[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS82142.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1i69A.bssp"
#ERROR : Can't open dsspfile "1b9mA1.bssp"
#ERROR : Can't open dsspfile "1utbA.bssp"
#ERROR : Can't open dsspfile "1ixcA2.bssp"
#ERROR : Can't open dsspfile "2p4wA1.bssp"
#ERROR : Can't open dsspfile "1o63A.bssp"
#ERROR : Can't open dsspfile "2hr3A1.bssp"
#ERROR : Can't open dsspfile "1r71A.bssp"
#ERROR : Can't open dsspfile "2esnA2.bssp"
#ERROR : Can't open dsspfile "1ixcA1.bssp"
#ERROR : Can't open dsspfile "1xn7A.bssp"
#ERROR : Can't open dsspfile "2esnA1.bssp"
#ERROR : Can't open dsspfile "1y0uA.bssp"
#ERROR : Can't open dsspfile "2f2eA1.bssp"
#ERROR : Can't open dsspfile "1cy0A.bssp"
#ERROR : Can't open dsspfile "1r1tA.bssp"
#ERROR : Can't open dsspfile "1sfxA.bssp"
#ERROR : Can't open dsspfile "2fxaA1.bssp"
#ERROR : Can't open dsspfile "1fokA2.bssp"
#ERROR : Can't open dsspfile "1lj9A.bssp"
#ERROR : Can't open dsspfile "2fbhA1.bssp"
#ERROR : Can't open dsspfile "1tbxA.bssp"
#ERROR : Can't open dsspfile "1jgsA.bssp"
#ERROR : Can't open dsspfile "1al3A.bssp"
#ERROR : Can't open dsspfile "1lnwA.bssp"
#ERROR : Can't open dsspfile "1ub9A.bssp"

## Summary of PDB Search
:285
    1e-11  25%  1i69A  [c.94.1.1] HYDROGEN PEROXIDE-INDUCIBLE GENES ACTIVATOR
    2e-08  24%  1b9mA1 [a.4.5.8] PROTEIN (MODE) A:-1 -- 126
    5e-07  15%  1utbA  [c.94.1.1] LYSR-TYPE REGULATORY PROTEIN
    2e-06  18%  1ixcA2 [c.94.1.1] LYSR-TYPE REGULATORY PROTEIN A:90 -- 294
    5e-06  14%  2p4wA1 [a.4.5.64] TRANSCRIPTIONAL REGULATORY PROTEIN ARSR FAMILY
    6e-06  13%  1o63A  [c.94.1.1] ATP PHOSPHORIBOSYLTRANSFERASE
    1e-05  12%  2hr3A1 [a.4.5.28] PROBABLE TRANSCRIPTIONAL REGULATOR A:2 -- 146
    1e-05  21%  1r71A  [a.4.14.1] TRANSCRIPTIONAL REPRESSOR PROTEIN KORB
    2e-05  16%  2esnA2 [c.94.1.1] PROBABLE TRANSCRIPTIONAL REGULATOR A:92 -- 303
    2e-05  38%  1ixcA1 [a.4.5.37] LYSR-TYPE REGULATORY PROTEIN A:1 -- 89
    3e-05  12%  1xn7A  [a.4.5.62] HYPOTHETICAL PROTEIN YHGG
    3e-05  24%  2esnA1 [a.4.5.37] PROBABLE TRANSCRIPTIONAL REGULATOR A:3 -- 91
    3e-05  24%  1y0uA  [a.4.5.5] ARSENICAL RESISTANCE OPERON REPRESSOR, PUTATIVE
    4e-05  17%  2f2eA1 [a.4.5.69] PA1607 A:5 -- 146
    4e-05  15%  1cy0A  [e.10.1.1] DNA TOPOISOMERASE I
    4e-05  27%  1r1tA  [a.4.5.5] TRANSCRIPTIONAL REPRESSOR SMTB
    7e-05  22%  1sfxA  [a.4.5.50] CONSERVED HYPOTHETICAL PROTEIN AF2008
    1e-04   8%  2fxaA1 [a.4.5.28] PROTEASE PRODUCTION REGULATORY PROTEIN HPR A:6
    2e-04  14%  1fokA2 [a.4.5.12] PROTEIN (FOKI RESTRICTION ENDONUCLEAS) A:144 --
    2e-04  13%  1lj9A  [a.4.5.28] TRANSCRIPTIONAL REGULATOR SLYA
    3e-04  11%  2fbhA1 [a.4.5.28] TRANSCRIPTIONAL REGULATOR PA3341 A:8 -- 144
    4e-04  12%  1tbxA  [a.4.5.48] HYPOTHETICAL 11.0 KDA PROTEIN
    4e-04  14%  1jgsA  [a.4.5.28] MULTIPLE ANTIBIOTIC RESISTANCE PROTEIN MARR
    5e-04  19%  1al3A  [c.94.1.1] CYS REGULON TRANSCRIPTIONAL ACTIVATOR CYSB
    6e-04  11%  1lnwA  [a.4.5.28] MULTIDRUG RESISTANCE OPERON REPRESSOR
    0.001  19%  1ub9A  [a.4.5.28] HYPOTHETICAL PROTEIN PH1061
:285

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDPRRLKAFLVLAEEKSFHKAAERLYLSQPALTQRIQAXXXXXXXXXXXXXPFRLTPAGxxxxxxxxxxx
1i69A           ----------------------------------------------------------------------
1b9mA1          ADPRRISLLKHIALSGSISQGAKDAGISYKSAWDAINE--------------------------------
1utbA           ----------------------------------------------------------------------
1ixcA2          ----------------------------------------------------------------------
2p4wA1          -NETRRRILFLLTKPYFVSELSRELGVGQKAVLEHLR---------------------------------
1o63A           ----------------------------------------------------------------------
2hr3A1          SQLVVLGAIDRLGGDVTPSELAAAERXRSSNLAALLRELERGGLIVRHARTRVSLSSEG-----------
1r71A           ---IADFIGRELAKGKKKGDIAKEIGKSPAFITQHVT---------------------------------
2esnA2          ----------------------------------------------------------------------
1ixcA1          ---RQLKYFIAVAEAGNXAAAAKRLHVSQPPITRQXQALEADLGVVLLE---IELTAAG-----------
1xn7A           -SLIQVRDLLALRGRMEAAQISQTLNTPQPMINAMLQQESMGKAVRIQEEPDGCLSGSC-----------
2esnA1          LDLNLLLVFDALYRHRNVGTAASELAISASAFSHALGR--------------------------------
1y0uA           TNPVRRKILRXLDKGRSEEEIXQTLSLSKKQLDYHLK---------------------------------
2f2eA1          ---SXLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRN--------------------------------
1cy0A           LTPAQFTKPPARFSEASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENRRFYAEKMG-----------
1r1tA           ADPNRLRLLSLLARELCVGDLAQAIGVSESAVSHQLR---------------------------------
1sfxA           FKPSDVRIYSLLLEGXRVSEIARELDLSARFVRDRLK---------------------------------
2fxaA1          LNINEHHILWIAYQLNSISEIAKFGVXHVSTAFNFSKKLEERGYLRFSKRTYVQLTEEG-----------
1fokA2          -----IEKEILIEAISSYPPAIRILTLLEDGQH-------------------------------------
1lj9A           LTRGQYLYLVRVCENPIQEKIAELIKVDRTTAARAIKR--------------------------------
2fbhA1          ARWLVLLHLARHRDSPTQRELAQSVGVEGPTLARLLD---------------------------------
1tbxA           ---AYLYDNEGIATYDLYKKVNAEFPXSTATFYDAKK---------------------------------
1jgsA           ITAAQFKVLCSIRCAATPVELKKVLSVDLGALTRMLD---------------------------------
1al3A           ----------------------------------------------------------------------
1lnwA           LTPPDVHVLKLIDEQRNLQDLGRQXCRDKALITRKIR---------------------------------
1ub9A           PVRLGIMIFLLPRRKAPFSQIQKVLDLTPGNLDSHIR---------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRRGLGQAVEVLEMHTPEQVRALKEGRLDYGLAG
1i69A           --------------------------------------------MYLHEAQTHQLLAQLDSGKLDAVILA
1b9mA1          ----------------------------------------------------------------------
1utbA           -------------------------------------QRAPHIQISTLRPNAGNLKEDMESGAVDLALGL
1ixcA2          --------------------------------------------VSLTHXTKDEQVEGLLAGTIHVGFSR
2p4wA1          ----------------------------------------------------------------------
1o63A           --------------------------------------------IVCFXVRPFDVPTYLVHGVADIGFCG
2hr3A1          ----------------------------------------------------------------------
1r71A           ----------------------------------------------------------------------
2esnA2          --------------------------------------------LRLVNAERKLSVEALASGRIDFALGY
1ixcA1          ----------------------------------------------------------------------
1xn7A           ----------------------------------------------------------------------
2esnA1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
2f2eA1          ----------------------------------------------------------------------
1cy0A           ----------------------------------------------------------------------
1r1tA           ----------------------------------------------------------------------
1sfxA           ----------------------------------------------------------------------
2fxaA1          ----------------------------------------------------------------------
1fokA2          ----------------------------------------------------------------------
1lj9A           ----------------------------------------------------------------------
2fbhA1          ----------------------------------------------------------------------
1tbxA           ----------------------------------------------------------------------
1jgsA           ----------------------------------------------------------------------
1al3A           --------------------------------------------LHMHQGSPTQIAEAVSKGNADFAIAT
1lnwA           ----------------------------------------------------------------------
1ub9A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LKVEDPEVAKEPLLRVPIVVALPETHPLAPRARVPLRALKEEXXXXXXXXXXXXXYEAFMEVFRRAGFAP
1i69A           LVKESEAFIEVPLFDEPMLLAIYEDHPWANREAVPMADLAGE--------KLLMLEDGHSLRDQAMGFCF
1b9mA1          ----------------------------------------------------------------------
1utbA           LPELQTGFFQRRLFRHRYVCMFRKDHPSAKSPMSLKQFSELE---HVGVVALNTGHGEVDGLLERAGIKR
1ixcA2          FFPRHPGIEIVNIAQEDLYLAVHRSQSGKFGKTCKLADLRAVELTLFPRGGRPSFADEVIGLFKHAGIEP
2p4wA1          ----------------------------------------------------------------------
1o63A           TDVSLIQPFFIPTNISRXVLAGPKGRGIPEGEKRIATKF----------------PNVTQRYCESKGWHC
2hr3A1          ----------------------------------------------------------------------
1r71A           ----------------------------------------------------------------------
2esnA2          DEEHEEGIQAHDWFADRYVVVARRDHPRLAG-APTLEGYLAERHAVVTPWNED--SGVIDRLLARSGLRR
1ixcA1          ----------------------------------------------------------------------
1xn7A           ----------------------------------------------------------------------
2esnA1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
2f2eA1          ----------------------------------------------------------------------
1cy0A           ----------------------------------------------------------------------
1r1tA           ----------------------------------------------------------------------
1sfxA           ----------------------------------------------------------------------
2fxaA1          ----------------------------------------------------------------------
1fokA2          ----------------------------------------------------------------------
1lj9A           ----------------------------------------------------------------------
2fbhA1          ----------------------------------------------------------------------
1tbxA           ----------------------------------------------------------------------
1jgsA           ----------------------------------------------------------------------
1al3A           EALLYDDLVMLPCYHWNRSIVVTPEHPLATKGSVSIEELAQYPLVTYTFGFTG--RSELDTAFNRAGLTP
1lnwA           ----------------------------------------------------------------------
1ub9A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           KVVREVARFSQAVSLVAAGLGVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1i69A           DTHFRATSLETLRNMVAAGSGI------------------------------------------------
1b9mA1          ----------------------------------------------------------------------
1utbA           RMRLVVPHFIAIGPILHSTDLI------------------------------------------------
1ixcA2          RIARVVEDATAALALTXAG---------------------------------------------------
2p4wA1          ----------------------------------------------------------------------
1o63A           RIIPLKGSVELAP---------------------------------------------------------
2hr3A1          ----------------------------------------------------------------------
1r71A           ----------------------------------------------------------------------
2esnA2          EVAVQLPTVLAALFLAGSTDFL------------------------------------------------
1ixcA1          ----------------------------------------------------------------------
1xn7A           ----------------------------------------------------------------------
2esnA1          ----------------------------------------------------------------------
1y0uA           ----------------------------------------------------------------------
2f2eA1          ----------------------------------------------------------------------
1cy0A           ----------------------------------------------------------------------
1r1tA           ----------------------------------------------------------------------
1sfxA           ----------------------------------------------------------------------
2fxaA1          ----------------------------------------------------------------------
1fokA2          ----------------------------------------------------------------------
1lj9A           ----------------------------------------------------------------------
2fbhA1          ----------------------------------------------------------------------
1tbxA           ----------------------------------------------------------------------
1jgsA           ----------------------------------------------------------------------
1al3A           RIVFTATDADVIKTYVRLGLGV------------------------------------------------
1lnwA           ----------------------------------------------------------------------
1ub9A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxx
1i69A           -----
1b9mA1          -----
1utbA           -----
1ixcA2          -----
2p4wA1          -----
1o63A           -----
2hr3A1          -----
1r71A           -----
2esnA2          -----
1ixcA1          -----
1xn7A           -----
2esnA1          -----
1y0uA           -----
2f2eA1          -----
1cy0A           -----
1r1tA           -----
1sfxA           -----
2fxaA1          -----
1fokA2          -----
1lj9A           -----
2fbhA1          -----
1tbxA           -----
1jgsA           -----
1al3A           -----
1lnwA           -----
1ub9A           -----