[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81585.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e2dA.bssp"
#ERROR : Can't open dsspfile "1g3uA.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1j90A.bssp"
#ERROR : Can't open dsspfile "1p5zB.bssp"
#ERROR : Can't open dsspfile "1uf9A.bssp"
#ERROR : Can't open dsspfile "1knqA.bssp"
#ERROR : Can't open dsspfile "1e2hA.bssp"
#ERROR : Can't open dsspfile "1grqA.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1bifA1.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "2bdtA1.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1gg4A4.bssp"
#ERROR : Can't open dsspfile "2v3jA1.bssp"
#ERROR : Can't open dsspfile "1fgsA2.bssp"

## Summary of PDB Search
:198
    3e-51  28%  1e2dA  [c.37.1.1] THYMIDYLATE KINASE
    8e-45  31%  1g3uA  [c.37.1.1] THYMIDYLATE KINASE
    2e-41  40%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    1e-25  21%  1j90A  [c.37.1.1] DEOXYRIBONUCLEOSIDE KINASE
    4e-23  18%  1p5zB  [c.37.1.1] DEOXYCYTIDINE KINASE
    3e-13  25%  1uf9A  [c.37.1.1] TT1252 PROTEIN
    2e-11   8%  1knqA  [c.37.1.17] GLUCONATE KINASE
    7e-10  18%  1e2hA  [c.37.1.1] THYMIDINE KINASE
    6e-07  16%  1grqA  [c.37.1.3] CHLORAMPHENICOL 3-O PHOSPHOTRANSFERASE
    3e-06  16%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    2e-05  26%  1bifA1 [c.37.1.7] 6-PHOSPHOFRUCTO-2-KINASE/ FRUCTOSE-2,6- A:37 --
    4e-05  11%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    6e-05  21%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    1e-04  22%  2bdtA1 [c.37.1.25] BH3686 A:1 -- 176
    1e-04  18%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    3e-04  18%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    4e-04  19%  1gg4A4 [c.72.2.1] UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,6- A:99
    4e-04  15%  2v3jA1 [c.116.1.6] ESSENTIAL FOR MITOTIC GROWTH 1 A:23 -- 251
    0.001  16%  1fgsA2 [c.72.2.2] FOLYLPOLYGLUTAMATE SYNTHETASE A:1 -- 296
:198

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MPGLFLTLEGLDGSGKTTQARRLAAFLEAQGRPVLLTREPGGGLPEVRSLLLTQELSPEAEYLLFSADRA
1e2dA           --GALIVLEGVDRAGKSTQSRKLVEALCAAGHRAELLRFPERSTEKLLSSYLQKKVEDHSVHLLFSANRW
1g3uA           ---MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSDIAAEALHGESSVYAMATLFALDRA
4tmkA           --SKYIVIEGLEGAGKTTARNVVVETLEQLGRDMVFTREPGGTQLKLRSLLLDIKITDKAEVLMFYAARV
1j90A           --PFTVLIEGNIGSGKTTYLNHFEKYK----NDICLLTEPVEKWRNVLMYKDPKKWAMPFQSYVTLTMLQ
1p5zB           --IKKISIEGNIAAGKSTFVNILKQLCEDWEEPVARWCNVQSTEKPERWSFTFQTYACLSRIRAQLASLN
1uf9A           ---IIIGITGNIGSGKSTVAALLR----SWGYPVLRARENKELKRLFPEAVVGGRLDRRARLVFSDPERL
1knqA           ----------------------------------------------------------DGDFLHPRRNIE
1e2hA           -TLLRVYIDGPHGMGKTTTTQLLRDDIVYVPEPMTYWRVLGASETIANIYTTQHRAVVMTSAQITMGMPY
1grqA           MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKSAEGGIEFDADGGVSIGPEFRALE
1yr6A1          ----IVVFVGTAGSGKTTLTGEFGRYLEDNYKVAYVNLDTGVKELPYEPSIDVREFVTVEEIMREGYGPN
1bifA1          -------MVGLPARGKTYISKKLTRYLNFIGVPTREFN-----VGQYRRDMVKTYKSFE----FFLPDNE
1n25A           -KKRYWLFKGPIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIVVFEDVKGTGGESRDLPSGQG
1eg7A           ---------TPAGEGKTTTSVGLTDALARLGKRVMVC----------------------------LREPS
2bdtA1          ----LYIITGPAGVGKSTTCKRLAAQL---DNSAYIE---GDIINH----XVVGGYRPPWESDELLALTW
2axpA1          ----LIILEGPDCCFKSTVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHFNKLA---------------
1lw7A2          -FAKTVAILGGESSGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGG------------------------
1gg4A4          ------------SSGKTSVKEXTAAILSQCGNTLYTAGNLNNDIGVPXTLLRLTPEYDYAVIELGANHQG
2v3jA1          -ITKRXIVVLAXASLETHKIYVLLNCDDHQGLLKK-----------------------------------
1fgsA2          --------------GKGSAANAIAHVLEASGLTVGLYTSPFIMRFNERIMIDHEPIPD--AALVNAVAFV


                         .         .         *         .         .         .         .:140
query           EHVRKVILPGLAAGKVVISDRYLDSSLAYQGYGRGLPLPWLREVAREATRGLKPRLTFLLDLPPEAALRR
1e2dA           EQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPDV---GLPKPDLVLFLQLQLADAAKR
1g3uA           GAV-HTIQGLCRGYDVVILDRYVASNAAYSAAAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGER
4tmkA           QLVETVIKPALANGTWVIGDRHDLSTQAYQGGGRGIDQHMLATLRDAVLGDFRPDLTLYLDVTPEVGLKR
1j90A           SHTAPTNKKLKIMERSIFSARYCFVENMRRGSLEQGMYNTLEEWYKFIEEHVQADLIIYLRTSPEVAYER
1p5zB           GKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHR
1uf9A           KALEAVVHPEVRRLLXEELSRLEAPLVFLEI-----------PLLFEKGWEGRLHGTLLVAAPLEERVRR
1knqA           KMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLICSALKKHYRDLLREGNPNLSFIYLKGDFDVIESR
1e2hA           AVTDAVLAPHIGGALTLIFDRHPIAALLCYPAMGSMTPQAVLAFVALIPPTLPGTNIVLGALPEDRHIDR
1grqA           GAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSF-------------VGDLDVLWVGVRCDGAVAEG-
1yr6A1          GAIVESY---------------------------------------------------------------
1bifA1          EGLK------------------------------------------------------------------
1n25A           INNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPPGIVT-MNEYSVPKTLQARFVKQIDFRPKDYLKHCLER
1eg7A           LGPSFGIKGGAAGGGYAQVVPMEDINLHFTGDIHAVTYAHNLLAAMVDNHLQQG--NVLNIDPRTITWRR
2bdtA1          KNITDLTVNFLLAQNDVVLD-YIAFPDEAEA---------LAQTVQAKVDDVEIRF-IILWTNREELLRR
2axpA1          ------------DEDNVIIDRFVYSNLVYAKKFKDYSILTERQLRFIEDKIKAKAKVVYLHADPSVIKKR
1lw7A2          ----------------------------------------------------------------------
1gg4A4          EIAWTVSLAGVAKAKGEIFSGLPENGIAIXNADNNDWLNWQSVIGS------RKVWRFSPN-AANSDFTA
2v3jA1          ----------------------------------------------------------------------
1fgsA2          RAALERLQQQQADFNVTEFEFITALAYWYFRQRQ---VDVAVIEVGDSTNVITPVVSVLTEV--------


                         +         .         .         .         .         *         .:210
query           VRRPDRLEGLGLEFFRRVREGYLALARAEPGRFVVLDATLPEEEIARAIQAHLRPLLP
1e2dA           AFGHERYE--NGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIA
1g3uA           SRRAQRDPGRAAELQQRTGAVYAELAQGWGGRWLVVGADVDPGRLAATL---------
4tmkA           ARELDRIEQESFDFFNRTRARYLELA-AQDKSIHTIDATQPLEAVMDAIRTTVTHWVK
1j90A           IRQRARSECVPLKYLQELHELHIHQRRPQSCKVLVLDADLNLE---------------
1p5zB           IYLRGREQGIPLEYLEKLHYKHTNFDYLQEVPILTLDVNEDFKDKYESLVEKVKEFL-
1uf9A           VSGLSREEVLARERAQXPEEEKRKRA------TWVLENTGSLEDLERALKAVLAELT-
1knqA           LKA-RKGHFFKTQMLVTQFETLQEPGADET-DVLVVDIDQPLEGVVASTIEVIK----
1e2hA           LKRQRPGERLDLAMLAAIRRVYGLLANT------------------------------
1grqA           -----RETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP---
1yr6A1          ----------------------------------------------------------
1bifA1          ----------------------------------------------------------
1n25A           SEFLLEKRIIQSALLLMLIWYRVEWKERLDKEFSLSVY----QKMKFNVAMGIGVL--
1eg7A           ----------------------------------------------------------
2bdtA1          DALRKKGE--------------------------------------------------
2axpA1          LRVRGDEYIEGKDIDSILE---LYREVXSNAGLHTYSGQWSSDEIAKDIIFLV-----
1lw7A2          ----------------------------------------------------------
1gg4A4          TNIHVTSHGTEFTLQTPTGSVLLPL----PGRHNIANALATLDAIKAGLA--------
2v3jA1          ----------------------------------------------------------
1fgsA2          --ALDTITAIAKHKAGIIKRG-------------------------------------