[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81728.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "2ba0A1.bssp"
#ERROR : Can't open dsspfile "2oceA4.bssp"
#ERROR : Can't open dsspfile "1jjgA.bssp"
#ERROR : Can't open dsspfile "2nn6H1.bssp"
#ERROR : Can't open dsspfile "1t9hA1.bssp"
#ERROR : Can't open dsspfile "2ja9A1.bssp"
#ERROR : Can't open dsspfile "2ot2A1.bssp"
#ERROR : Can't open dsspfile "2ahoB2.bssp"
#ERROR : Can't open dsspfile "1y14B1.bssp"
#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "1hr0W.bssp"
#ERROR : Can't open dsspfile "1go3E1.bssp"
#ERROR : Can't open dsspfile "2id0A1.bssp"
#ERROR : Can't open dsspfile "1wi5A.bssp"
#ERROR : Can't open dsspfile "1bmfD1.bssp"
#ERROR : Can't open dsspfile "2nn6I1.bssp"
#ERROR : Can't open dsspfile "1hh2P1.bssp"
#ERROR : Can't open dsspfile "1k3rA1.bssp"
#ERROR : Can't open dsspfile "1jt8A.bssp"
#ERROR : Can't open dsspfile "1smxA.bssp"
#ERROR : Can't open dsspfile "1luzA.bssp"
#ERROR : Can't open dsspfile "1kl9A2.bssp"

## Summary of PDB Search
:142
    1e-14  46%  1sroA  [b.40.4.5] PNPASE
    2e-11  21%  2ba0A1 [b.40.4.5] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4 A:53
    4e-11  31%  2oceA4 [b.40.4.5] HYPOTHETICAL PROTEIN PA5201 A:637 -- 730
    1e-10  15%  1jjgA  [b.40.4.5] M156R
    1e-10  20%  2nn6H1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP4 H:73 -- 167
    7e-10  15%  1t9hA1 [b.40.4.5] PROBABLE GTPASE ENGC A:1 -- 67
    5e-09  14%  2ja9A1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP40 A:62 -- 151
    2e-08  21%  2ot2A1 [b.40.14.1] HYDROGENASE ISOENZYMES FORMATION PROTEIN HYPC
    4e-08  25%  2ahoB2 [b.40.4.5] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT
    8e-08  14%  1y14B1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE II 19 KDA B:81 --
    9e-08  17%  1d7qA  [b.40.4.5] TRANSLATION INITIATION FACTOR 1A
    1e-07  22%  1hr0W  [b.40.4.5] TRANSLATION INITIATION FACTOR
    2e-07  35%  1go3E1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE SUBUNIT E E:79 --
    2e-07  14%  2id0A1 [b.40.4.5] EXORIBONUCLEASE 2 A:558 -- 644
    3e-07  16%  1wi5A  [b.40.4.5] RRP5 PROTEIN HOMOLOG
    4e-07  10%  1bmfD1 [a.69.1.1] BOVINE MITOCHONDRIAL F1-ATPASE D:358 -- 475
    4e-07  16%  2nn6I1 [b.40.4.5] 3'-5' EXORIBONUCLEASE CSL4 HOMOLOG I:61 -- 185
    2e-06  14%  1hh2P1 [b.40.4.5] N UTILIZATION SUBSTANCE PROTEIN A P:127 -- 198
    3e-06  10%  1k3rA1 [b.40.4.10] CONSERVED PROTEIN MT0001 A:93 -- 163
    6e-06  20%  1jt8A  [b.40.4.5] PROBABLE TRANSLATION INITIATION FACTOR 1A
    2e-05  40%  1smxA  [b.40.4.5] RIBONUCLEASE E
    3e-05  17%  1luzA  [b.40.4.5] PROTEIN K3
    6e-04  35%  1kl9A2 [b.40.4.5] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 A:3
:142

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxELEAGTXXXXXXXXXXSFGAFVELAGGEQGLVHISQIAHEYVTNVRDYLNEG
1sroA           ------------------EIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEKVTDYLQMG
2ba0A1          -----------------------------------NGWAVDIYSPYQAFLPVSENPEMKNKKPNEVLDIG
2oceA4          ------------------DLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAG
1jjgA           -----------------------------------GIFKVRLLGYEGHECILLDYLNYRQDTLDRLKERG
2nn6H1          -----------------------------------KRWKVETNSRLDSVLLLSSMNEL---AMRGFLQEG
1t9hA1          ----------------------------------SGFYYVLDESEDSDKVIQCRGRG-IFRKNKITPLVG
2ja9A1          -----------------------------------DSYKVSLQNFSSSVSLSYMAFPNASKKNRPTLQVG
2ot2A1          -----------------------------------NQAKVDV-CGIQRDVDLTLVGSC---DENGQPRVG
2ahoB2          ------------------LPSEGEILIATVKQVFDYGSYVSLDEGLQAFLPWSEVSNI-----RDVLKEN
1y14B1          -----------------------------------HGFEVQV-GPMKVFVTKHLMPQDLTFSSEDVITIK
1d7qA           -------------------FKEDGQEYAQVIKMLGNGRLAMCFDGVKRLCHIRGKLRKKVW-----INTS
1hr0W           ------------------KEKDTIRTEGVVTEALPNATFVKLDSGPEILAYISGK----MRMHYIRILPG
1go3E1          -----------------------------------FGSFVRL-GPLDGLIHVSQIMDDYVKETGKVLEIG
2id0A1          ----------------------------------RGGXRVRLVNGAIAFIPAPFLHAVRDELVCSQYKVT
1wi5A           ------------------ALKPGMLLTGTVSSLEDHGYLVDIGGTRAFLPLLKAQEYIRQKNKGAKLKVG
1bmfD1          -----------------------------------LKETIKGQILAGEYDHLPEQAFYMVGPIEEAVAKA
2nn6I1          -----------------------------------RFAKVHILYSFRGTIRKEDVRATEKVEIYKSFRPG
1hh2P1          -----------------------------------EWADIRI-GKLETRLPKKEWIP------GEEIKAG
1k3rA1          ------------------KPVTGEYRQGLTVKRVKKGTLVDIGADKLALCR-------------EKLTVN
1jt8A           -----------------------------------ASRVVRCLDGKTRLGRIPGRLKNRIW-----VREG
1smxA           ------------------------------------AAFVDYGAERHGFLPLKEIAREYFPNIKDVLREG
1luzA           ----------------------------------DYALYIYDYPHFEAILAESVKXHXDRYVEYRDKLVG
1kl9A2          ------------------------------------GAYVSLLEYNEGXILLS------------ELRIG


                         .         .         *         .         .         .         .:140
query           DIVQVLIKGRDAKGRLDLSIKDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1sroA           QEVPVKVLEVDRQGRIRLSIKE------------------------------------------------
2ba0A1          DAIIAKVLNIDPKMKVTLTMKDR-----------------------------------------------
2oceA4          DIVKVKVMEVDPRNRVGLSMRMS-----------------------------------------------
1jjgA           RVIKTRVVRAD-GLYVDLR---------------------------------------------------
2nn6H1          DLISAEVQAVFSDGAVSLHTRSL-----------------------------------------------
1t9hA1          DYVVYQAENDK-EGYLMEIKE-------------------------------------------------
2ja9A1          DLVYARVCTAEKELEAEIECFDS-----------------------------------------------
2ot2A1          QWVLVHVGFAMAEARDTLDALQ------------------------------------------------
2ahoB2          KVIVKVIRVDRRKGTVDVSLK-------------------------------------------------
1y14B1          SRIRVKIEGCIQVSSIHAIGSIK-----------------------------------------------
1d7qA           DIILVGLRDYQNKADVILKYNAD-----------------------------------------------
1hr0W           DRVVVEITPYDTRGRIVYR---------------------------------------------------
1go3E1          DYVRARIVAISKASKIALTMRQP-----------------------------------------------
2id0A1          DVIDVTIAEVRETRSIIARPV-------------------------------------------------
1wi5A           QYLNCIVEKVKNGGVVSLSVGHS-----------------------------------------------
1bmfD1          DKLA------------------------------------------------------------------
2nn6I1          DIVLAKVISLGAQSNYLLTTAEN-----------------------------------------------
1hh2P1          DLVKVYIIDVVTTKGPKILVS-------------------------------------------------
1k3rA1          RIMSFRVVRLGKEILIEPDEP-------------------------------------------------
1jt8A           DVVIVKPWEVQGDQKCDIIWR-------------------------------------------------
1smxA           QIVQIDKEERGNKG--------------------------------------------------------
1luzA           KTVKVKVIRVDTKGYIDVNYKR------------------------------------------------
1kl9A2          RNECVVVIRVDEKGYIDLSKR-------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xx
1sroA           --
2ba0A1          --
2oceA4          --
1jjgA           --
2nn6H1          --
1t9hA1          --
2ja9A1          --
2ot2A1          --
2ahoB2          --
1y14B1          --
1d7qA           --
1hr0W           --
1go3E1          --
2id0A1          --
1wi5A           --
1bmfD1          --
2nn6I1          --
1hh2P1          --
1k3rA1          --
1jt8A           --
1smxA           --
1luzA           --
1kl9A2          --