[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81794.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yliA1.bssp"
#ERROR : Can't open dsspfile "2gvhA1.bssp"
#ERROR : Can't open dsspfile "1vpmA.bssp"
#ERROR : Can't open dsspfile "2gvhA2.bssp"
#ERROR : Can't open dsspfile "2cy9A1.bssp"
#ERROR : Can't open dsspfile "1bvqA.bssp"
#ERROR : Can't open dsspfile "2av9A1.bssp"
#ERROR : Can't open dsspfile "1sh8A.bssp"
#ERROR : Can't open dsspfile "2aliA1.bssp"
#ERROR : Can't open dsspfile "1yocA1.bssp"
#ERROR : Can't open dsspfile "2hboA1.bssp"
#ERROR : Can't open dsspfile "2nujA1.bssp"
#ERROR : Can't open dsspfile "1o0iA.bssp"
#ERROR : Can't open dsspfile "2ownA1.bssp"
#ERROR : Can't open dsspfile "1z54A1.bssp"
#ERROR : Can't open dsspfile "2ownA2.bssp"
#ERROR : Can't open dsspfile "1q4sA.bssp"
#ERROR : Can't open dsspfile "1z6bA1.bssp"
#ERROR : Can't open dsspfile "1c8uA1.bssp"
#ERROR : Can't open dsspfile "1tbuA1.bssp"
#ERROR : Can't open dsspfile "1s5uA.bssp"
#ERROR : Can't open dsspfile "1j1yA.bssp"
#ERROR : Can't open dsspfile "1njkA.bssp"
#ERROR : Can't open dsspfile "2cyeA1.bssp"
#ERROR : Can't open dsspfile "2gf6A1.bssp"
#ERROR : Can't open dsspfile "2hx5A1.bssp"
#ERROR : Can't open dsspfile "1iq6A.bssp"
#ERROR : Can't open dsspfile "2c2iA1.bssp"
#ERROR : Can't open dsspfile "2oafA1.bssp"
#ERROR : Can't open dsspfile "2ov9A1.bssp"
#ERROR : Can't open dsspfile "2essA2.bssp"
#ERROR : Can't open dsspfile "2oiwA1.bssp"
#ERROR : Can't open dsspfile "1zkiA1.bssp"
#ERROR : Can't open dsspfile "1pn2A2.bssp"
#ERROR : Can't open dsspfile "1ixlA.bssp"
#ERROR : Can't open dsspfile "2f3xA1.bssp"

## Summary of PDB Search
:125
    3e-25  32%  1yliA1 [d.38.1.1] PUTATIVE ACYL-COA THIOESTER HYDROLASE HI0827 A:11
    4e-21  32%  2gvhA1 [d.38.1.1] AGR_L_2016P A:9 -- 143
    8e-19  33%  1vpmA  [d.38.1.1] ACYL-COA HYDROLASE
    1e-12  31%  2gvhA2 [d.38.1.1] AGR_L_2016P A:147 -- 262
    7e-11  19%  2cy9A1 [d.38.1.5] THIOESTERASE SUPERFAMILY MEMBER 2 A:13 -- 139
    2e-10  12%  1bvqA  [d.38.1.1] PROTEIN (4-HYDROXYBENZOYL COA THIOESTERASE)
    5e-10  16%  2av9A1 [d.38.1.1] THIOESTERASE A:5 -- 146
    5e-10  11%  1sh8A  [d.38.1.5] HYPOTHETICAL PROTEIN PA5026
    5e-10  13%  2aliA1 [d.38.1.1] HYPOTHETICAL PROTEIN PA2801 A:5 -- 134
    1e-09  11%  1yocA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA1835 A:1 -- 145
    1e-09  22%  2hboA1 [d.38.1.5] HYPOTHETICAL PROTEIN (NP_422103.1) A:12 -- 153
    1e-09  12%  2nujA1 [d.38.1.1] THIOESTERASE SUPERFAMILY A:3 -- 161
    4e-09  16%  1o0iA  [d.38.1.5] HYPOTHETICAL PROTEIN HI1161
    5e-09   8%  2ownA1 [d.38.1.8] PUTATIVE OLEOYL-[ACYL-CARRIER PROTEIN] A:3 -- 149
    7e-09  17%  1z54A1 [d.38.1.1] PROBABLE THIOESTERASE A:1 -- 132
    2e-08   6%  2ownA2 [d.38.1.8] PUTATIVE OLEOYL-[ACYL-CARRIER PROTEIN] A:150 --
    2e-08  12%  1q4sA  [d.38.1.5] THIOESTERASE
    3e-08  13%  1z6bA1 [d.38.1.6] FATTY ACID SYNTHESIS PROTEIN A:84 -- 229
    3e-08   7%  1c8uA1 [d.38.1.3] ACYL-COA THIOESTERASE II A:2 -- 115
    8e-08   9%  1tbuA1 [d.38.1.3] PEROXISOMAL ACYL-COENZYME A THIOESTER HYDROLASE
    1e-07  24%  1s5uA  [d.38.1.1] PROTEIN YBGC
    1e-07  22%  1j1yA  [d.38.1.5] PAAI PROTEIN
    2e-07  14%  1njkA  [d.38.1.1] HYPOTHETICAL PROTEIN YBAW
    3e-07  36%  2cyeA1 [d.38.1.1] CONSERVED HYPOTHETICAL PROTEIN, TTHA1846 A:1 --
    4e-07  22%  2gf6A1 [d.38.1.1] CONSERVED HYPOTHETICAL PROTEIN A:1 -- 134
    1e-06  30%  2hx5A1 [d.38.1.1] HYPOTHETICAL PROTEIN A:1 -- 144
    2e-06  12%  1iq6A  [d.38.1.4] (R)-SPECIFIC ENOYL-COA HYDRATASE
    2e-06  13%  2c2iA1 [d.38.1.4] RV0130 A:2 -- 150
    3e-06  23%  2oafA1 [d.38.1.1] THIOESTERASE SUPERFAMILY A:1 -- 143
    3e-06  15%  2ov9A1 [d.38.1.5] HYPOTHETICAL PROTEIN A:7 -- 209
    8e-06   7%  2essA2 [d.38.1.8] ACYL-ACP THIOESTERASE A:150 -- 247
    1e-05  28%  2oiwA1 [d.38.1.1] PUTATIVE 4-HYDROXYBENZOYL-COA THIOESTERASE A:1 --
    2e-05  26%  1zkiA1 [d.38.1.5] HYPOTHETICAL PROTEIN PA5202 A:4 -- 129
    3e-05  12%  1pn2A2 [d.38.1.4] PEROXISOMAL HYDRATASE-DEHYDROGENASE-EPIMERASE
    5e-05  33%  1ixlA  [d.38.1.5] HYPOTHETICAL PROTEIN PH1136
    0.001  13%  2f3xA1 [d.38.1.5] TRANSCRIPTION FACTOR FAPR A:66 -- 186
:125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MEARTLELVFPEHTNPXXXXXXXXXXXXMDKVGSYAAARRAKRPVVTVAVGSVEFKVPIRTGDLLEVVAR
1yliA1          ------TLAMPSDTNANGDIFGGWIMSQMDMGGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGQ
2gvhA1          -TTRLIDIVFPGDTNHHGTLFGGTGLALXDRVAFIAATRFGRTPFVTASCERIDFRQPARIGHIVEFTAR
1vpmA           -RTIQTRLVLPPDTNHLGTIFGGKVLAYIDEIAALTAXKHANSAVVTASIDSVDFKSSATVGDALELEGF
2gvhA2          ------EIVFPDQANSAGRXFGGEAIAYXTKAAFVAASRYCGKLVVLASSERIDFARAIEIGEIVEAQAH
2cy9A1          --------VEEQHTNKLGTLHGGLTATLVDSISTXALXCTP----GVSVDXNITYXSPAKIGEEIVITAH
1bvqA           -------------------------------PPWRQTVVERGIVGTPIVSCNASFVCTASYDDVLTIETC
2av9A1          YLHFQPISTRWHDNDIYGHVNNVTYYAFFDTAVNTYLIEQGGEVIGLVVSSSCDYFAPVAFPQRIEXGLR
1sh8A           ----RLRMPGAGNENHIGSMYAGALFTLAELPGGALFLTDSARFYPIVKEMTLRFRRPAKGDIRVQLETE
2aliA1          LLHTAHIPVRWGDXDSYGHVNNTLYFQYLEEARVAWFDLEGAAEGPVVLQSLHTYLKPVVHPATVVVELY
1yocA1          -YAEVTFPKRREVLNHIGTVHAIALCNAAELAAGTMTDASIPAGHRWIPRGTVEYLAKATGDVRAVADGS
2hboA1          ----------EHHTNGLGNCHGGXLXSFADXAWGRIISLQKSYSWVTVRLX-CDFLSGAKLGDWVEGEGE
2nujA1          --------VRFGELDAIGHVNHTAYLRWYESFRLPFLKAGPTSPRLVLKQVHCTYLAEXGXGEDYVITGR
1o0iA           -WIEATXPVDHRTXQPFGVLHGGVSVALAETIGSLAGSLCLEEGKTVVGLDNANHLRPVRSGKVT-ARAT
2ownA1          SLYSEQHRITYYECDRTGRATLTTLIDIAVLASEDQSDAQSHGVGWVVTQYAIDITRXPRQDEVVTIAVR
1z54A1          MESVTRIKVRYAETDQMGVVHHSVYAVYLEAARVDFHRVEARGVFFPVVELGLTFRAPARFGEVVEVRTR
2ownA2          -------HVRFFDIDPNRHVNNAHYFDWLVDTLPATFLL-----QHDLVHVDVRYENEVKYGQTVTAHAN
1q4sA           -RATASVEVTDTLRQRWGLVHGGAYCALAEMLATEATVAHEKGMMAVGQSNHTSFFRPVKEGHVR-AEAV
1z6bA1          ------EPFFNGHFPQKQIMPGVLQIEALAQLAGILCLKSDNNLFLFAGVDGVRWKKPVLPGDTLTMQAN
1c8uA1          ------LFRGQSEDLGLRQVFGGQVVGQALYAAKETVPE-----ERLVHSFHSYFLRPGDSKKPIIYDVE
1tbuA1          -------LSPTSFVTKYLPTFGGTLVSQSLLASLHTV-----PLNFFPTSLHSYFIKGGDPRTKITYHVQ
1s5uA           --------------------------------HFSQQALMAERVAFVVRKMTVEYYAPARLDDMLEIQTE
1j1yA           -EAVVAGEVRADHLNLHGTAHGGFLYALADSAFALASNTRGPAVALSC---RMDYFRPLGAGARVEARAV
1njkA           ----------------------------LENSDSFQWXTAHNIAFVVVNI-NINYRRPAVLSDLLTITSQ
2cyeA1          ----------------------------------------LEEGHFVVARXEVDYLRPILLGDEVFVGVR
2gf6A1          -----------------------------------------------IAESHAIYHRPVKLGDKLTVLLN
2hx5A1          ---------------------------------------------------QADFRRPIHTGDALAXELR
1iq6A           --------LHLDPAFAATTAFERPIVHGMLLASLFSLGQQLPGKGSIYLGQSLSFKLPVFVGDEVTAEVE
2c2iA1          ----------------------------LPRLQHQXYTVKGVKLAINYGLNKVRFPAPVPVGSRVRATSS
2oafA1          ---------------------------------------------------EXDFKSPVTPRHILKCHTW
2ov9A1          --VRGTVTLTIPYQGPPGHVHGGVSALLLDHVLGVANAWG--GKAGXTAQLSTRYHRPTPLFEPLTLTGK
2essA2          --------AKYSDIDINGHVNSIRYIEHILD----LFPIELYQTKRIRRF-EXAYVAESYFGDELSFFCD
2oiwA1          -----------------------------------------------IIRXEVDYVNQXYYGQDVTVYTG
1zkiA1          ----------AHLRNRGGVXHGGALFSLXDVTXGLACSSSFDRQSVTLEC-KINYIRAVADGEVR-CVAR
1pn2A2          ----------------------------HGXCTYGLSAKALIDKFGXFNEIKARFTGIVFPGETLRVLAW
1ixlA           ---------------------------------DYAAXLAVNEPTVVLGKAEVRFTKPVKVGDKLVAKAK
2f3xA1          ------EIKQEHVFSRNQIARGHHLFAQANSLAVAVIDD----ELALTASADIRFTRQVKQGERVVAKAK


                         .         .         *         .         .         .         .:140
query           VVRVGRTSLTVEVEVYKERFGEGNGRVLATQGVLTYVAVNEKGEPVPVExxxxxx
1yliA1          CLKVGRSSIKIKVEVWVKKVASEPIRYCVTDAVFTFVAVDNNGRSRTI-------
2gvhA1          PVKAGRRSLTVEVEXVAETIIGRQQH-TCTRGIFHXVAIPEGEDAASYV------
1vpmA           VTHTGRTSXEVYVRVHSNNLLTGERTLTTE-SFLTXVAVDESGKPKPV-------
2gvhA2          VERVGRSSXSIQTKLWSENLLTGERHITAT-GHFTXVAVD---RPATI-------
2cy9A1          ILKQGKTLAFASVDLTNKTTGK-----LIAQGRHTKH------------------
1bvqA           IKEWRRKSFVQRHSVSRTT-PGGDVQLVMR-ADEIRVFAGERLRAIEV-------
2av9A1          VARLGNSSVQYELALFLEGQRE-----ACAAGRFVHVFVERSSRPVAI-------
1sh8A           AGERGKAEYSLELQLTDEQ------GEVVAESAALYQLRSHA-------------
2aliA1          AGRLGTSSLVLEHRLHTL---EDPQGTYGE-GHCKLVWVRAENRSTPV-------
1yocA1          QIDWQATGNVVPVVAY-------VDDKPVFRAEITMYVS----------------
2hboA1          LISEEDXLFTVRGRIWAG------ERTLITTGVFKALS-----------------
2nujA1          VSNFRTTSFTXEFACWRL---GDAVECTSE-GSAVVVLLNDGSGRYPI-------
1o0iA           PINLGRNIQVWQIDIRTE-----ENKLCCV-SRLTLSVIN---------------
2ownA1          GSAYNPYFAYREFWIRD-----ADGQQLAY-ITSIWVXXSTTRRIVKI-------
1z54A1          LAELSSRALLFRYRVE-------REGVLLAEGFTRHLCQV-GERAARI-------
2ownA2          ILPSEVADQVTTSHLIEV-----DDEKCCE-VTIQWRTLPE--------------
1q4sA           RIHAGSTTWFWDVSLRDDA------GRLCAVSSMSIAVRPRR-------------
1z6bA1          LISFKSSLGIAKLSGVGYVNGK-----VVINISEMTFAL----------------
1c8uA1          TLRDGNSFSARRVAAIQN-------GKPIFYMTASFQAPEAG-------------
1tbuA1          NLRNGRNFIHKQVSAYQH-------------------------------------
1s5uA           ITSMRGTSLVFTQRIVNA-----ENTLLNE-AEVLVVCVDLKMKPRAL-------
1j1yA           EVNLSRRTATYRVEVVSE------GKLVAL-FTGTVFRL----------------
1njkA           LQQLNGKSGILSQVITLEPEGQ-----VVADALITFVCIDKTQKALAL-------
2cyeA1          TVGLGRSSLRXEHLVTAN--GE-----SAAKGLGVLVWL-EGGRPAPL-------
2gf6A1          PKILSNKTIKFEFKVLKD-------GELTTEGYVIQIAINKIWKSTE--------
2hx5A1          PERLNPNSFQVHFEFRCE-------EQIAAHALIRHLAINAQ-------------
1iq6A           VTALREDKPIATLTTR----IFTQGGALAVTGEAVVKL-----------------
2c2iA1          LVGVEDLGNGTVQATVSTTVVEGAKPACVAESIVRYV------------------
2oafA1          PTRLGTKSITFRVDGVQD-------GVTCFVGAFTCVFTIDQFKSQPA-------
2ov9A1          LXSVDGRKITTAGDIRTA-----DGQVCVS-VEGLFV------------------
2essA2          EVSENEFHVEVKKN-----------------------------------------
2oiwA1          IERIGNTSLTIYEEIHQN-------GVVCAKGRSVYVNFNDTGRPEPI-------
1zkiA1          VLHAGRRSLVVEAEVRQG-------------------------------------
1pn2A2          KESDDTIVFQTHVVD----------------------------------------
1ixlA           IIEDLGKKKIVEVKVYRE-------------------------------------
2f3xA1          VTAVEKEKGRTVVEVNSY-----VGEEIVFSGRFDMYR-----------------