[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS81963.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1p9rA.bssp"
#ERROR : Can't open dsspfile "1itwA.bssp"
#ERROR : Can't open dsspfile "1pgsA2.bssp"
#ERROR : Can't open dsspfile "2i7xA1.bssp"
#ERROR : Can't open dsspfile "1f48A2.bssp"
#ERROR : Can't open dsspfile "1eg7A.bssp"
#ERROR : Can't open dsspfile "1heiB1.bssp"
#ERROR : Can't open dsspfile "1w36D1.bssp"
#ERROR : Can't open dsspfile "1yr6A1.bssp"
#ERROR : Can't open dsspfile "1w44A.bssp"
#ERROR : Can't open dsspfile "1ny5B2.bssp"
#ERROR : Can't open dsspfile "1odfA.bssp"
#ERROR : Can't open dsspfile "1e9rA.bssp"
#ERROR : Can't open dsspfile "1l8qA2.bssp"
#ERROR : Can't open dsspfile "1e6cA.bssp"
#ERROR : Can't open dsspfile "1n25A.bssp"
#ERROR : Can't open dsspfile "1lw7A2.bssp"
#ERROR : Can't open dsspfile "1jalA1.bssp"
#ERROR : Can't open dsspfile "1yj5A2.bssp"
#ERROR : Can't open dsspfile "2bdtA1.bssp"
#ERROR : Can't open dsspfile "4tmkA.bssp"
#ERROR : Can't open dsspfile "1ak2A1.bssp"
#ERROR : Can't open dsspfile "1zp6A1.bssp"
#ERROR : Can't open dsspfile "1yksA1.bssp"
#ERROR : Can't open dsspfile "1udwA.bssp"
#ERROR : Can't open dsspfile "1oftA.bssp"
#ERROR : Can't open dsspfile "2axpA1.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "1xzpA1.bssp"

## Summary of PDB Search
:361
    2e-49  32%  1p9rA  [c.37.1.11] GENERAL SECRETION PATHWAY PROTEIN E
    4e-44  14%  1itwA  [c.77.1.2] ISOCITRATE DEHYDROGENASE
    2e-23   9%  1pgsA2 [b.121.1.1] PEPTIDE-N(4)-(N-ACETYL-BETA-D-GLUCOSAMINYL)
    5e-22   9%  2i7xA1 [d.157.1.10] PROTEIN CFT2 A:1 -- 422 A:626 -- 717
    1e-13  17%  1f48A2 [c.37.1.10] ARSENITE-TRANSLOCATING ATPASE A:309 -- 586
    3e-12  14%  1eg7A  [c.37.1.10] FORMYLTETRAHYDROFOLATE SYNTHETASE
    3e-09  17%  1heiB1 [c.37.1.14] HCV HELICASE B:188 -- 325
    4e-08  11%  1w36D1 [c.37.1.19] EXODEOXYRIBONUCLEASE V ALPHA CHAIN D:2 -- 360
    3e-07  21%  1yr6A1 [c.37.1.10] ATP(GTP)BINDING PROTEIN A:1 -- 244
    1e-05  26%  1w44A  [c.37.1.11] NTPASE P4
    2e-05  20%  1ny5B2 [c.37.1.20] TRANSCRIPTIONAL REGULATOR (NTRC FAMILY) B:138 --
    3e-05  22%  1odfA  [c.37.1.6] HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2
    4e-05  15%  1e9rA  [c.37.1.11] CONJUGAL TRANSFER PROTEIN TRWB
    4e-05  18%  1l8qA2 [c.37.1.20] CHROMOSOMAL REPLICATION INITIATOR PROTEIN DNAA
    7e-05  10%  1e6cA  [c.37.1.2] SHIKIMATE KINASE
    8e-05  12%  1n25A  [c.37.1.20] LARGE T ANTIGEN
    1e-04  11%  1lw7A2 [c.37.1.1] TRANSCRIPTIONAL REGULATOR NADR A:220 -- 411
    1e-04  11%  1jalA1 [c.37.1.8] YCHF PROTEIN A:1 -- 278
    2e-04  20%  1yj5A2 [c.37.1.1] 5' POLYNUCLEOTIDE KINASE-3' PHOSPHATASE A:351 --
    3e-04  32%  2bdtA1 [c.37.1.25] BH3686 A:1 -- 176
    4e-04  18%  4tmkA  [c.37.1.1] PROTEIN (THYMIDYLATE KINASE)
    4e-04  17%  1ak2A1 [c.37.1.1] ADENYLATE KINASE ISOENZYME-2 A:14 -- 146 A:177 --
    4e-04  23%  1zp6A1 [c.37.1.25] HYPOTHETICAL PROTEIN ATU3015 A:6 -- 181
    4e-04  11%  1yksA1 [c.37.1.14] GENOME POLYPROTEIN [CONTAINS: FLAVIVIRIN A:185
    5e-04  20%  1udwA  [c.37.1.6] URIDINE-CYTIDINE KINASE 2
    5e-04  15%  1oftA  [c.37.1.22] HYPOTHETICAL PROTEIN PA3008
    5e-04  17%  2axpA1 [c.37.1.1] HYPOTHETICAL PROTEIN BSU20280 A:2 -- 165
    7e-04  29%  1vplA  [c.37.1.12] ABC TRANSPORTER, ATP-BINDING PROTEIN
    8e-04  11%  1xzpA1 [a.24.25.1] PROBABLE TRNA MODIFICATION GTPASE TRME A:118 --
:361

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAKAPDVVDLLALAVERGASDLVITVGLPPMLKIDGEFHPTEYEPLTPQETRRLMYALMDEKQQRIFEEE
1p9rA           LAEEAPIIKLLGEAIKEGASDIHIETTLSIRFRVDGVLR--EVLAPSRKLSSLLVSRVKVXAKLDIAEKR
1itwA           -----MVNSDKGITNLHVPSDVIVDASMPAMIRDSGKMWGPDGKLHDTKAVIPDRCYANVGLMAQKAEEY
1pgsA2          ----------------------------------------------------------------------
2i7xA1          ------------------------------LFESQVPVLILSYARGRTLTYAKSMLEWLSPSLLKTWENR
1f48A2          ----------------------------------------------------------------------
1eg7A           ----------------------------------------------------------------------
1heiB1          ----------------------------------------------------------------------
1w36D1          -GDEHPAVTLAAALLSHDAGEGHVCLPLSRLENNEASHPSEIGELQNWEECLLASQAVSRGDEPTPMILC
1yr6A1          ----------------------------------------------------------------------
1w44A           -------------------------------------------------GVESGDAIVFDKNAQRIVAKE
1ny5B2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KELDFSFSLPGKGRYRVNVFLQRGSVGGVLRVVPSAVKSFEELGLPKNIAEIAMSPRGLVLVTGPTGSGK
1p9rA           VPQDGRISL--AVDVRVSTXPSSHGERVVXRLLDKNATRLDLHSLGDNFRRLIKRPHGIILVTGPTGSGK
1itwA           GSHDKTFQIPADGVVRVTLLEQSVEAGDIWRMCQAKDAPIQDWV-KLAVNRARATNTPAVFWLDPARAHD
1pgsA2          ----------------------------SIDGVPYGKAHTLGLKKNIQLPTNTEKAYLRTTISGWGHAKP
2i7xA1          NNTSPFEIGSRIKIIAPNELSKYPGSKICFVSEVGALI-------NEVIIKVGNSEKTTLILTKPSFECA
1f48A2          ----------------------------------------DIPSLSALVDDIARNEHGLIMLMGKGGVGK
1eg7A           ------------------------------------AKISLDVYRRLKDKPDGKLILVTAITPTPAGEGK
1heiB1          --------------------------------------------------PAVPQSFQVAHLHAPTGSGK
1w36D1          GDRLYLNRMRTVARFFNEVNHAIEVDEALLAQTLDKLFPVSDEINWQKVAAAVALTRRISVISGGPGTGK
1yr6A1          -----------------------------------------------------------VVFVGTAGSGK
1w44A           KSVKAEDSVSVVQV--ENGFMKQGHRGWLVDL------TGELVGCSPVVAEFGGHRSGMVIVTGKGNSGK
1ny5B2          ----------------------------------------------EKIKKISCAECP-VLITGESGVGK
1odfA           -----------------------------------YTIEFLDKYIPEWF-ETGNKCPLFIFFSGPQGSGK
1e9rA           ----------GQGEFGGAPFKRFGTRIVSGGKLKRMTREKAKQVTVAGV-PMPRDAEPHLLVNGATGTGK
1l8qA2          ----------------------------------------LAYEVVKEALENLGSLYNPIFIYGSVGTGK
1e6cA           -------------------------------------------------------TEPIFMV-GARGCGM
1n25A           -------------------------------------KMDSVVYDFLKCMVYNIPKKRYWLFKGPIDSGK
1lw7A2          --------------------------------------------------EARPFFAKTVAILGGESSGK
1jalA1          -----------------------------------------------------------CGIVGLPNVGK
1yj5A2          ------------------------------------------LYLPESSSLLSPNPEVVVAV-GFPGAGK
2bdtA1          ----------------------------------------------------------LYIITGPAGVGK
4tmkA           ----------------------------------------------------------YIVIEGLEGAGK
1ak2A1          -------------------------------------------------------PKGRAVLLGPPGAGK
1zp6A1          --------------------------------------------------------GGILLLSGHPGSGK
1yksA1          -------------------------------------------------SHMLKKGMT-TVLDFHPGAGK
1udwA           ----------------------------------------------------------LIGVSGGTASGK
1oftA           -------------------------------------------------------PAAFSLSLSGLPGHC
2axpA1          ----------------------------------------------------------LIILEGPDCCFK
1vplA           ---------------------------------------------------------------GPNGAGK
1xzpA1          ----------------------------------------------TEELKKADAGILLNRGQEIFERGS


                         +         .         .         .         .         *         .:210
query           STTLASMIDYINERKACHIVTIEDPIEFFHKHKRAIVNQREIGSDTKSFHKALRSVLRQAPDVILVGEMR
1p9rA           STTLYAGLQELNSSE-RNILTVEDPIEFDIDG----IGQTQVNPRVDTFARGLRAILRQDPDVVXVGEIR
1itwA           AQVIAKVERYLKDDTSGLDIRILSPVEATRFS----LARIREGKDTISVTGNVLRDYLTDLFPIMELGTS
1pgsA2          YDAGSRGCAEWCFRT--HTIAINNANTFQHQLGALGCSANPINNQSPGNWTPDRAGWCPGMAVPTRIDVL
2i7xA1          SS--LDKILEIVEQDEDGKSFLCDNYISIDTIKEEPLSKEETNFDNLDYLKIDKTLSKRTISTVNVQLKC
1f48A2          TTMAAAIAVRLADMGFDVHLTTSDPAAHLNNLQVSRIDPHEETERYRELDEAGKRLLEEDLRSPCTEEIA
1eg7A           TTTSVGLTDALARLGKRVMVCLREPSLGPSFGIKG----------GAAGGGYAQVVPMEDINLHFTGDIH
1heiB1          STKVPAAYAAQGYKVLVLNPSVGSPDGGCSGGAYDIIICDECHSTDATSILGIGTVAETAGARLVVL---
1w36D1          TTTVAKLLAALADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTLHRLLHAGNPL
1yr6A1          TTLTGEFGRYLEDNYKVAYVNLDTGVKELPYE--------------------------------------
1w44A           TPLVHAL---------------------------------------------------------------
1ny5B2          -EVVARLIHKLSDRSKEPFVAL-NVASIPRDIFEAELFGYEKGAFTGAVSSKEGFFELADGGTLFLDEI-
1odfA           SFTSIQIYNHLMEKYGGEKSIGYASIDDFYL---------------------------------------
1e9rA           SVLLRELAYTGLLRGDRMVIVDPNGDMLSKFGRD------------------------------------
1l8qA2          THLLQAAGNEAKKRGYRVIYSSAD--DFAQAXVEHLKK--------------------------------
1e6cA           TTVGRELARALGYEFVDTDIFMQHTSGMTVADVV------------------------------------
1n25A           TTLLLELCGGKALNVNLPL--DRLNFELGVAIDQFLVVFEDVKGTGGESRDLPSGQGINNLDNLR-----
1lw7A2          SVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQY--SDYPQXALGHQRYIDYAVRHSHKIAFIDTDF
1jalA1          STLFNALTKAGPFCTIEPNTGVVPMPDPRLDALA------------------------------------
1yj5A2          STFIQEHLVSAGYVHVNRDTLGSWQRCVSSCQ--------------------------------------
2bdtA1          STTLAAQLD-----NSAY---IEGDI-INHXVVGGYRPPWESDETWKNITDLTVNFLLAQNDVVLDYI--
4tmkA           TTARNVVVETLEQLGIRDMVTREPGGTQLAEKLRSLLLDIKSVGD-------------------------
1ak2A1          GTQAPKLAKNFCVCHLATGDMLRAMVASGSEL--------------------------------------
1zp6A1          -STIAEALANLPGVPKVHFHSDDLWGYIKHGRIDPWLPQ-------------------------------
1yksA1          TRRFLPQILAECARRRLRTLVLAPTRVVLSEMKE------------------------------------
1udwA           SSVCAKIVQLLQKQVVILSQDSFYRVLTSEQKAK------------------------------------
1oftA           LTLLAPILRELSEEQDARWLTLIAPPASLTHEWLRRAGLN------------------------------
2axpA1          -STVAAKLSKELKYPIIKGSSFELAKSGNEKLFEHF----------------------------------
1vplA           TTTLRIISTLIKPSSGIVTVFGKNVVEEPHEVRK------------------------------------
1xzpA1          DSLITNLRQ--KQLLENVKGHLEDAIKSLKEGMPVDMARALNLLDEVTGRSFREDLLDTIFSNFCVG---


                         .         .         .         +         .         .         .:280
query           DYXXXXXXXXXXXXGHLVMGTLHTNSAPETIDRIVDVFPENQQEQVRVQLSNNLVAVLTQQLLPKAFGGG
1p9rA           DLETAQIAVQASLTGHLVXSTLHTNTAVGAVTRLRDXGIE------PFLISSSLLGVLAQRLVRTLFEPG
1itwA           ----AKMLSIVPLMSG---GGLFETGAGGSAPKHVQQFLEEGYLRWD-SLGEFLALAASLEHLGNAYKNP
1pgsA2          N-----NSLTGSTFSYEYKFQSWTNNGTNGDAFYAISSFVIAKSNTPISAPV------------------
2i7xA1          SVVILNLQSLVDQRSASIIWPSL---------KSRKIVLSAPKQIQNEEITAKLIKKNIEVVNMP-----
1f48A2          VFQAFSRVIREAGKRFVVGHTLLLLDATTPMMLLQDPER-------------------------------
1eg7A           AVTYAHNLLAAMVDNHLQQGNVLNIDPRTITWRRVIDLNERALRNIVIGLGGK------ANGVPRETGFD
1heiB1          ----------------------------------------------------------------------
1w36D1          HLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRLASVEAGAVLGDICAYANAGFTAERARQL---S
1yr6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1lw7A2          I---------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RVLAYELMIATPAVRALIREGKTHQLRSVIQTGGQYGMITMDACxxxxxxxxxxxxxxxxxxxxxxxxxx
1p9rA           RTGIHELLLVDDALQELIHSEAGEQA--------------------------------------------
1itwA           KALVLASTLDQ-ATGKILDNNKARKVGEIDNRGSHF----------------------------------
1pgsA2          ----------------------------------------------------------------------
2i7xA1          ----------------------------------------------------------------------
1f48A2          ----------------------------------------------------------------------
1eg7A           ISVASEVMACLCLASDLMDLKERFSRKVVGYTYDGKPVTAGDLE--------------------------
1heiB1          ----------------------------------------------------------------------
1w36D1          RLTGTHVPAGTGTEAASLRDSLCLLQKS------------------------------------------
1yr6A1          ----------------------------------------------------------------------
1w44A           ----------------------------------------------------------------------
1ny5B2          ----------------------------------------------------------------------
1odfA           ----------------------------------------------------------------------
1e9rA           ----------------------------------------------------------------------
1l8qA2          ----------------------------------------------------------------------
1e6cA           ----------------------------------------------------------------------
1n25A           ----------------------------------------------------------------------
1lw7A2          ----------------------------------------------------------------------
1jalA1          ----------------------------------------------------------------------
1yj5A2          ----------------------------------------------------------------------
2bdtA1          ----------------------------------------------------------------------
4tmkA           ----------------------------------------------------------------------
1ak2A1          ----------------------------------------------------------------------
1zp6A1          ----------------------------------------------------------------------
1yksA1          ----------------------------------------------------------------------
1udwA           ----------------------------------------------------------------------
1oftA           ----------------------------------------------------------------------
2axpA1          ----------------------------------------------------------------------
1vplA           ----------------------------------------------------------------------
1xzpA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxx
1p9rA           -----------
1itwA           -----------
1pgsA2          -----------
2i7xA1          -----------
1f48A2          -----------
1eg7A           -----------
1heiB1          -----------
1w36D1          -----------
1yr6A1          -----------
1w44A           -----------
1ny5B2          -----------
1odfA           -----------
1e9rA           -----------
1l8qA2          -----------
1e6cA           -----------
1n25A           -----------
1lw7A2          -----------
1jalA1          -----------
1yj5A2          -----------
2bdtA1          -----------
4tmkA           -----------
1ak2A1          -----------
1zp6A1          -----------
1yksA1          -----------
1udwA           -----------
1oftA           -----------
2axpA1          -----------
1vplA           -----------
1xzpA1          -----------