[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81530.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1wdjA.bssp"

## Summary of PDB Search
:187
    6e-22  21%  1wdjA  [c.52.1.27] HYPOTHETICAL PROTEIN TT1808
:187

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxRRLTAEEYLREEATSPVKRELVEGVPYAMAGAGRAHNLIVTNLVLLLGPLARRKGGRLYVADM
1wdjA           -------RPVSEEELRRSELNPGYQWERSPEGRLWVSPTGGESGRRSLQLAYQLARWNEERGLGVVFDSS


                         .         .         *         .         .         .         .:140
query           KLKVGEATFYYPDLMAVCAPPPESPLYEEAPCLVVEVLSPATEGVDRREKLWRYLSLPSLEGYLLVSARE
1wdjA           TGKFPDGSILSPDAAFVERGAWEALFPPLAPKAVFEVRSASQDPEELRAKMGIYLRNGVLL-GVLVDPYA


                         +         .         .         .         .         *         .:210
query           RRVELYRKEGDILHQVAEEGEVPLPCLEGSLPVAEVYxxxxxxxxxx
1wdjA           RAVEVFRPGKPPLLEGVERVSLDPELPGFALSLPPLW----------