[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81760.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2id1A1.bssp"
#ERROR : Can't open dsspfile "2o5aA1.bssp"

## Summary of PDB Search
:113
    2e-20  25%  2id1A1 [d.218.1.12] HYPOTHETICAL PROTEIN A:1 -- 120
    2e-17  32%  2o5aA1 [d.218.1.12] BH1328 PROTEIN A:2 -- 114
:113

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxLIERIKELLAEKKAENVVALDLRRVSETLDYFVVASATSTPHLQAXXXXXXXXXXXXXXRP
2id1A1          ---------ISKLAIEALEDIKGKDIIELDTSKLTSLFQRXIVATGDSNRQVKALANSVQVKLKEAGVDI
2o5aA1          ---------LLQLAVNAVDDKKAEQVVALNXKGISL--DFFLICHGNSEKQVQAIAHELKKVAQEQGIEI


                         .         .         *         .         .         .         .:140
query           RPTAGQSPRWVVLDYGEVVVHLMTPEAREYYDLEGFWADAExx
2id1A1          VGSEGHESEWVLVDAGDVVVHVXLPAVRDYYDIEALWGGQK--
2o5aA1          KRLEGYEARWVLIDLGDVVVHVFHKDERAYYNLEKLWPTVE--