[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81826.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1gv4A1.bssp"
#ERROR : Can't open dsspfile "1f8gA1.bssp"
#ERROR : Can't open dsspfile "1fl2A1.bssp"
#ERROR : Can't open dsspfile "1mo9A1.bssp"
#ERROR : Can't open dsspfile "1d7yA2.bssp"
#ERROR : Can't open dsspfile "1xhcA2.bssp"
#ERROR : Can't open dsspfile "1w27A.bssp"
#ERROR : Can't open dsspfile "1f8wA2.bssp"
#ERROR : Can't open dsspfile "1f8wA1.bssp"
#ERROR : Can't open dsspfile "1gv4A2.bssp"
#ERROR : Can't open dsspfile "1onfA2.bssp"
#ERROR : Can't open dsspfile "1bhyA2.bssp"
#ERROR : Can't open dsspfile "1vh4A.bssp"
#ERROR : Can't open dsspfile "1mo9A2.bssp"
#ERROR : Can't open dsspfile "1d7yA1.bssp"
#ERROR : Can't open dsspfile "1cjcA2.bssp"
#ERROR : Can't open dsspfile "1f8wA3.bssp"
#ERROR : Can't open dsspfile "1d5tA1.bssp"
#ERROR : Can't open dsspfile "1cl0A1.bssp"
#ERROR : Can't open dsspfile "1gosA1.bssp"
#ERROR : Can't open dsspfile "1aogA3.bssp"
#ERROR : Can't open dsspfile "1aogA2.bssp"
#ERROR : Can't open dsspfile "1fl2A2.bssp"
#ERROR : Can't open dsspfile "1dxlA2.bssp"
#ERROR : Can't open dsspfile "1qzfA1.bssp"
#ERROR : Can't open dsspfile "1w4xA2.bssp"
#ERROR : Can't open dsspfile "1bwcA2.bssp"
#ERROR : Can't open dsspfile "1f0yA2.bssp"
#ERROR : Can't open dsspfile "1t0qC.bssp"
#ERROR : Can't open dsspfile "1vqwA2.bssp"
#ERROR : Can't open dsspfile "1j3lA.bssp"
#ERROR : Can't open dsspfile "1djnA3.bssp"
#ERROR : Can't open dsspfile "1cl0A2.bssp"
#ERROR : Can't open dsspfile "1xhcA1.bssp"
#ERROR : Can't open dsspfile "1cjcA1.bssp"
#ERROR : Can't open dsspfile "1h6vA2.bssp"
#ERROR : Can't open dsspfile "1bhyA3.bssp"
#ERROR : Can't open dsspfile "1w4xA1.bssp"
#ERROR : Can't open dsspfile "1np3A2.bssp"
#ERROR : Can't open dsspfile "1f8rA1.bssp"
#ERROR : Can't open dsspfile "1rp0A1.bssp"
#ERROR : Can't open dsspfile "1fcdA1.bssp"
#ERROR : Can't open dsspfile "1xdiA2.bssp"
#ERROR : Can't open dsspfile "1lsuA.bssp"
#ERROR : Can't open dsspfile "1p9oA.bssp"
#ERROR : Can't open dsspfile "1eyzA2.bssp"
#ERROR : Can't open dsspfile "1aogA1.bssp"
#ERROR : Can't open dsspfile "1gt8A4.bssp"
#ERROR : Can't open dsspfile "1ps9A2.bssp"
#ERROR : Can't open dsspfile "1lnqA3.bssp"
#ERROR : Can't open dsspfile "1chuA2.bssp"
#ERROR : Can't open dsspfile "1bncA2.bssp"
#ERROR : Can't open dsspfile "1ltxR1.bssp"
#ERROR : Can't open dsspfile "1fcdA2.bssp"
#ERROR : Can't open dsspfile "1xdiA1.bssp"
#ERROR : Can't open dsspfile "1b6rA2.bssp"
#ERROR : Can't open dsspfile "2culA1.bssp"
#ERROR : Can't open dsspfile "1el5A1.bssp"
#ERROR : Can't open dsspfile "2hy5B1.bssp"
#ERROR : Can't open dsspfile "1bg6A2.bssp"
#ERROR : Can't open dsspfile "1ps9A3.bssp"
#ERROR : Can't open dsspfile "1hyhA1.bssp"
#ERROR : Can't open dsspfile "2ivdA1.bssp"
#ERROR : Can't open dsspfile "1lssA.bssp"
#ERROR : Can't open dsspfile "1ng3A1.bssp"
#ERROR : Can't open dsspfile "2dw4A2.bssp"
#ERROR : Can't open dsspfile "1e4eA1.bssp"
#ERROR : Can't open dsspfile "1sezA1.bssp"
#ERROR : Can't open dsspfile "2gqfA1.bssp"
#ERROR : Can't open dsspfile "1jw9B.bssp"
#ERROR : Can't open dsspfile "1uaiA.bssp"
#ERROR : Can't open dsspfile "1yrwA2.bssp"
#ERROR : Can't open dsspfile "1e7pA2.bssp"
#ERROR : Can't open dsspfile "1r4mA.bssp"
#ERROR : Can't open dsspfile "1b37A1.bssp"
#ERROR : Can't open dsspfile "1evyA2.bssp"
#ERROR : Can't open dsspfile "1e0dA1.bssp"

## Summary of PDB Search
:443
    2e-30  17%  1gv4A1 [c.3.1.5] PROGRAMED CELL DEATH PROTEIN 8 A:121 -- 264 A:398
    7e-28  13%  1f8gA1 [c.2.1.4] NICOTINAMIDE NUCLEOTIDE TRANSHYDROGENASE A:144 --
    4e-25  21%  1fl2A1 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:212 --
    4e-25  17%  1mo9A1 [c.3.1.5] ORF3 A:2 -- 192 A:314 -- 383
    7e-25  28%  1d7yA2 [c.3.1.5] FERREDOXIN REDUCTASE A:116 -- 236
    6e-24  31%  1xhcA2 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:104 -- 225
    1e-22  14%  1w27A  [a.127.1.2] PHENYLALANINE AMMONIA-LYASE 1
    2e-22  39%  1f8wA2 [c.3.1.5] NADH PEROXIDASE A:120 -- 242
    2e-21  23%  1f8wA1 [c.3.1.5] NADH PEROXIDASE A:1 -- 119 A:243 -- 321
    3e-21  21%  1gv4A2 [c.3.1.5] PROGRAMED CELL DEATH PROTEIN 8 A:265 -- 397
    5e-21  19%  1onfA2 [c.3.1.5] GLUTATHIONE REDUCTASE A:154 -- 270
    8e-21  21%  1bhyA2 [c.3.1.5] P64K A:276 -- 400
    9e-21  12%  1vh4A  [b.80.6.1] SUFD PROTEIN
    2e-20  19%  1mo9A2 [c.3.1.5] ORF3 A:193 -- 313
    3e-20  21%  1d7yA1 [c.3.1.5] FERREDOXIN REDUCTASE A:5 -- 115 A:237 -- 308
    1e-19  13%  1cjcA2 [c.4.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:6 -- 106 A:332
    2e-19  24%  1f8wA3 [d.87.1.1] NADH PEROXIDASE A:322 -- 447
    7e-18  11%  1d5tA1 [c.3.1.3] GUANINE NUCLEOTIDE DISSOCIATION INHIBITOR A:-2 --
    1e-17  16%  1cl0A1 [c.3.1.5] THIOREDOXIN REDUCTASE A:1 -- 118 A:245 -- 317
    2e-17  11%  1gosA1 [c.3.1.2] MONOAMINE OXIDASE A:4 -- 289 A:402 -- 500
    2e-17  13%  1aogA3 [d.87.1.1] TRYPANOTHIONE REDUCTASE A:358 -- 487
    3e-17  21%  1aogA2 [c.3.1.5] TRYPANOTHIONE REDUCTASE A:170 -- 286
    5e-17  17%  1fl2A2 [c.3.1.5] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F A:326 --
    5e-17  29%  1dxlA2 [c.3.1.5] DIHYDROLIPOAMIDE DEHYDROGENASE A:153 -- 275
    8e-17  12%  1qzfA1 [c.71.1.1] BIFUNCTIONAL DIHYDROFOLATE REDUCTASE-THYMIDYLATE
    1e-16  14%  1w4xA2 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:155 -- 389
    2e-15  28%  1bwcA2 [c.3.1.5] PROTEIN (GLUTATHIONE REDUCTASE) A:166 -- 290
    3e-15  12%  1f0yA2 [c.2.1.6] L-3-HYDROXYACYL-COA DEHYDROGENASE A:12 -- 203
    7e-15  12%  1t0qC  [d.15.12.1] TOUB
    8e-15   5%  1vqwA2 [c.3.1.5] PROTEIN WITH SIMILARITY TO FLAVIN-CONTAINING A:181
    1e-14  18%  1j3lA  [c.8.7.1] DEMETHYLMENAQUINONE METHYLTRANSFERASE
    2e-14  23%  1djnA3 [c.4.1.1] TRIMETHYLAMINE DEHYDROGENASE A:341 -- 489 A:646 --
    5e-14  16%  1cl0A2 [c.3.1.5] THIOREDOXIN REDUCTASE A:119 -- 244
    3e-13  21%  1xhcA1 [c.3.1.5] NADH OXIDASE /NITRITE REDUCTASE A:1 -- 103 A:226
    8e-13  16%  1cjcA1 [c.3.1.1] PROTEIN (ADRENODOXIN REDUCTASE) A:107 -- 331
    2e-12  24%  1h6vA2 [c.3.1.5] THIOREDOXIN REDUCTASE A:171 -- 292
    5e-12  17%  1bhyA3 [d.87.1.1] P64K A:471 -- 598
    5e-12  14%  1w4xA1 [c.3.1.5] PHENYLACETONE MONOOXYGENASE A:10 -- 154 A:390 --
    9e-12  12%  1np3A2 [c.2.1.6] KETOL-ACID REDUCTOISOMERASE A:1 -- 182
    1e-11  26%  1f8rA1 [c.3.1.2] L-AMINO ACID OXIDASE A:4 -- 319 A:433 -- 486
    2e-11  10%  1rp0A1 [c.3.1.6] THIAZOLE BIOSYNTHETIC ENZYME A:7 -- 284
    4e-11  19%  1fcdA1 [c.3.1.5] FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-
    1e-10  22%  1xdiA2 [d.87.1.1] RV3303C-LPDA A:349 -- 466
    3e-10   9%  1lsuA  [c.2.1.9] CONSERVED HYPOTHETICAL PROTEIN YUAA
    4e-10  20%  1p9oA  [c.72.3.1] PHOSPHOPANTOTHENOYLCYSTEINE SYNTHETASE
    1e-09  15%  1eyzA2 [c.30.1.1] PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2 A:2
    3e-09  22%  1aogA1 [c.3.1.5] TRYPANOTHIONE REDUCTASE A:3 -- 169 A:287 -- 357
    3e-09  20%  1gt8A4 [c.4.1.1] DIHYDROPYRIMIDINE DEHYDROGENASE A:184 -- 287 A:441
    6e-09  25%  1ps9A2 [c.3.1.1] 2,4-DIENOYL-COA REDUCTASE A:466 -- 627
    7e-09  10%  1lnqA3 [c.2.1.9] POTASSIUM CHANNEL RELATED PROTEIN A:116 -- 244
    4e-08  23%  1chuA2 [c.3.1.4] PROTEIN (L-ASPARTATE OXIDASE) A:2 -- 237 A:354 --
    6e-08  13%  1bncA2 [c.30.1.1] BIOTIN CARBOXYLASE A:1 -- 114
    2e-07   7%  1ltxR1 [c.3.1.3] RAB ESCORT PROTEIN 1 R:2 -- 444 R:558 -- 614
    3e-07  20%  1fcdA2 [c.3.1.5] FLAVOCYTOCHROME C SULFIDE DEHYDROGENASE (FLAVIN-
    2e-06  38%  1xdiA1 [c.3.1.5] RV3303C-LPDA A:2 -- 161 A:276 -- 348
    4e-06  16%  1b6rA2 [c.30.1.1] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE RIBONUCLEOTIDE
    6e-06  22%  2culA1 [c.3.1.7] GLUCOSE-INHIBITED DIVISION PROTEIN A-RELATED A:2
    9e-06  25%  1el5A1 [c.3.1.2] SARCOSINE OXIDASE A:1 -- 217 A:322 -- 385
    1e-05  12%  2hy5B1 [c.114.1.1] INTRACELLULAR SULFUR OXIDATION PROTEIN DSRF
    1e-05  15%  1bg6A2 [c.2.1.6] N-(1-D-CARBOXYLETHYL)-L-NORVALINE DEHYDROGENASE
    1e-05  28%  1ps9A3 [c.4.1.1] 2,4-DIENOYL-COA REDUCTASE A:331 -- 465 A:628 --
    2e-05  20%  1hyhA1 [c.2.1.5] L-2-HYDROXYISOCAPROATE DEHYDROGENASE A:21 -- 166
    3e-05  41%  2ivdA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE A:10 -- 306 A:415 --
    3e-05  12%  1lssA  [c.2.1.9] TRK SYSTEM POTASSIUM UPTAKE PROTEIN TRKA HOMOLOG
    3e-05  19%  1ng3A1 [c.3.1.2] GLYCINE OXIDASE A:1 -- 218 A:307 -- 364
    4e-05  47%  2dw4A2 [c.3.1.2] LYSINE-SPECIFIC HISTONE DEMETHYLASE 1 A:274 -- 654
    4e-05  13%  1e4eA1 [c.30.1.2] VANCOMYCIN/TEICOPLANIN A-TYPE RESISTANCE PROTEIN
    8e-05  46%  1sezA1 [c.3.1.2] PROTOPORPHYRINOGEN OXIDASE, MITOCHONDRIAL A:13 --
    1e-04  32%  2gqfA1 [c.3.1.8] HYPOTHETICAL PROTEIN HI0933 A:1 -- 194 A:343 --
    1e-04  18%  1jw9B  [c.111.1.1] MOLYBDOPTERIN BIOSYNTHESIS MOEB PROTEIN
    2e-04  11%  1uaiA  [b.29.1.18] POLYGULURONATE LYASE
    3e-04  11%  1yrwA2 [c.65.1.1] PROTEIN ARNA A:1 -- 203
    4e-04  24%  1e7pA2 [c.3.1.4] FUMARATE REDUCTASE FLAVOPROTEIN SUBUNIT A:1 -- 250
    5e-04  12%  1r4mA  [c.111.1.2] AMYLOID BETA PRECURSOR PROTEIN-BINDING PROTEIN 1
    5e-04  35%  1b37A1 [c.3.1.2] PROTEIN (POLYAMINE OXIDASE) A:5 -- 293 A:406 --
    5e-04  20%  1evyA2 [c.2.1.6] GLYCEROL-3-PHOSPHATE DEHYDROGENASE A:9 -- 197
    6e-04  22%  1e0dA1 [c.5.1.1] UDP-N-ACETYLMURAMOYLALANINE--D-GLUTAMATE LIGASE
:443

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxVVVYEKSGWVSYGACGLPYVLSGEIPRLERLVARTPEEFRK
1gv4A1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1vh4A           --------------------------------QLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNS
1mo9A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1f8wA3          ----------------------------------------------------------------------
1d5tA1          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1gosA1          -----------------------------VVVLEARGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKE
1aogA3          ----------------------------------------------------------------------
1aogA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1t0qC           ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1bhyA3          ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1rp0A1          -----------------------------------------------------------------DLIVK
1fcdA1          ----------------------------------------------------------------------
1xdiA2          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1aogA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1chuA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1ltxR1          ----------------------------------------------------------------------
1fcdA2          ----------------------------------------------------------------------
1xdiA1          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1lssA           ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1uaiA           ----------------------------------------------------------TMVFREAFNHLP
1yrwA2          ----------------------------------------------------------------------
1e7pA2          ----------------------------------------------------------------------
1r4mA           ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           QGVLVHTRHEVVDVDYELRTLTVHDHAEGRTFQDRFDHLVLATGARPSLPPIPGTEQEGVYTLRTMEDGE
1gv4A1          -------------------TVPQ----IRAPS--HVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDP
1f8gA1          -------------------------------------------GYRAVIDGAYE--------FARAFPXX
1fl2A1          ----------------------------------------------------------------------
1mo9A1          ---------------------ARNDHLTINQWATRIDEILEAPDGGEVIYNVDENDPREYDAIGRFGSAY
1d7yA2          ------------------------------------------------LPTLQGAT-MPVHTLRTLEDAR
1xhcA2          ---------------------------------------------RAREPQIKGKE--YLLTLRTIFDAD
1w27A           ---------------------------------------------------------------SHLDEVK
1f8wA2          ---------------------------------------------------IPGKDLDNIYLMRGRQWAI
1f8wA1          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------LSAIDRAGAEVKSRTLFRKIGDFR
1onfA2          ------------------------------------------------FPPVKGIEN--TISSDEFFN--
1bhyA2          -------------------------------------------------TKLPFPEDPRIIDSSGALA--
1vh4A           RQLHKTIVSDKGRAVFN-GLINVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKC-----SHG
1mo9A2          -----------------------------------------------------GVNAKGVFDHATLVEEL
1d7yA1          ----------------------------------------------------------------------
1cjcA2          ----------------------------------------------------------------------
1f8wA3          ----------------------------------------------------------------------
1d5tA1          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1gosA1          LGLETYKVNEVERLIHHVKGKSDHNNFWRTMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESA
1aogA3          ----------------------------------------------------------------------
1aogA2          ---------------------------------------------------------PGIEHCISSNEAF
1fl2A2          -------------------------------------------------MNVPGEDQYRTKGVTYCPHCD
1dxlA2          ---------------------------------------------------LPGVTIDEKKIVSS--TGA
1qzfA1          ----------------------------NKCDSNKKNALIMGRKTWDSIGRRPLKNRINVVVFRNLEDSI
1w4xA2          ----------------------------------------------PQLPNFPGLKDFAGNLYHTGNWPH
1bwcA2          ---------------------------------------------------------PGASLGITSDGFF
1f0yA2          ----------------------------------------------------------------------
1t0qC           ----------------------------------------------------------------------
1vqwA2          ------------------------------------------------IPNIKGLDEYAKAVPGSVLHSS
1j3lA           ---------------------------------DLYPEGEALPX---VFKSFGGRARFAVRTLRVFEDNA
1djnA3          ----------------------------------------------------------------------
1cl0A2          --------------------------------------------------GLPSEEAFKGRGVSACATCD
1xhcA1          ----------------------------------------------------------------------
1cjcA1          -------------------------------------------------LDIPGEELPGVFSARAFVGWY
1h6vA2          ----------------------------------------------------------------------
1bhyA3          ----------------------------------------------------------------------
1w4xA1          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1f8rA1          -------------------------------------------------NPLAECFQENDYE-EFLEIAR
1rp0A1          GNRVGGVVTNWALVAQNHHTQS---CMDPNVMEAKI--VVSSCGHDGPFGATGVKRLKSIGMIDHVPGMK
1fcdA1          ----------------------------------------------------------------------
1xdiA2          ----------------------------------------------------------------------
1lsuA           ----------------------------------------------------------------------
1p9oA           --------------------------------------------VMARFAARLGAQ-GRRVVLVTS-GGT
1eyzA2          ----------------------------------------------------------------------
1aogA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------PRTPPIDGIDHPKVLSY-----LD
1lnqA3          ----------------------------------------------------------------------
1chuA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1ltxR1          ----------------------DLLIKSNVSRYAEFKNITRILAFREGTVEQVPCSRADVFNLTMVEKRM
1fcdA2          --------------------------------------------------------------LEDMADGG
1xdiA1          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1ps9A3          ---------------------------------------------------------------RACHETK
1hyhA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1lssA           ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1jw9B           --------------------------------------------------------------------DF
1uaiA           EVKPHLVGAQIHDGDDDLEGTSLYITKGDDTHHKLVTSDYKLNTV-------------------------
1yrwA2          ----------------------------------------------------------------------
1e7pA2          ----------------------------------------------------------------------
1r4mA           --------------------------------------------------------------------GD
1b37A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RLLKALPQARRAAILGAGYIGLEAAEAFRKRGLQVTLLEAKDRPLPHWDPEVGALLKEELERHGVEVWTG
1gv4A1          ELPY------MRPPLSKELWFSDDPNVTKTLQFRQWNGKERSIYFQPPSFYVSAQDLPNIENGGVAVLTG
1f8gA1          XTAAGTVPPARVLVFGVGVAGLQAIATAKRLGAVVXATDVRAATKEQVESLGGKFITVDDEATAETAGGY
1fl2A1          -----------AAAIYSARKGIRTGLMGERFGGQTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDS
1mo9A1          LRAMG---GRQLIVDRWPFLGGSCPHNACVPHHLFSDCAAELMLARGRNGPHGIMNFQSKEQLNLEYILN
1d7yA2          RIQAGLRPQSRLLIVGGGVIGLELAATARTAGVHVSLVETQPRLMSAAPATLADFVARYHAAQGVDLRFE
1xhcA2          RIKESIENSGEAIIIGGGFIGLELAGNLAEAGYHVKLIHRGAM-FLGLDEELSNMIKDMLEETGVKFFLN
1w27A           KMVAEYR--KPVVKLGGETLTISQVAAISARDGSGVTVELSEAARAGVKASSDWVMNKGTDSYGVTTGFG
1f8wA2          KLKQKTVDVNNVVVIGSGYIGIEAAEAFAKAGKKVTVIDILDRPLVYLDKEFTDVLTEEMEANNITIATG
1f8wA1          ----------KVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSXGMQLYLEGMESRGVNVFSN
1gv4A2          ALEKISREVKSITVIGGGFLGSELACKSQASGIEVIQLFPEKGNMGILPQYLSNWTMEKVKREGVKVMPN
1onfA2          -----IKESKKIGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRKFDESVINVLENDMKKNNINIVTF
1bhyA2          --LKEVPG--KLLIIGGGIIGLEMGTVYSTLGSRLDVVEMMDGLMQGADRDLVKVWQKQNEYRFDNIMVN
1vh4A           ATVGRIDD-EQIFYLRSRGINQQDAQQMIIYAFAAELTEA--LRDEGLKQQVLARIGQRLPG--------
1mo9A2          DYEPG----STVVVVGGSKTAVEYGCFFNATGRRTVMLVRTEPLKLIKDNETRAYVLDRMKEQGMEIISG
1d7yA1          ---------APVVVLGAGLASVSFVAELRQAGYQGLITVVGDEAERPYDRPPLSKDFMAHDAEKIRLDCK
1cjcA2          ----------QICVVGSGPAGFYTAQHLLKHHSRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQ
1f8wA3          ----------------------------------------------------------------------
1d5tA1          -------------------------------------------------------FARLSAIYGGTYMLN
1cl0A1          ---------SKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLME
1gosA1          KQLATLFVNLCVTAETHEVSALWFLWYVKQCGGTTRIISTTNGGERKFVGGSGQVSERIMDLLGDRVKLE
1aogA3          ----------------------------------------------------------------------
1aogA2          YLPE---PPRRVLTVGGGFISVEFAGIFNAYKPKDGQVTLCYRGLRGFDHTLREELTKQLTANGIQILTK
1fl2A2          GPLFK---GKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIILNAQTTE
1dxlA2          LALSEIPK--KLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPTMDAEIRKQFQRSLEKQGMKFKLK
1qzfA1          ENLMNDDSIENIFVCGGESIYRDALKDNFVDRIYLTRVALFDTYFPEIPEFLPVYMSQTFCTKNISYDFM
1w4xA2          EPVD--FSGQRVGVIGTGSSGIQVSPQIAKQAAELFVFQRTPHFVPARNAPLDPEFLADLKKRYAEFREE
1bwcA2          QLEE---LPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKF
1f0yA2          ---------KHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKA
1t0qC           --------------------------------MSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVH
1vqwA2          LFREPELFVESVLVVGGASSANDLVRHLTPVAKHPIYQSLLGGGDIQNESLQQVPEITKFDPREIYLKGG
1j3lA           LVLEEEGAGQVLFVDGGGLLGGNLARRAWEKGWAGVVVHGAVRDTEELEVPIGLLALAATPKKSAKEGKG
1djnA3          ---------DSVLIVGAGPSGSEAARVLMESGYTVHLTDTAEKIGGHLNQVAALPGLGEWSYHQITKLLK
1cl0A2          GFFY---RNQKVAVIGGGNTAVEEALYLSNIASEVHLIH--RRDGFRAEKILIKRLMDKVENGNIILHTN
1xhcA1          ----------KVVIVGNGPGGFELAKQLSQTY-EVTVIDKEPVPYYSKPMLSHYIAGFIPRNRLFPYSLD
1cjcA1          NGLPENLSCDTAVILGQGNVALDVARILLTPPDHLEKTDITEAALGALRQSRVKTVWIVGRRGPLQVAFT
1h6vA2          ---------GKTLVVGASYVALECAGFLAGIGLDVTVMVRSIL-LRGFDQDMANKIGEHMEEHGIKFIRQ
1bhyA3          ----------------------------------------------------------------------
1w4xA1          -------------YLGLSTAGFPNLFFIAGPGSPSALSNMLVSIEQHVEWVTD--HIAYMFKNGLTRSEA
1np3A2          ---------KKVAIIGYGSQGHAHACNLKDSGVDVTVGLRSGSATVAKAEAHGLKVADAAADVVMILTPD
1f8rA1          NGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGPMRLPEKHRIVREYIRKFDLRLFSQ
1rp0A1          ALDMNT------AEDAIVRLTREVVPGMIVTGMEVAEIDGAPRMGPTFGAMM------------------
1fcdA1          ---------RKVVVVGGGTGGATAAKYIKDPSIEVTLIEPNTDYYTCYKLESIKHGYDGLRAHGIQVVHD
1xdiA2          ----------------------------------------------------------------------
1lsuA           ---------KQFAVIGLGRFGGSIVKELHRMGHEVLAVDINEEKVNAYASYATHAVIANATEENELLSLG
1p9oA           KVPLEARPVRFLDNFSSGRRGATSAEAFLAAGYGVLFLYRARSAFPYAHRFP------------------
1eyzA2          ------PAATRVMLLGSGELGKEVAIECQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVEL
1aogA1          --------PKKLMVTGAQYM--EHLRESAGFGWEFNLIAVKDE---AVLNINKSYDEMFRDTEGLEFFLG
1gt8A4          ----------KIALLGAGPASISCASFLARLGYSITIFEKQEYVGGLSTSEIQFRLPYDVVNFEIELDLG
1ps9A2          VLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGDSSLQQKASKPGQIHRTTLLSRGVKMIPG
1lnqA3          ---------RHVVICGWSESTLECLRELRGSEVFVLAEDENVRKKVLRSGANFVHGDPTRVSDLEKANVR
1chuA2          --------VEDTLIAGAGICDRHAVEFVASNARSVQWLIDQGVLTTLVSKALNHPNIRVLERTNAVDLIV
1bncA2          ---------DKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLADETVCIGPAPSVKSYLNI
1ltxR1          LMKFLTFCVEYEEHPYRAYEGTTFSEYLKTQKLTPNLQYFVLHSIAMTSTSCTVDGLKATKKFLQCLGRY
1fcdA2          TVVIAPPAAPFRCPPGPYERASQVAYYLKAHKPIILDSSQTFSKQSQFSKGWERLYGFGTENAMIEWHPG
1xdiA1          ----------------------------------------------------------------------
1b6rA2          ---------KQVCVLGNGQLGRMLRQAGEPLGIAVWPVGLDAEPAAVPFQQSVITAEIERWPETALTRQL
2culA1          -----------VLIVGAGFSGAETAFWLAQKGVRVGLLTQSLDADERVWAFHARAKYLLEGLRPLHLFQA
1el5A1          ----------------------------------------------VLFSENCIRYRELAEARGAKVLTH
2hy5B1          ---------KKFMYLNRKWEALEVVLIGAAFDQDVCVLFLDDGVYQLTMKNFSPTYRTLGDYEVRRIYVD
1bg6A2          --------SKTYAVLGLGNGGHAFAAYLALKGQSVLAWDIDAQRIKEIQDRGAAEGPGLAGTAHPDLLTS
1ps9A3          MPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEPGKEEFYETLRYYRRMIEVTGVTLKLN
1hyhA1          --------ARKIGIIGLGNVGAAVAHGLIAQGVADDYVFIDANEAKVK----------------------
2ivdA1          ------------AVVGGGISGLAVAHHLRSRGTDAVLLESSARL--------------------------
1lssA           ----------YIIIAGIGRVGYTLAKSLSEKGHDIVLIDIDKDICKKASAEIDALVINGDCTKIKTLEDA
1ng3A1          ------------------------------------------------PYFVCKAYVKAAKMLGAEIFEH
2dw4A2          ----------KVIIIGSGVSGLAAARQLQSFGMDVTLLEARDRV--------------------------
1e4eA1          ---------IKVAILFGGCSAIEIAANINKEKYEPLYIGITKSGVWKMCEKPCAEWENENCYSAVLSPDK
1sezA1          --------AKRVAVIGAGVSGLAAAYKLKIHGLN------------------------------------
2gqfA1          -------QYSENIIIGAGAAGLFCAAQLAKLGKSVTVFDNGKKI--------------------------
1jw9B           DGQEALKDSR-VLIVGLGGLGCAASQYLASAGVGNLTLLDFDTVSLSNLQRQTLHSDATVGQPKVESAPH
1uaiA           ----------------------------------------------------------------------
1yrwA2          ----------KTVVFAYHDMGCLGIEALLAAGYEISAIFTHTDFYGSV----------------------
1e7pA2          ---------------------------------------------------YGAVVRDLVTGDIIAYVAK
1r4mA           HGQEALESAH-VCLINATATGTEILKNLVLPGIGSFTGEDAGNNFFLQRSSIGKNRAEAAMEFLQELNSD
1b37A1          ----------RVIVVGAGMSGISAAKRLSEAGIDLLILEATDHI--------------------------
1evyA2          ---------NKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEE--------------------------
1e0dA1          ---------KNVVIIGLGLTGLSCVDFFLARGVTPRVMDTRMTP-------------------------P


                         .         .         .         +         .         .         .:280
query           VKVEAFRGMGRVEAVETSEGVVPADLVLLATGIRPNTELAQAMGVALGPTGAIATDERMRTNLEGVYAAG
1gv4A1          KKVVHLDVRGNM-VKLNDGSQITFEKCLIATGGTPRGLEAKTGGLEIDSDFGGFRVNAELQARSNIWVAG
1f8gA1          AKEXGEEFRK-KQAEAVLKELVKTDIAITTALIPGKPAPVLITEEXV-----TKXKPGSVIIDLAVEAGG
1fl2A1          QSASKLIEGGLHQIETASGAVLKARSIIVATGAKLPNTNWLEGAVERNRMGEIIIDAKCETNVKGVFAAG
1mo9A1          CPAKVIDNHT----VEAAGKVFKAKNLILAVGAGPGTLDVPEQPRDLGPKGEVLVNEYLQTSVPNVYAVG
1d7yA2          RSVTGSVD---GVVLLDDGTRIAADMVVVGIG--------------------------------------
1xhcA2          SELLEANE----EGVLTNSGFIEGKVKICAIGI-------------------------------------
1w27A           ATSHRRTKQGGALQKEGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAIT-KFLNQNITPCLPLRG
1f8wA2          ETVERYEGDGRVQKVVTDKNAYDADLVVVA----------------------------------------
1f8wA1          TEITAIQPKEHQVTVKDLERVENYDKLIISPGAVPFELDGVRPNTAWLKNGLIKTDEYMRTSEPDVFAVG
1gv4A2          AIVQSVGVSGGRLLIKLKDGKVETDHIVTA----------------------------------------
1onfA2          ADVVEIKKSDKNLSIHLSDGYEHFDHVIYC----------------------------------------
1bhyA2          TKTVAVEPKETFEGANAPKEPQRYDAVLVAAG--------------------------------------
1vh4A           ----------------------------------------------------------------------
1mo9A2          SNVTRIEEDAAVVAMTPNGERIETDFVFLGLG--------------------------------------
1d7yA1          RAPEVEWLLGVTAQSLSDGRTLPYGTLVLATGAAPRAVLANARAAGLACDDGIFVDAYGRTTCPDVYALG
1cjcA2          TARSDFYGNVEVGRDVTVQEQDAYHAVVLSYGAEDKSRPIDPSVPFDPKLGVVPNMEGRVVDVPGLYCSG
1f8wA3          ----------------------------------------------------------------------
1d5tA1          KPVDDIIMEGKVVGVKSEGEVARCKQLICDPSYVPDRVPIDDGSES---QVFCSCSYDATTHFEDIYKRM
1cl0A1          RMHENKVDLQNRPFRLNGDNEYTCDALIIATGASARYHSPNTLENGYIKVQSGIHGNATQTSIPGVFAAG
1gosA1          RPVIYIDQTRENVLVETLNHMYEAKYVISAIPPTLGMKIHQMITRVFPPGILTQYGRVLRQPVDRIYFAG
1aogA3          ----------------------------------------------------------------------
1aogA2          ENPAKVELNAGSKSVTFESGKMDFDLVMMA----------------------------------------
1fl2A2          VKDGSKVVGLEYRDRVSGDINIELAGIFVQIGL-------------------------------------
1dxlA2          TKVVGVDTSGTVEPSAGGEQIIEADVVLVS----------------------------------------
1qzfA1          IFE-------------------------------------------------------------------
1w4xA2          SRNTPYQGPKSALEVSDEELVETLERYWQEGGPDILAAYR---DILRDRDANERVAEFIRNKIRNTVRDP
1bwcA2          SQVKEVKKTLAVPGRLPVMTIPDVDCLLWAIG--------------------------------------
1f0yA2          GDEFVEKTLSTIATSTDAASVHSTDLVVEAIVENLKVKNELF--KRLDKFAAEHTIFASNTSSLQITSIA
1t0qC           PQPEKI----LRVRRHEDGTLFPRGMIVSDAGLRPTETLD------------------------------
1vqwA2          KVLSNI----------------------------------------------------------------
1j3lA           EVDVPLKVLGVE--------VLPGSFLL------------------------------------------
1djnA3          KNKESQLALGQKPMTADDVLQYGADKVIIATGASECT---------LWNELKARESEWAENDIKGIYLIG
1cl0A2          RTLEEVTGDMGVTGVRDNIESLDVAGLFVAIG--------------------------------------
1xhcA1          WYRKRGIEIRLAEEAKLEKGEVPYDTLVLATGAPNVDLARRSG---IHTGRGILIDDNFRTSAKDVYAIG
1cjcA1          IKELREMGLQDRIKEAARPRKRLMELLLRTATEKPGVEEAARRASA---SRAWGLRFFRSPQQVLPSPDG
1h6vA2          FVPTKIEQIETAKSTNSEETEDEFNTVLLAVG--------------------------------------
1bhyA3          ----------------------------------------------------------------------
1w4xA1          VLEKEDEWVEHVNEIAGANVPGKPRVFMLYVGGFHRYRQICDEVAAKGYEGFVLT---------------
1np3A2          EFQGRLYKEEIEPNLKKGATLAAHGFSIHYNQVVPRADLDVIMIAPKAPGHTVRSEFVKGGGIPDLIAIY
1f8rA1          ENDNAW---YFIKNIRKKVGEVKKDPGLLKYPVKP-SEAGKSAGQLYEESLGKVVEELKRTNCSYIYDTY
1rp0A1          ----------------------------------------------------------------------
1fcdA1          SATGIDPDKKLV--KTAGGAEFGYDRCVVAPGIELIYDKIEQRAGKIAQIAPVDIKTFESSIHKGIHVIG
1xdiA2          ----------------------------------------------------------------------
1lsuA           VIVAIGANIQASTLTTLLLKELDIPNIWVKAQNYYHHKVLEKIGA-------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          EKPHYIVPEIEAIATDMLIQLEEEGLNVVPCARATKLTM-------------------------------
1aogA1          WGSLESKNVVNVRESADPASAVKTEHILLASGSWPHMDLQLQNAGVMIKNGGVQVDEYSRTNVSNIYAIG
1gt8A4          VKIICGKSLSENEITLNTLKEEGYKAAFIGIGLDPKVKEALSPIKFNRWDLPEVDPETMQTSEPWVFAGG
1ps9A2          VSYQKIDDDGLHVVINGETQVLAVDNVVICAG--------------------------------------
1lnqA3          GARAVIVSDSETIHCILGIRKIDESVRIIAEAERYENEQLRMAGADQVISPFVISGRLMSRSID------
1chuA2          SDKIGLPGTRRVVGAWVTVETCHAKAVVLATGGASKVYQAWRAGCRVANCGGVMVDDHGRTDVEGLYAIG
1bncA2          PAISAAEITGAVAIHPGYGFLSENANFAEFIFIGPKAETIRLMG--------------------------
1ltxR1          GNTPFLFPLYGQGELPQCFCRMCAKHFIIEDSYLSENTCSRVSRDCYNDLSNVYVCSGPDSGLGNDNAVK
1fcdA2          PDSAVVKVDGGEMMVETAFGEFKADVINL-----------------------------------------
1xdiA1          --------------------------------------------------------RVSRTLATGIYAAG
1b6rA2          ARHPAFVNR-------------------------------------------------------------
2culA1          TATGLLLEGNRVVGVRTWEGPARGEKVVLAVGSFLG----------------------------------
1el5A1          TRVEDFDISPDSVKIETANGSYTADKLIVSMGAW-NSKLLSKLNL-------------------------
2hy5B1          RDSLEARGLTQ------------DDLVEIAFEDMETEEE-----FDNI------------VEVIDSARVS
1bg6A2          DIGLAVKDADVILAANIASYISEGQLIILNPGATGGALEFRKILRENG----------------------
1ps9A3          HTV-------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1lssA           GIEDADMYIAVTGKSSLLAKSYGINKTIARISEIEYKDVFERLGVSPELIAANYIEKLIE----------
1ng3A1          TPVLHVERDGEALFIKTPSGDVWANHVVVASGV-WSGMFFKQLGLNN-----------------------
2dw4A2          ----------------------------------------------------------------------
1e4eA1          KMHGLLVKKNHEYEINHVDVAFSA----------------------------------------------
1sezA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1jw9B           IAITPVNAL--LDDAELAALIAEHDLVLDCTDNVAVRNQLNAGCFAAK----------------------
1uaiA           ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1e7pA2          GTLIATGGYGRIYKNTTNAVVCEGT---------GTAIALETGIAQLGNMGGIRTDYRGEAKLKGLFSAG
1r4mA           VSGSFVEESPENLLDNDPSFFCRFTVVVATQLPESTSLRLADVLWN------------------------
1b37A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1e0dA1          GLDKLPEAVERHTGSLNDEWLMAADLIVASPGIALAHPSLSA----------------------------


                         .         *         .         .         .         .         +:350
query           DVAESFHRVLKRPYWLPLGDVANKHGRTAGSVIAGREARFLGVVGTAIFKAFDLAVATTGLSLEGALKEG
1gv4A1          DAACFYDIKLGRRR-VEHHDHAVVSGRLAGENMTGAAKPY------------------------------
1f8gA1          NCPLSEPGKIVVKHGVKIVGHTNVPSR-------------------------------------------
1fl2A1          DCTTVPY---------KQIIIATGEGAKASLSAFDYLIRT------------------------------
1mo9A1          DLIG----------GPMEMFKARKSGCYAARNVMGEKISY------------------------------
1d7yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1w27A           TITXDLVLLTGRPNSKAVGPTGVILSPEEAFKLAGVEGGFFELQPKEGLALVNGTAVGSGMA--------
1f8wA2          ----------------------------------------------------------------------
1f8wA1          DATLIKYNPADTEVNIALATNAMKQGRFAVKNLEEPVKPF------------------------------
1gv4A2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1vh4A           ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1d7yA1          DVTRQRNPLSGRFERIETWSNAQNQGIAVA----------------------------------------
1cjcA2          W------------------VKRGPTGVITTTMTDSFLTGQILLQDLKAGHLPSGPRPGSAFIKALLDSRG
1f8wA3          -----------------------------------------GVQGSSGLAVFDYKFASTGINEVMAQKLG
1d5tA1          AGSA--FD--------------------------------------------------------------
1cl0A1          DVM-------DHIY--RQAITSAGTGCMAALDAERYLD--------------------------------
1gosA1          T-------ETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLERHLPS
1aogA3          ------------------------------------------RVASAVF--SIPPIGTCGLIEEVASKRY
1aogA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1w4xA2          EVAERLV-----PKGYPFGTKRLILEIDYYEMFNRDNVHLVDTLSAPIETITPRGVRTSEREYE------
1bwcA2          ----------------------------------------------------------------------
1f0yA2          NATTRQDRFAGLHF--FNPVPVMKLVEVIKTPMTSQKT---FESLVDFSKALGKHPVSCKDT--------
1t0qC           ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1djnA3          DAE-------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1xhcA1          DCAE------YSGIIAGTAKAAMEQARVLADILKG-----------------------------------
1cjcA1          RRAAGIRLA----------VTRLEGIGEATRAVPTGDVE-------------------------------
1h6vA2          ----------------------------------------------------------------------
1bhyA3          ------------------------------------------VIPGVAY--TSPEVAWVGETELSAKASA
1w4xA1          ----------------------------------------------------------------------
1np3A2          QDAS---------GNAKNVALSYACGVGGG----------------------------------------
1f8rA1          STKEYLEGDLSPGAVDMIGDLLNEDSGYYVSFIES-----------------------------------
1rp0A1          ----------------------------------------------------------------------
1fcdA1          DASIANPMP-------KSGYSANSQGKVAAAALKGEE---------------------------------
1xdiA2          ----------------------------------------LRTVAATVF--TRPEIAAVGVPQSVIDAGS
1lsuA           ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1aogA1          DVTN----------RVMLTPVAINEAAALVDTVFGTTPR-------------------------------
1gt8A4          DIV-------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1chuA2          EVSYTGLHGANRMASNSLLE-CLVYGWSAAEDITRR----------------------------------
1bncA2          ----------------------------------------------------------------------
1ltxR1          QAETLFQQICPNEDFP------------------------------------------------------
1fcdA2          ----------------------------------------------------------------------
1xdiA1          DCTG----------LLPLASVAAMQGRIAMYHALGEGVSPI-----------------------------
1b6rA2          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
2hy5B1          ELMNESDAVF------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1lssA           ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1uaiA           ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1e7pA2          EAA-------------------------------------------------------------------
1r4mA           ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           FWAKKVFIQSRDGAHYYPGSGPLWVELVYEEGTGRLLGGAVVARGHGALRIDVLAALLHREGSVEXXXXX
1gv4A1          ----------------------------------------------------------------------
1f8gA1          ----------------------------------------------------------------------
1fl2A1          ----------------------------------------------------------------------
1mo9A1          ----------------------------------------------------------------------
1d7yA2          ----------------------------------------------------------------------
1xhcA2          ----------------------------------------------------------------------
1w27A           ----------------------------------------------------------------------
1f8wA2          ----------------------------------------------------------------------
1f8wA1          ----------------------------------------------------------------------
1gv4A2          ----------------------------------------------------------------------
1onfA2          ----------------------------------------------------------------------
1bhyA2          ----------------------------------------------------------------------
1vh4A           ----------------------------------------------------------------------
1mo9A2          ----------------------------------------------------------------------
1d7yA1          ----------------------------------------------------------------------
1cjcA2          VSFSDWEKLDAEEVSRGQASGKPREKLLDPQEMLRLLG--------------------------------
1f8wA3          KETKAVTVVEDYLMDFNPDKQKAWFKLVYDPETTQILGAQLMSKADLTANINAISLAIQAKMTIEDLAYA
1d5tA1          ----------------------------------------------------------------------
1cl0A1          ----------------------------------------------------------------------
1gosA1          ----------------------------------------------------------------------
1aogA3          VAVYLSSFTPLMHKVSGSKYKTFVAKIITNHSDGTVLGVHLLGDNAPEI-IQGIGICLKLNAKISDFYNT
1aogA2          ----------------------------------------------------------------------
1fl2A2          ----------------------------------------------------------------------
1dxlA2          ----------------------------------------------------------------------
1qzfA1          ----------------------------------------------------------------------
1w4xA2          ----------------------------------------------------------------------
1bwcA2          ----------------------------------------------------------------------
1f0yA2          ----------------------------------------------------------------------
1t0qC           ----------------------------------------------------------------------
1vqwA2          ----------------------------------------------------------------------
1j3lA           ----------------------------------------------------------------------
1djnA3          ----------------------------------------------------------------------
1cl0A2          ----------------------------------------------------------------------
1xhcA1          ----------------------------------------------------------------------
1cjcA1          ----------------------------------------------------------------------
1h6vA2          ----------------------------------------------------------------------
1bhyA3          RKITKANFPWAAGRAIANGCDKPFTKLIFDAETGRIIGGGIVGPNGGDM-IGEVYLAIEMGCDAADIGKT
1w4xA1          ----------------------------------------------------------------------
1np3A2          ----------------------------------------------------------------------
1f8rA1          ----------------------------------------------------------------------
1rp0A1          ----------------------------------------------------------------------
1fcdA1          ----------------------------------------------------------------------
1xdiA2          VAARTIMLPLRTNARAKMEMRHGFVKIFCRRSTGVVIGGVVVAPIASEL-ILPIAVAVQNRITVNELAQT
1lsuA           ----------------------------------------------------------------------
1p9oA           ----------------------------------------------------------------------
1eyzA2          ----------------------------------------------------------------------
1aogA1          ----------------------------------------------------------------------
1gt8A4          ----------------------------------------------------------------------
1ps9A2          ----------------------------------------------------------------------
1lnqA3          ----------------------------------------------------------------------
1chuA2          ----------------------------------------------------------------------
1bncA2          ----------------------------------------------------------------------
1ltxR1          ----------------------------------------------------------------------
1fcdA2          ----------------------------------------------------------------------
1xdiA1          ----------------------------------------------------------------------
1b6rA2          ----------------------------------------------------------------------
2culA1          ----------------------------------------------------------------------
1el5A1          ----------------------------------------------------------------------
2hy5B1          ----------------------------------------------------------------------
1bg6A2          ----------------------------------------------------------------------
1ps9A3          ----------------------------------------------------------------------
1hyhA1          ----------------------------------------------------------------------
2ivdA1          ----------------------------------------------------------------------
1lssA           ----------------------------------------------------------------------
1ng3A1          ----------------------------------------------------------------------
2dw4A2          ----------------------------------------------------------------------
1e4eA1          ----------------------------------------------------------------------
1sezA1          ----------------------------------------------------------------------
2gqfA1          ----------------------------------------------------------------------
1jw9B           ----------------------------------------------------------------------
1uaiA           ----------------------------------------------------------------------
1yrwA2          ----------------------------------------------------------------------
1e7pA2          ----------------------------------------------------------------------
1r4mA           ----------------------------------------------------------------------
1b37A1          ----------------------------------------------------------------------
1evyA2          ----------------------------------------------------------------------
1e0dA1          ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXYAPPFSPVWDPLLIAAQQAx
1gv4A1          -----------------------
1f8gA1          -----------------------
1fl2A1          -----------------------
1mo9A1          -----------------------
1d7yA2          -----------------------
1xhcA2          -----------------------
1w27A           -----------------------
1f8wA2          -----------------------
1f8wA1          -----------------------
1gv4A2          -----------------------
1onfA2          -----------------------
1bhyA2          -----------------------
1vh4A           -----------------------
1mo9A2          -----------------------
1d7yA1          -----------------------
1cjcA2          -----------------------
1f8wA3          DFFFQPAFDKPWNIINTAALEA-
1d5tA1          -----------------------
1cl0A1          -----------------------
1gosA1          -----------------------
1aogA3          IGVH-PTSAEELCSMRTPSYYY-
1aogA2          -----------------------
1fl2A2          -----------------------
1dxlA2          -----------------------
1qzfA1          -----------------------
1w4xA2          -----------------------
1bwcA2          -----------------------
1f0yA2          -----------------------
1t0qC           -----------------------
1vqwA2          -----------------------
1j3lA           -----------------------
1djnA3          -----------------------
1cl0A2          -----------------------
1xhcA1          -----------------------
1cjcA1          -----------------------
1h6vA2          -----------------------
1bhyA3          IHPH-PTLGESIGMAAEVA----
1w4xA1          -----------------------
1np3A2          -----------------------
1f8rA1          -----------------------
1rp0A1          -----------------------
1fcdA1          -----------------------
1xdiA2          LAVY-PSLS---GSITEAARRL-
1lsuA           -----------------------
1p9oA           -----------------------
1eyzA2          -----------------------
1aogA1          -----------------------
1gt8A4          -----------------------
1ps9A2          -----------------------
1lnqA3          -----------------------
1chuA2          -----------------------
1bncA2          -----------------------
1ltxR1          -----------------------
1fcdA2          -----------------------
1xdiA1          -----------------------
1b6rA2          -----------------------
2culA1          -----------------------
1el5A1          -----------------------
2hy5B1          -----------------------
1bg6A2          -----------------------
1ps9A3          -----------------------
1hyhA1          -----------------------
2ivdA1          -----------------------
1lssA           -----------------------
1ng3A1          -----------------------
2dw4A2          -----------------------
1e4eA1          -----------------------
1sezA1          -----------------------
2gqfA1          -----------------------
1jw9B           -----------------------
1uaiA           -----------------------
1yrwA2          -----------------------
1e7pA2          -----------------------
1r4mA           -----------------------
1b37A1          -----------------------
1evyA2          -----------------------
1e0dA1          -----------------------