVKYLESARVVPVRLDLTEKDYEILSINGILFPGGSVDLRRSDYAKVAKIFYGD
1t3tA2          -VAVLREQGVNSHVEMAAAFHRAGFDAIDMSDLLGGRIGLGNFHALVACGGFSYGDVLGAGEGWAKFHRP
1ka9H           -ALLIDYGSGNLRSAAKALEAAGFSVAVAQDPKAHEE-----ADLLVLPGQGHFGQVMRAFQESGRHLER
1jgtA1          ----------------------------------------------------------------------
1fy2A           ---------------------------GIHRVADPLAAIEK-AEIIIVGGGNTFQLLKESRERGADRVKR
1gpmA1          ----------------------------------------------------------------------
1j42A           ---------------------------ICPDASLEDAKKEGPYDVVVLPGGNLGAQNAAVKEILKEQENR
1q15A1          ----------------------------------------------------------------------
2c5sA1          ----------------------------------------------------------------------
1aa7A           -DVFAGKNTDLEVLMEWLKTRPILGILGFVFTLTVPSERGLQRRRFVQNALNGNGDPNNMDKAVKLYRIT
1xngA1          ----------------------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1sy7A1          ----------------------------VQPHHHLEGFRSTMVDAIFIPGGAKAAETGRALHWIREAFGH
1wy5A1          ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
1yqeA1          ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GLPLLGICYGMQLLAQELGGRVERAGRAEYGKALLTRHEGPLFRGLEGEVQVWMSHQDAVTAPPPGWRVV
1gpmA2          GVPVFGVCYGMQTMAMQLGGHVEASNEREFGYAQVEVVNSALVRGIEDALDVWMSHGDKVTAIPSDFITV
1wl8A1          NVPILGICLGHQLIAKFFGGKVGRGEKAEYSLVEIEIIDEEIFKGLPKRLKVWESHMDEVKELPPKFKIL
1a9xB2          DIPVFGIXLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEK-----NVVMITAQNHGFAVDEAPANLRVT
1qdlB           RTPILGVCLGHQAIGYAFGAKIRRARKVFHGKILVNNSPLSLYYGIAKEFKATRYHSLVVDEVHRPLIVD
2ghrA1          VTSTLHICWGAQAGLYHHYGVQKYPKEKXFGVFEHEVREQKLLQGFDELFFAPHSRESDIREVK-ELTLL
1o1yA           EIPFLGIXLGSQXLAKVLGASVYRGKNGEEIGWYFVEKDNKFFREFPDRLRVFQWHGDTFD-LPRRATRV
1q7rA           GKPXFGTCAGLILLAKRIVGYDEPHERNSFGRQRESFEAELSIKGVGDGFVGVFIRAPHIVEAGDGVDVL
1jvnA2          GKPIMGIXVGLQALFAGIDFKLSRFDDSEKPVPEICIPSENLFFGLDPYKRYYFVHSFAANLENDGWKIA
1i1qB           KLPIIGICLGHQAIVEAYGGYVGQILHGKAT--SIEHDGQAMFAGLANPLPVARYHSSNVPAGL----TI
1gpwB           ERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRVIFKDTFPNGYYYFVHTYRAV-CEEEHVLG
1gpmA3          ----------------------------------------------------------------------
1l9xA           YFPVWGTCLGFEELSLLISGECLLTATDTVDVAMPLNFTVEPLTANFHKWSLSVKNFTMNEKLKKFFNVL
1t3tA2          QTLALGVXNGCQMMSNLRELIPGSELWPRFVRNHSDRFEDAHLAALESKGLVALRYVDNFGKVTETYPAN
1ka9H           GLPFLGICVGMQVLYEGSEEAPGVRGLGLVPGEVRRFRAGRVPQMGWNALEFGGAFANSYYGPLTPYSLG
1jgtA1          ----------------------------------------------------------------------
1fy2A           GALYIGWSAGANLACPTIRTTNDMPIVDPNGFDALDLFPLTNTREQRIRELLVVAPELTVIGLPEGNWIQ
1gpmA1          ----------------------------------------------------------------------
1j42A           KGLIAAICAGPTALLAHEIGCGSKVTTHPLAKDKMMNGGHYTYSENRVEKDGLILTSRGPGTSFEFALAI
1q15A1          ----------------------------------------------------------------------
2c5sA1          ----------------------------------------------------------------------
1aa7A           FHGAKEISLSYSAGALASCMGLIYNRMGAFGLVCATCE--------------------------------
1xngA1          ----------------------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1sy7A1          LKAIGATGEAVDLVAKAIALPQVTVSSEAEVHESYGVVTLKKVKPESFTDAVKIAKGAAGFLGEFFYAIA
1wy5A1          ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
1yqeA1          ------------------------------------EKLAKYIDFEEILFASRHSGRKIFTVHVSGVGTA
2pg3A1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AETEENPVAAIASPDGRAYGVQFHPEVAHTPKGMQILENFLELAGAKRDWTPEHXXXXXXXXXXXXAGKD
1gpmA2          ASTESCPFAIMANEEKRFYGVQFHPEVTHTRQGMRMLERFVRICQCE-----------------------
1wl8A1          ARSETXPIEAMKHEELPIYGVQFHPEVAHTEKGEEILRNFAKLCG-------------------------
1a9xB2          HKSLDGTLQGIHRTDKPAFSFQGNPEASPGPDAAPLFDHFIELI--------------------------
1qdlB           ASAEDNEIMAIHHEEYPIYGVQFHPESVGTSLGYKILYNFLNR---------------------------
2ghrA1          ANSEEAGVHLVIGQEGRQVFALGHSEYSCD----------------------------------------
1o1yA           FTSEKYENQGFV--YGKAVGLQFHIEVGART-XKRWIEAYKDLEKKKIDPRLLL----------------
1q7rA           ATYNDRIVAAR---QGQFLGCSFHPELTDDH---RLXQYFLNXVKEAKXASS------------------
1jvnA2          KAKYGSEEFIAAVNKNNIFATQFHPEKSGKA-GLNVIENFLKQSPPIPNYSAEE----------------
1i1qB           NAHFNGMVMAVRHDADRVCGFQFHPESILTTQGARLLEQTLAWAQQK-----------------------
1gpwB           TTEYDGEIFPSAVRKGRILGFQFHPEKSSKI-GRKLLEKVIECSLSR-----------------------
1gpmA3          ----------------------------------------------------------------------
1l9xA           TTNTDGFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAP-NAVKTAFYLAEFFVNEARKNNHHFKSE
1t3tA2          PNGSPNGITAVTTENGRVTIMMPHPERVFRTPWMRIFRNARKQLG-------------------------
1ka9H           KGEYEGTPFTALLAKENLLAPQFHPEKSGKA-GLAFLALARR----------------------------
1jgtA1          -------------------------------------------------------------------PGD
1fy2A           VSNGQ--AVLGGPNTTWVFKAGEEAVALEAG---------------------------------------
1gpmA1          -------------------------------------------------WTPAKIIDDAVARIREQVGDD
1j42A           VEALNGKEVAAQ----------------------------------------------------------
1q15A1          ------------------------------------------------------------------PRFD
2c5sA1          --------------------------------------------------------------------GG
1aa7A           ----------------------------------------------------------------------
1xngA1          ------------------------------------------------------------------RGFK
1k92A1          ---------------------------------------------------------------------Q
1ni5A1          ------------------------------------------------------------------LTSR
1sy7A1          QHRNWDRELD------------------------------------------------------------
1wy5A1          -------------------------------------------------------------------GER
1vbkA1          --------------------------------------------------------------------EG
1xr4A2          ----------------------------------------------------------------------
1surA           ---------------------------------------------------------------------G
1yqeA1          DFGGKPYSLAKPSPQTERLDRKPEFEFTHGPSEISKPSAFYEIGSTEEEWKDREAAEVVAEAMLDAIRAW
2pg3A1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDHXXXXXXXXXXXXXXXXXXGVNLLVVDAKERFLKALKG
1gpmA2          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1gpmA3          ----------------------------------------------------------------------
1l9xA           SEE-------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1jgtA1          TPLVVLSGGIDSSGVAACAHRAAGELDTVSMGT--DTSNEFREARAVVDHLRTRHREITIPTTELLAQSE
1fy2A           ----------------------------------------------------------------------
1gpmA1          KVILGLSGGVDSSVTAMLLHRAIGKNLCVFVDNLLRLNEAEQVLDMFGDHFGLNIVHVPAEDRFLSALAG
1j42A           ----------------------------------------------------------------------
1q15A1          TVGIPLSGGLDSSLVTALASRHFKKLNTYSIGTNEFEFSQQVADALGTHHQMKILSETEVINGIIESIYY
2c5sA1          KVMVLLSGGIDSPVAAYLTMKRGVSVEAVHFHSPFTSERAKQKVIDLAQELTKYCKRVTLHLVPFTEVQK
1aa7A           ----------------------------------------------------------------------
1xngA1          KVVYGLSGGLDSAVVGVLCQKVFKENAALLMPSSVSMPENKTDALNLCEKFSIPYTEYSIAPYDAIFSSH
1k92A1          RIGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQPDEEDYDAIPRRAMEYGAENARKQLVAEGIAAIQC
1ni5A1          QILVAFSGGLDSTVLLHQLVQWRTENPGVALRASANADAWVTHCENVCQQWQVPLVVERVQ---------
1sy7A1          ----------------------------------------------------------------------
1wy5A1          RVLIAFSGGVDSVVLTDVLLKLKNYFALAHFNHRESAERDEEFCKEFAKERNMKIFVGKEDVRAFAKENR
1vbkA1          RMIGILHDELSALAIFLMMKRGVEVI-PVYIGKD---------------------DKNLEKVRSLWNLLK
1xr4A2          -TAPLVRGRIPCVVEKVLTTVTPGASVVLVTDHGIAVNPARQDLLDNLRAAGVALXTIEQLQQRAEQLTG
1surA           EYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDKLKLNLKVYRATE--------
1yqeA1          NVAVGVGGTHYAPRQTEIMLTTTFTFGHNFAKY-------------------------------------
2pg3A1          RAVVVFSGGQDSTTCLIQALQDYDDVHCITFDY-------------------------------------


                         .         *         .         .         .         .         +:350
query           VEDPEEKRKIIGREFVAAFSQVARERGPFRFLAQGTLYPDVIESAGGHGAAKIKSHHNVGGXXXXXXXXX
1gpmA2          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1gpmA3          ----------------------------------------------------------------------
1l9xA           ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1jgtA1          SVDPDIIEYLLPLTALYRALDRILTGYGADIPLGGMHREDRLPALDTVLAHDMATFDGLNEMSPVLSTLA
1fy2A           ----------------------------------------------------------------------
1gpmA1          ENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAAKM----------------------
1j42A           ----------------------------------------------------------------------
1q15A1          NEIFDGLSAEIQSGLFNVY---RQAQGQVSCMLTGILKPGAQYDNPNQLLAQVYRTRWTGEFATHGASCY
2c5sA1          TINKEIPSSVMRRMMMRITERIAEERN-ALAITTGESLGQVASQ----------TLDSMHTINEVTNYPV
1aa7A           ----------------------------------------------------------------------
1xngA1          FKDASLTRKFCARLRMAFLYDYSLKSD---SLVIGT--SNKSERMLGYGTLFGDLACAI-----------
1k92A1          GAFHNTTGGLTYFNTTPLGRAVMKEDG-VNIWGDGSTYKGNDIERFYR----YGLLTNAELQIYKPWLDT
1ni5A1          --LAQEGLGIEAQARQARYQAFARTLLPGEVLVTAQHLDDQCETFLLARGSGPAGLSAXAEVSEFAGTRL
1sy7A1          ----------------------------------------------------------------------
1wy5A1          MSLEEAGRFLRYK----FLKEILESEG-FDCIATAHHLNDLLETS-------------------------
1vbkA1          RYSYGSKGFLVVAESFDRVLKLI-RDFGVKGVIKGLRPNDLNSEVSE-----ITEDFKMFP---------
1xr4A2          KPQPIETDRVVAV---------------------------------------------------------
1surA           ----------------------------------------------------------------------
1yqeA1          ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXXXKDEVREXXXXXXXXXXXXXRHPFPGPGLAVRVLGEVTEERLEILRRADDIFTSLLREWGLYE
1gpmA2          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1gpmA3          --------------------------------GPGLGVRVLGEVKKEYCDLLRRADAIFIEELRKADLYD
1l9xA           ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1jgtA1          GHWTTHPYWDR-EVLDLLVSLEAGLKRRHGRDKWVLRAAMADA-------------------LPAETVNR
1fy2A           ----------------------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1q15A1          GIDIRHPFWSH-SLISLCHALHPDYKIFDNEVKNIL-----------------REYADSLQLLPKDIVWR
2c5sA1          IRPLITMDKLEIIK---IAEEIGTYDISIRPYKPKREKANRFEAKYDFTPLIDEAANKETMVLQT-----
1aa7A           ----------------------------------------------------------------------
1xngA1          -NPIGELFKTEVYELARRLNIPKKILNKPPFVGQGYPYSVIDPLLKD-IEALFQTKPIDTETLAQLGYDE
1k92A1          DFIDELGGRHEMSE--------------------------------------------------------
1ni5A1          IRPLLARTRGELVQRWIEDESNQDDSYDRNFRWPHFAEATA-----RSAALCAEQESLLDEL--------
1sy7A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
1yqeA1          ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           KVAQALAVLTPVRSVGVAGDERKYGYVLALRAVTTEDFMTADWARLPLEFLDEAARRITRRVPEIGRVVY
1gpmA2          ----------------------------------------------------------------------
1wl8A1          ----------------------------------------------------------------------
1a9xB2          ----------------------------------------------------------------------
1qdlB           ----------------------------------------------------------------------
2ghrA1          ----------------------------------------------------------------------
1o1yA           ----------------------------------------------------------------------
1q7rA           ----------------------------------------------------------------------
1jvnA2          ----------------------------------------------------------------------
1i1qB           ----------------------------------------------------------------------
1gpwB           ----------------------------------------------------------------------
1gpmA3          KVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDFMTAHWAHLPYDFLGRVSNRIINEVNGISRVVY
1l9xA           ----------------------------------------------------------------------
1t3tA2          ----------------------------------------------------------------------
1ka9H           ----------------------------------------------------------------------
1jgtA1          PKLSSFSRL--LLDHGVAEDRVHEAKRQVVRELF--DLTVGGGRHPSEVDTDDVVRSVADR---------
1fy2A           ----------------------------------------------------------------------
1gpmA1          ----------------------------------------------------------------------
1j42A           ----------------------------------------------------------------------
1q15A1          SVNQAFANVLGSTVDNYQTKSR-FTYRVYQAFLRGRLSITDVTPSQLKDLI-------------------
2c5sA1          ----------------------------------------------------------------------
1aa7A           ----------------------------------------------------------------------
1xngA1          ILVK------------------------------------------------------------------
1k92A1          ----------------------------------------------------------------------
1ni5A1          ----------------------------------------------------------------------
1sy7A1          ----------------------------------------------------------------------
1wy5A1          ----------------------------------------------------------------------
1vbkA1          ----------------------------------------------------------------------
1xr4A2          ----------------------------------------------------------------------
1surA           ----------------------------------------------------------------------
1yqeA1          ----------------------------------------------------------------------
2pg3A1          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           DLTSKPPATIEWE
1gpmA2          -------------
1wl8A1          -------------
1a9xB2          -------------
1qdlB           -------------
2ghrA1          -------------
1o1yA           -------------
1q7rA           -------------
1jvnA2          -------------
1i1qB           -------------
1gpwB           -------------
1gpmA3          DISGKPPATIEWE
1l9xA           -------------
1t3tA2          -------------
1ka9H           -------------
1jgtA1          -------------
1fy2A           -------------
1gpmA1          -------------
1j42A           -------------
1q15A1          -------------
2c5sA1          -------------
1aa7A           -------------
1xngA1          -------------
1k92A1          -------------
1ni5A1          -------------
1sy7A1          -------------
1wy5A1          -------------
1vbkA1          -------------
1xr4A2          -------------
1surA           -------------
1yqeA1          -------------
2pg3A1          -------------