[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81546.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xtpA.bssp"
#ERROR : Can't open dsspfile "2p7hA1.bssp"
#ERROR : Can't open dsspfile "1qsaA1.bssp"
#ERROR : Can't open dsspfile "1uirA.bssp"
#ERROR : Can't open dsspfile "2h00A1.bssp"
#ERROR : Can't open dsspfile "1p91A.bssp"
#ERROR : Can't open dsspfile "2cfuA2.bssp"
#ERROR : Can't open dsspfile "1ya0A1.bssp"
#ERROR : Can't open dsspfile "2c2lA1.bssp"
#ERROR : Can't open dsspfile "2dulA1.bssp"
#ERROR : Can't open dsspfile "2avnA1.bssp"
#ERROR : Can't open dsspfile "3ck7A1.bssp"
#ERROR : Can't open dsspfile "1xdzA.bssp"
#ERROR : Can't open dsspfile "1w3bA.bssp"
#ERROR : Can't open dsspfile "1im8A.bssp"
#ERROR : Can't open dsspfile "1sqfA2.bssp"
#ERROR : Can't open dsspfile "1aqiA1.bssp"
#ERROR : Can't open dsspfile "2bzgA1.bssp"
#ERROR : Can't open dsspfile "1qamA.bssp"
#ERROR : Can't open dsspfile "1m6yA2.bssp"
#ERROR : Can't open dsspfile "1bhjA.bssp"
#ERROR : Can't open dsspfile "1d8dA.bssp"
#ERROR : Can't open dsspfile "1khhA.bssp"
#ERROR : Can't open dsspfile "1vjpA2.bssp"
#ERROR : Can't open dsspfile "1qzzA2.bssp"
#ERROR : Can't open dsspfile "1hz4A.bssp"
#ERROR : Can't open dsspfile "2f8lA1.bssp"
#ERROR : Can't open dsspfile "2ex4A1.bssp"
#ERROR : Can't open dsspfile "1hxiA.bssp"
#ERROR : Can't open dsspfile "1zbpA1.bssp"
#ERROR : Can't open dsspfile "1a17A.bssp"
#ERROR : Can't open dsspfile "2b25A1.bssp"
#ERROR : Can't open dsspfile "1ufkA.bssp"
#ERROR : Can't open dsspfile "1yzhA1.bssp"
#ERROR : Can't open dsspfile "1ihgA1.bssp"
#ERROR : Can't open dsspfile "1ouvA.bssp"
#ERROR : Can't open dsspfile "1pg3A.bssp"
#ERROR : Can't open dsspfile "2fbnA1.bssp"
#ERROR : Can't open dsspfile "1suiA1.bssp"
#ERROR : Can't open dsspfile "1pjzA.bssp"
#ERROR : Can't open dsspfile "1elrA.bssp"
#ERROR : Can't open dsspfile "1ws6A1.bssp"
#ERROR : Can't open dsspfile "1wfdA.bssp"
#ERROR : Can't open dsspfile "1o54A.bssp"
#ERROR : Can't open dsspfile "1f38A.bssp"
#ERROR : Can't open dsspfile "1t43A.bssp"
#ERROR : Can't open dsspfile "1qyrA.bssp"
#ERROR : Can't open dsspfile "1b89A.bssp"
#ERROR : Can't open dsspfile "1dusA.bssp"
#ERROR : Can't open dsspfile "1u1iA2.bssp"

## Summary of PDB Search
:916
    3e-08  25%  1xtpA  [c.66.1.42] LMAJ004091AAA
    7e-08  31%  2p7hA1 [c.66.1.41] HYPOTHETICAL PROTEIN A:21 -- 249
    1e-07  10%  1qsaA1 [a.118.5.1] PROTEIN (SOLUBLE LYTIC TRANSGLYCOSYLASE SLT70)
    1e-07  19%  1uirA  [c.66.1.17] POLYAMINE AMINOPROPYLTRANSFERASE
    1e-07  12%  2h00A1 [c.66.1.54] METHYLTRANSFERASE 10 DOMAIN CONTAINING PROTEIN
    2e-07  23%  1p91A  [c.66.1.33] RIBOSOMAL RNA LARGE SUBUNIT METHYLTRANSFERASE A
    2e-07  16%  2cfuA2 [d.157.1.13] SDSA1 A:20 -- 524
    2e-07   9%  1ya0A1 [a.118.8.1] SMG-7 TRANSCRIPT VARIANT 2 A:1 -- 497
    5e-07  14%  2c2lA1 [a.118.8.1] CARBOXY TERMINUS OF HSP70-INTERACTING PROTEIN
    8e-07  14%  2dulA1 [c.66.1.58] N(2),N(2)-DIMETHYLGUANOSINE TRNA A:3 -- 377
    9e-07  22%  2avnA1 [c.66.1.41] UBIQUINONE/MENAQUINONE BIOSYNTHESIS A:1 -- 246
    2e-06   7%  3ck7A1 [a.118.8.6] SUSD A:42 -- 551
    2e-06  14%  1xdzA  [c.66.1.20] METHYLTRANSFERASE GIDB
    5e-06  19%  1w3bA  [a.118.8.1] UDP-N-ACETYLGLUCOSAMINE--PEPTIDE
    6e-06  22%  1im8A  [c.66.1.14] YECO
    7e-06  12%  1sqfA2 [c.66.1.38] SUN PROTEIN A:145 -- 429
    1e-05  18%  1aqiA1 [c.66.1.27] ADENINE-N6-DNA-METHYLTRANSFERASE TAQI A:21 --
    1e-05   6%  2bzgA1 [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE A:17 -- 245
    2e-05  10%  1qamA  [c.66.1.24] ERMC' METHYLTRANSFERASE
    2e-05  16%  1m6yA2 [c.66.1.23] S-ADENOSYL-METHYLTRANSFERASE MRAW A:2 -- 114
    4e-05  16%  1bhjA  [c.66.1.5] GLYCINE N-METHYLTRANSFERASE
    4e-05  10%  1d8dA  [a.118.6.1] FARNESYLTRANSFERASE (ALPHA SUBUNIT)
    4e-05  34%  1khhA  [c.66.1.16] GUANIDINOACETATE METHYLTRANSFERASE
    5e-05  20%  1vjpA2 [d.81.1.3] MYO-INOSITOL-1-PHOSPHATE SYNTHASE-RELATED A:210
    6e-05  20%  1qzzA2 [c.66.1.12] ACLACINOMYCIN-10-HYDROXYLASE A:102 -- 357
    6e-05  11%  1hz4A  [a.118.8.2] MALT REGULATORY PROTEIN
    6e-05  14%  2f8lA1 [c.66.1.45] HYPOTHETICAL PROTEIN LMO1582 A:2 -- 329
    7e-05  13%  2ex4A1 [c.66.1.42] ADRENAL GLAND PROTEIN AD-003 A:2 -- 224
    8e-05  20%  1hxiA  [a.118.8.1] PEROXISOME TARGETING SIGNAL 1 RECEPTOR PEX5
    1e-04  21%  1zbpA1 [e.61.1.1] HYPOTHETICAL PROTEIN VPA1032 A:2 -- 265
    1e-04  22%  1a17A  [a.118.8.1] SERINE/THREONINE PROTEIN PHOSPHATASE 5
    1e-04  21%  2b25A1 [c.66.1.13] HYPOTHETICAL PROTEIN A:6 -- 329
    1e-04  20%  1ufkA  [c.66.1.39] TT0836 PROTEIN
    1e-04  16%  1yzhA1 [c.66.1.53] TRNA (GUANINE-N(7)-)-METHYLTRANSFERASE A:8 --
    2e-04  19%  1ihgA1 [a.118.8.1] CYCLOPHILIN 40 A:197 -- 365
    2e-04  10%  1ouvA  [a.118.18.1] CONSERVED HYPOTHETICAL SECRETED PROTEIN
    2e-04  11%  1pg3A  [e.23.1.1] ACETYL-COA SYNTHETASE
    3e-04  20%  2fbnA1 [a.118.8.1] 70 KDA PEPTIDYLPROLYL ISOMERASE, PUTATIVE A:22
    3e-04  17%  1suiA1 [c.66.1.1] CAFFEOYL-COA O-METHYLTRANSFERASE A:21 -- 247
    3e-04  11%  1pjzA  [c.66.1.36] THIOPURINE S-METHYLTRANSFERASE
    4e-04  16%  1elrA  [a.118.8.1] TPR2A-DOMAIN OF HOP
    4e-04  29%  1ws6A1 [c.66.1.46] METHYLTRANSFERASE A:15 -- 185
    4e-04  11%  1wfdA  [a.7.14.1] HYPOTHETICAL PROTEIN 1500032H18
    5e-04  21%  1o54A  [c.66.1.13] SAM-DEPENDENT O-METHYLTRANSFERASE
    5e-04  25%  1f38A  [c.66.1.22] PRECORRIN-8W DECARBOXYLASE
    5e-04  27%  1t43A  [c.66.1.30] PROTEIN METHYLTRANSFERASE HEMK
    6e-04  15%  1qyrA  [c.66.1.24] HIGH LEVEL KASUGAMYCIN RESISTANCE PROTEIN
    6e-04  11%  1b89A  [a.118.1.3] PROTEIN (CLATHRIN HEAVY CHAIN)
    6e-04  14%  1dusA  [c.66.1.4] MJ0882
    7e-04  21%  1u1iA2 [d.81.1.3] MYO-INOSITOL-1-PHOSPHATE SYNTHASE A:228 -- 332
:916

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSPARRAPLLKAWRAYLAQGGREAVRSFYREVLKVPKG
1xtpA           --------------------------------------------WKAELTGDLYDPEKGWYGKALEYWRT
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ---------------------------------------------PEAVRALTCTLLREDFGLSIDIPTV
1p91A           ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1xdzA           ---------------------------------NIEEFTSGLAEKGISLSPRQLEQFELYYDMLVEWITE
1w3bA           ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------PDAVRLETPAPVHALPGF
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ---------------------------------------------------------LEEWQDKWVNGKT
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1khhA           ----------------------------------------------------------------------
1vjpA2          ----------------------------------------------------------------------
1qzzA2          --------------------------------------DVVRTGRPAYAGRYGRPFWEDLSADVALADSF
1hz4A           ----------------------------------------------------------------------
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ------------------------------------------------------SKAKTYWKQIPPTVDG
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          ------------------------------------------------------EAMKELREVTAKHPWN
1pjzA           ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1dusA           -----------------------------------------------------KPTTKSDVKIVEDILRG
1u1iA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EALVYGMHLPHLEFYAKELPPRVEGRVLEVGAFTGALVGFLQRKRPDLEWHALDGVEEAVALGKKRVPEV
1xtpA           PATVSGVHVHDVDIFIASLPGHGTSRALDCGAGIGRITKNLLTKLYA-TTDLLEPVKHXLEEAKRELPVG
2p7hA1          ------------------------GNLLELGSFKGDFTSRLQEHFNDIT--CVEASEEAISHAQGRLKDI
1qsaA1          ----------------------------------------------------------------------
1uirA           ----DEYIYHETLVHPAMLTHPEPKRVLIVGGGEGATLREVLKHPTVEKAVMVDIDGELVEVAKRHMPEW
2h00A1          PLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQN
1p91A           -----GHYQPLRDAIVAQLRERLDTAVLDIGCGEGYYTHAFADALPEITTFGLDVSKVAIKAAAKRYPQV
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
2dulA1          ------------DIVVVLLNILNPKIVLDALSATGIRGIRFALETPAEEVWLNDISEDAYELMKRNDGEL
2avnA1          ETPKWKLYHRLIGSFLEEYLKN-PCRVLDLGGGTGKWSLFLQER--GFEVVLVDPSKEXLEVAREKGVKN
3ck7A1          ----------------------------------------------------------------------
1xdzA           KKEVYLKHFYDSITAAFYVDFNQVNTICDVGAGAGFPSLPIKICFPHLHVTIVDSLNKRITFLEKLSEAL
1w3bA           ----------------------------------------------------------------------
1im8A           ------------------------SNVYDLGCSRGAATLSARRNQPNVKIIGIDNSQPXVERCRQHIAPV
1sqfA2          EDGWVTVQDASAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRR
1aqiA1          ------------DFMVSLAEAPRGGRVLEPACAHGPFLRAFEAHGTGYRFVGVEIDPKALDLPPWAEGIL
2bzgA1          AFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEXKWFADRGHSVVGVEISELGIQEFQNLSYSEEP
1qamA           ---------------MTNIRLNEHDNIFEIGSGKGHFTLELVQRCNFVTAIEIDHKLCKTTENKVDHDNF
1m6yA2          ------HIPVXVREVIEFLKPEDEKIILDCTVGEGGHSRAILEHCPGCRIIGIDVDSEVLRIAEEKLKEF
1bhjA           ----RSRTAEYKAWLLGLLRQHGCHRVLDVACGTGVDSIML--VEEGFSVTSVDASDKMLKYALKERWNR
1d8dA           ----------------------------------------------------------------------
1khhA           ------------------------GRVLEVGFGMAIAASRVQQAPIKEHWECNDGVQRLQNWALKQPHKV
1vjpA2          ----------------------------------------------------------------------
1qzzA2          DALMSCDEDLAYEAPADAYDWSAVRHVLDVGGGNGGMLAAIALRAPHLRGTLVELAGPAERARRRFADRV
1hz4A           ----------------------------------------------------------------------
2f8lA1          ------------YLLEKVIQKKKNVSILDPACGTANLLTTVINQLELKGASGVDVDDLLISLALVGQKXT
2ex4A1          MLGGYGHISSIRKFLQRFLRKTGTSCALDCGAGIGRITKRLLLPLFREVDMVDITEDFLVQAGEEGKRVR
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          -------------------------TVLEAGSGSGGMSLFLSKAGSQGRVISFEVRKDHHDLAKKNYKHW
1ufkA           -------------------------KVLDLGTGSGVLAIAAEKLGGKALGVDIDPMVLPQAEANAKRNGV
1yzhA1          ---------------WRDLFGNDNPIHVEVGSGKGAFVSGXAKQNPDINYIGIDIQKSVLSYALDKVLEV
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          IMTTSADEGQFLSMLLKLINAK---NTMEIGVYTGYSLLATLAIPEDGKILAMDINKENYELGLPVIKKA
1pjzA           ---------KDLQQYWSSLNVVPGARVLVPLCGKSQDMSWLSGQGYHVVGAELSEAAVERYFTERGEQPH
1elrA           ----------------------------------------------------------------------
1ws6A1          ------------------------GRFLDPFAGSGAVG--LEAASEGWEAVLVEKDPEAVRLLKEN----
1wfdA           ----------------------------------------------------------------------
1o54A           ------------SFIAMMLDVKEGDRIIDTGVGSGAMCAVLRAVGSSGKVFAYEKREEFAKLAESNLTKW
1f38A           ------------------AEPGKNDVAVDVGCGTGGVT--LELAGRVRRVYAIDRNPEAISTTEXN----
1t43A           -------------------------RILDLGTGTGAIALALASERPDCEIIAVDRMPDAVSLAQRAIKNI
1qyrA           ---------------VSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQTHFLGPKL
1b89A           ----------------------------------------------------------------------
1dusA           KKLKFVFSYGKVDKGTKILVENVDDDILDLGCGYGVIGIALADEVKST--TXADINRRAIKLAKENIKLN
1u1iA2          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AWHLGWAEEVELPPFDTLLLLSVFPEGLVDQGLESRLAPEAFWKRFAFFERLPLFARLLRPGGLLVYGHG
1xtpA           KFILASXETATLPPYD-LIVIQWTAIYLTDADFV------------KFFKH---CQQALTPNGYIF----
2p7hA1          TYIHSRFEDAQLPRYDNIVLTHVL-EHIDD--------PVALLKR--------INDDWLAEGGRLF----
1qsaA1          ----------------------------------------------------------------------
1uirA           HQGAFDDPRAVLVIDDARAYL-ERTEERYDVVIIDPVGEDNPARLLYTVEFYRLVKAHLNPGGVMGMQTG
2h00A1          NLSDLIKVVKVPQKTLLMDALKEESEIMCNPPFFGITEIMAEGGELEFVKRIHDSLQLKKRLRWYSCMLG
1p91A           TFCVASSHRLP------------FSDTSXD-AIIRIYAPCK----------AEELARVVKPGGWVI----
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
2dulA1          RESKGRAILKGEKTIVINHDDANRLMAERHRYFHFIDLDPFGSPMEFLDT----ALRSAKRRGILGVTAT
2avnA1          VVE-AKAEDLPFPSFEAVLALG--------DVLSYVENKDKA---------FSEIRRVLVPDGLLIATVD
3ck7A1          ----------------------------------------------------------------------
1xdzA           QLE---------NTTFCHDRAETFGQRKDVRESYDIVTARAVARLSVLSELC---LPLVKKNGLFV----
1w3bA           ----------------------------------------------------------------------
1im8A           EILCNDIRHVEIKNASXVILNFTL----------QFLPPE---DRIALLTKI---YEGLNPNGVLVLSE-
1sqfA2          YPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQSEILDAIWPHLKTGGTLVYATC
1aqiA1          LWEPGEAFDLILGPYGIVKAVKDLYKKAFSTWKGKYNLYGAFLEKAV---------RLLKPGGVLVFVVP
2bzgA1          ITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDXIWDRGALVAINPGDRKCYFSLLGKKFQYLLCVL
1qamA           QVLNKDILQFKFPKNQSYKIFGNIPYNISTDIIR-KIVFDSIADEIYLIVEYGFAKRLLNTKRSL-----
1m6yA2          SDRVSLFKVSYREADFLLKTLGIEKVDGIDLGVSTYQLKGENRELENLKEFLKKAEDLLNPGGRIVVIS-
1bhjA           RKEPAFDKWVIEEANWLTLDKDVPAGDGFDAVICLGNSFAHLPDSKGDQSEHRLAASMVRPGGLLVIDHR
1d8dA           ----------------------------------------------------------------------
1khhA           VPLKGLWEEV----------APTLPDGHFDGILYDTYPSEETWHTHQFFIKTHAF-RLLKPGGILTY---
1vjpA2          ----------------------------------------------------------------------
1qzzA2          TVAEGDFFKPLPVTADVVLLSFVL----------------LNWSDEDALTILRGCVRALEPGGRLL----
1hz4A           ----------------------------------------------------------------------
2f8lA1          LLHQDGLANLLVDPVDVVISDLPVGYYPDDENAKTFELCREEGHSFAHFLFIEQGXRYTKPGGYLFF---
2ex4A1          NYFCCGLQDFTPEPDSYDVIWIQW--------------VIGHLTDQHLAEFLRRCKGSLRPNGIIVIKDN
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          RDSWKLSH-VEEWPDNVDFIHKDISGATFDAVALDMLNPHVT---------LPVFYPHLKHGGVCAVVNI
1ufkA           RPRFLEGSLEAALPFGPFDLLVANLY------------------AELHAALAPRYREALVPGGRALLTGI
1yzhA1          GVPNIKLLWVDGSDLTDYFEDGEIDRLYLNFSDPWPKKRHEKRRLTY-KTFLDTFKRILPENGEIHF---
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          GVD----HKIDFREGPALPVLDEMIKDEKNHGSYDFIFVDADKDNYLNY--HKRLIDLVKVGGVIGYDNT
1pjzA           ITSQGDFKVYAAPGIEIWCGDFFALTARDIGHCAAFYDRAAALPADMRERYVQHLEALMPQACSGLYDQA
1elrA           ----------------------------------------------------------------------
1ws6A1          VRRTGLGARVVALPVE------VFLPEAKAQGERFTVAFXAYAXDLAALFGELLASGLVEAGGLYVLQHP
1wfdA           ----------------------------------------------------------------------
1o54A           GLIERVTIKVRDISEG-------FDEKDVDALFLDVPDPWNYIDK---------CWEALKGGGRFAT-VC
1f38A           LQRHGLGDNVTLXEGDAPEALCKIPDIDIAVVGGSGGELQEI---------LRIIKDKLKPGGRIIV-TA
1t43A           HILQSWFSALAGQQFAMIVIDEQDPHLQGDVRFEPLTALVAADSGMADIVHIEQSRNALVSGGFLLLEHG
1qyrA           TIYQQDAMTFNFGMGQPLRVFGNLPYNISTPLMFHLFSYTDAIADMHFMLQKEVVNRLVAGPNSKAYG--
1b89A           ----------------------------------------------------------------------
1dusA           NLDRVVHSDLYENVKDRKYNKIITNPPIRA----------GKEVLHRIIEEG---KELLKDNGEIWVVIQ
1u1iA2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           PFLGKSPEGVEEGLRRLGFDRVERVGEGEYFLVLARKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1uirA           MILLRVHPVVHRTVREAFRY--------------------------------------------------
2h00A1          K--KCSLAPLKEELRIQGVPKVTYT---------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
2dulA1          DGAPLCGAHPRACLRKYLAVPLRGELCHEVG---------------------------------------
2avnA1          NFYTF----LQQXIEKDAWDQITR----------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1sqfA2          SVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQN----------------------------------
1aqiA1          ATWLVLEDFALLREFLAREGKTSVYYLGEVF---------------------------------------
2bzgA1          SYDPTKHPGPPFYVPHAEIERLFGKICNIRCLE-------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           NYDYILSTGCAPPGKNIYYK--------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1khhA           ----------------------------------------------------------------------
1vjpA2          ----------------------------------------------------------------------
1qzzA2          ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2f8lA1          ----------------------------------------------------------------------
2ex4A1          MAQEGDLDVVRRIICSAGLSLLAEE---------------------------------------------
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          TQVIELLDGIRTCELALSCEKISEVIVRDWFLVKLRK---------------------------------
1ufkA           LKDRA--PLVREAMAGAGFRPLEEAAEGEWVLLAYGR---------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          LWNGSVVAPPDAPLRK------------------------------------------------------
1pjzA           LLEGPPFSVPQTWLHRVMSGNWEVTKVGGQ----------------------------------------
1elrA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1o54A           PTTNQVQE-TLKKLQELPFIRIE-----------------------------------------------
1f38A           ILLETKFE-AXECLRDLGFD--------------------------------------------------
1t43A           WQQG---EAVRQAFILAGYHDVE-----------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1dusA           TYXKDVFGNVETVTIKGGYRVLK-----------------------------------------------
1u1iA2          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1khhA           ----------------------------------------------------------------------
1vjpA2          ----------------------------------------------------------------------
1qzzA2          ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1dusA           ----------------------------------------------------------------------
1u1iA2          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1khhA           ----------------------------------------------------------------------
1vjpA2          ----------------------------------------------------------------------
1qzzA2          ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1dusA           ----------------------------------------------------------------------
1u1iA2          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1khhA           ----------------------------------------------------------------------
1vjpA2          ----------------------------------------------------------------------
1qzzA2          ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1dusA           ----------------------------------------------------------------------
1u1iA2          ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGMAYHHLAQVKRALRRP
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          -------------------------------------------------------ELKEQGNRLFVGRK-
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1khhA           ----------------------------------------------------------------------
1vjpA2          ----------------------------------------------------------------------
1qzzA2          ----------------------------------------------------------------------
1hz4A           -----------------------------------------------------SEILFAQGFLQTAWETQ
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1dusA           ----------------------------------------------------------------------
1u1iA2          ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           LKEVLGDHKRAHALRAYPAPYLFRLAQEALEGGEEVLARELLSRARDAGLEAVAEEDLTGLIHLLERLEG
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ------NTGLVTVLAGQMPADYQTIASAIISLANNPNTVLTFARTTGATDFTRQMAAVAFASVARQDAEN
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          YPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYD
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1khhA           ----------------------------------------------------------------------
1vjpA2          ----------------------------------------------------------------------
1qzzA2          ----------------------------------------------------------------------
1hz4A           EKAFQLINEQHLEQLPMHEFLVRIRAQLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQCSLG
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1dusA           ----------------------------------------------------------------------
1u1iA2          ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           PWAAFSVLYQALSRTPQPPLELLALAYRLSRAFRESPEAETARGQYLAALYAAGRAEEVGRLLEEELKAH
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ARLMIPSLAQAQQLNEDQILRDIVAWRLWRDDAIMRSQSTSLIERRVRMALGTGDRRGLNTWLARLPMEA
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          -----------------------SPED-SAGRYVEYMGGAERLLEQARASYARGEYRWVVEVVNRLVFAE
1ya0A1          -------------------NQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSSCS
2c2lA1          EAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEEHQESELHSYLTRLIAAERERELEECQRNH
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          ------------------------------------YRTTFNCNELPTDECLWAWQKNQDIPQLTSISWS
1xdzA           ----------------------------------------------------------------------
1w3bA           ------------------------------SALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQ
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           ------------------------------------------------------------------LSLD
1khhA           ----------------------------------------------------------------------
1vjpA2          ----------------------------------------------------------------------
1qzzA2          ----------------------------------------------------------------------
1hz4A           DLDNARSQLNRLENLLGNGKYHSDWISNANKVRVIYWQMTGDKAAAANWLRHT---------AKPEFANN
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1hxiA           -----------------------ALAFE--AVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARXLD
1zbpA1          -----------------------------------------------------GQLQQALELLIEAIKAS
1a17A           -----------------------------------------------------------------PADGA
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ---------------------LISEDLKIGNTFFKSQNWEMAIKKYTKV-LRYVEGSRAAAEDADGAKLQ
1ouvA           ----------------------------------------------------------------------
1pg3A           --EQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLQEN
2fbnA1          -------------------VQSAFDIKEEGNEFFKKNEINEAIVKYKEALDFFIHTEEW-DDQILLDKKK
1suiA1          ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1elrA           ----------------------------------KQALKEKELGN---DAYKKKDFDTALKHYDKAKELD
1ws6A1          ----------------------------------------------------------------------
1wfdA           ------------------------------------------------ELDAESRYQQALVCYQEGIDML
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           --------------------------YLRSVQNHNNKSVNESLNNLFITEEDYQA-------LRTSIDAY
1dusA           ----------------------------------------------------------------------
1u1iA2          ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           PQALEVLFDLAEHHEAQGDWRRAAEFWQKALEVALYREKDLALAREILRNLLFLRPHDESLALYLEELKA
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          KEKDEWRYWQADLLLERGREAEAKEILHQL----------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          PDNRAARELQADALEQLGYQAENAGWRNSYLSAAYELRHGVP----------------------------
1ya0A1          YICQHCLVHLGDIARYRNQTSQAESYYRHAA---------------------------------------
2c2lA1          EGHEDDGHIRAQQACIEAKHDKYMADMDELFS--------------------------------------
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          PSSQRTEWVYVRLGYDITQYNFFLDQTEGMTDAETLRQRAEIRFLRAL-HYWYFLDLFGKAPFKEHFSND
1xdzA           ----------------------------------------------------------------------
1w3bA           PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTNVLKEARIFDRAVAAYLRALSLSPNHAVVHGNLACVYY
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           SPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAV---LQRDERSERAFKLTRDAIE-
1khhA           ----------------------------------------------------------------------
1vjpA2          ----------------------------------------------------------------------
1qzzA2          ----------------------------------------------------------------------
1hz4A           HFLQGQWRNIARAQILLGEFEPAEIVLEELNENAYWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEA
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1hxiA           PKDIAVHAALAVSHTNEHNANAALASLRAWL---------------------------------------
1zbpA1          PKDASLRSSFIELLCIDGDFERADEQLXQSIK----LFPEYLPGASQLRHLVKAAQARKDFAQGAAT---
1a17A           LKRAEELKTQANDYFKAKDYENAIKFYSQAIE--------------------------------------
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          PVALSCVLNIGACKLKMSDWQGAVDSCLEALEIGWQGLKEYDQALADLKKAQEIAPEDKAIQAEL-----
1ouvA           ----KELVGLGAKSYKEKDFTQAKKYFEKACDL----KENSGCFNLGVLYYQGGVEKNLKKAASFYAKAC
1pg3A           GDRTAIIWE--GDDTSQSKHISYRELHRDVCRFA------------------------------------
2fbnA1          NIEISCNLNLATCYNKNKDYPKAIDHASKVLGVANMYFGFLEEAKENLYKAASLNPNNLDIRNSYELC--
1suiA1          ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1elrA           PTNMTYITNQAAVYFEKGDYNKCRELCEKAIENSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKI
1ws6A1          ----------------------------------------------------------------------
1wfdA           LQVLKGTKESSKRCVLRTKISGYMDRAENIKK---YLDQEKEDGKS------------------------
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           DNFDNISLAQRLEKHELIEFRRIA----------------------------------------------
1dusA           ----------------------------------------------------------------------
1u1iA2          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           VGEGLKALGEEAPHLPEAPRDLLEEDLPRFHGEHLVVVGGHTQLRSRLVPFLEGRGLRVDWYDADTVGVG
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          LPVEKKGTELYTYIQNELNEIEADMYEPRQAPFGRADKAANWLLRARL----------------------
1xdzA           ----------------------------------------------------------------------
1w3bA           EQGLIDLA--------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1khhA           ----------------------------------------------------------------------
1vjpA2          ---------------------------------------GATPFTADVLSHLAQRNRYVKVAQFNIGGNF
1qzzA2          ----------------------------------------------------------------------
1hz4A           MAQQLRQLIQ------------------------------------------------------------
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           DLNYSNGC--------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1elrA           LKE-------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1dusA           ----------------------------------------------------------------------
1u1iA2          ---------------------------------------GETLVKTTLAPMFAYRNMEVVWMSYNILGDG


                         +         .         .         .         .         *         .:910
query           KEALRRILNRLEKAHGLMIVSSYVGHDLSEPVRLEAERLGVPVHVIPxxxxxxxxxxxxxxxxxxxxxxx
1xtpA           ----------------------------------------------------------------------
2p7hA1          ----------------------------------------------------------------------
1qsaA1          ----------------------------------------------------------------------
1uirA           ----------------------------------------------------------------------
2h00A1          ----------------------------------------------------------------------
1p91A           ----------------------------------------------------------------------
2cfuA2          ----------------------------------------------------------------------
1ya0A1          ----------------------------------------------------------------------
2c2lA1          ----------------------------------------------------------------------
2dulA1          ----------------------------------------------------------------------
2avnA1          ----------------------------------------------------------------------
3ck7A1          ----------------------------------------------------------------------
1xdzA           ----------------------------------------------------------------------
1w3bA           ----------------------------------------------------------------------
1im8A           ----------------------------------------------------------------------
1sqfA2          ----------------------------------------------------------------------
1aqiA1          ----------------------------------------------------------------------
2bzgA1          ----------------------------------------------------------------------
1qamA           ----------------------------------------------------------------------
1m6yA2          ----------------------------------------------------------------------
1bhjA           ----------------------------------------------------------------------
1d8dA           ----------------------------------------------------------------------
1khhA           ----------------------------------------------------------------------
1vjpA2          LALTDDGKNKSKEFTKSSIVKDILGYD-------------APHYIKP-----------------------
1qzzA2          ----------------------------------------------------------------------
1hz4A           ----------------------------------------------------------------------
2f8lA1          ----------------------------------------------------------------------
2ex4A1          ----------------------------------------------------------------------
1hxiA           ----------------------------------------------------------------------
1zbpA1          ----------------------------------------------------------------------
1a17A           ----------------------------------------------------------------------
2b25A1          ----------------------------------------------------------------------
1ufkA           ----------------------------------------------------------------------
1yzhA1          ----------------------------------------------------------------------
1ihgA1          ----------------------------------------------------------------------
1ouvA           ----------------------------------------------------------------------
1pg3A           ----------------------------------------------------------------------
2fbnA1          ----------------------------------------------------------------------
1suiA1          ----------------------------------------------------------------------
1pjzA           ----------------------------------------------------------------------
1elrA           ----------------------------------------------------------------------
1ws6A1          ----------------------------------------------------------------------
1wfdA           ----------------------------------------------------------------------
1o54A           ----------------------------------------------------------------------
1f38A           ----------------------------------------------------------------------
1t43A           ----------------------------------------------------------------------
1qyrA           ----------------------------------------------------------------------
1b89A           ----------------------------------------------------------------------
1dusA           ----------------------------------------------------------------------
1u1iA2          KVLSARDNKESKVLSKDKVLEKMLGYS-------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxx
1xtpA           ------
2p7hA1          ------
1qsaA1          ------
1uirA           ------
2h00A1          ------
1p91A           ------
2cfuA2          ------
1ya0A1          ------
2c2lA1          ------
2dulA1          ------
2avnA1          ------
3ck7A1          ------
1xdzA           ------
1w3bA           ------
1im8A           ------
1sqfA2          ------
1aqiA1          ------
2bzgA1          ------
1qamA           ------
1m6yA2          ------
1bhjA           ------
1d8dA           ------
1khhA           ------
1vjpA2          ------
1qzzA2          ------
1hz4A           ------
2f8lA1          ------
2ex4A1          ------
1hxiA           ------
1zbpA1          ------
1a17A           ------
2b25A1          ------
1ufkA           ------
1yzhA1          ------
1ihgA1          ------
1ouvA           ------
1pg3A           ------
2fbnA1          ------
1suiA1          ------
1pjzA           ------
1elrA           ------
1ws6A1          ------
1wfdA           ------
1o54A           ------
1f38A           ------
1t43A           ------
1qyrA           ------
1b89A           ------
1dusA           ------
1u1iA2          ------