[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS82166.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2ba0A1.bssp"
#ERROR : Can't open dsspfile "2nn6I1.bssp"
#ERROR : Can't open dsspfile "1wi5A.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "2oceA4.bssp"
#ERROR : Can't open dsspfile "1jjgA.bssp"
#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "1go3E1.bssp"
#ERROR : Can't open dsspfile "1y14B1.bssp"
#ERROR : Can't open dsspfile "2id0A1.bssp"
#ERROR : Can't open dsspfile "2ahoB2.bssp"
#ERROR : Can't open dsspfile "2ot2A1.bssp"
#ERROR : Can't open dsspfile "1bmfD1.bssp"
#ERROR : Can't open dsspfile "2ja9A1.bssp"
#ERROR : Can't open dsspfile "2nn6H1.bssp"
#ERROR : Can't open dsspfile "1t9hA1.bssp"
#ERROR : Can't open dsspfile "1hr0W.bssp"
#ERROR : Can't open dsspfile "1hh2P1.bssp"
#ERROR : Can't open dsspfile "1k3rA1.bssp"
#ERROR : Can't open dsspfile "1luzA.bssp"
#ERROR : Can't open dsspfile "1kl9A2.bssp"
#ERROR : Can't open dsspfile "1gu9A.bssp"
#ERROR : Can't open dsspfile "1t3eA1.bssp"
#ERROR : Can't open dsspfile "1k0rA1.bssp"
#ERROR : Can't open dsspfile "1smxA.bssp"
#ERROR : Can't open dsspfile "1wfqA.bssp"
#ERROR : Can't open dsspfile "2ba0A1.bssp"
#ERROR : Can't open dsspfile "2ba0A1.bssp"
#ERROR : Can't open dsspfile "2ba0A1.bssp"
#ERROR : Can't open dsspfile "2ba0A1.bssp"
#ERROR : Can't open dsspfile "2nn6I1.bssp"
#ERROR : Can't open dsspfile "1wi5A.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "1sroA.bssp"
#ERROR : Can't open dsspfile "2oceA4.bssp"
#ERROR : Can't open dsspfile "2oceA4.bssp"
#ERROR : Can't open dsspfile "1jjgA.bssp"
#ERROR : Can't open dsspfile "1jjgA.bssp"
#ERROR : Can't open dsspfile "1d7qA.bssp"
#ERROR : Can't open dsspfile "1go3E1.bssp"
#ERROR : Can't open dsspfile "1y14B1.bssp"
#ERROR : Can't open dsspfile "1y14B1.bssp"
#ERROR : Can't open dsspfile "1y14B1.bssp"
#ERROR : Can't open dsspfile "1y14B1.bssp"
#ERROR : Can't open dsspfile "2id0A1.bssp"
#ERROR : Can't open dsspfile "2id0A1.bssp"
#ERROR : Can't open dsspfile "2id0A1.bssp"
#ERROR : Can't open dsspfile "2id0A1.bssp"
#ERROR : Can't open dsspfile "2ahoB2.bssp"
#ERROR : Can't open dsspfile "2ahoB2.bssp"
#ERROR : Can't open dsspfile "2ahoB2.bssp"
#ERROR : Can't open dsspfile "2ahoB2.bssp"
#ERROR : Can't open dsspfile "2ot2A1.bssp"
#ERROR : Can't open dsspfile "1bmfD1.bssp"
#ERROR : Can't open dsspfile "2ja9A1.bssp"
#ERROR : Can't open dsspfile "2ja9A1.bssp"
#ERROR : Can't open dsspfile "2ja9A1.bssp"
#ERROR : Can't open dsspfile "2nn6H1.bssp"
#ERROR : Can't open dsspfile "2nn6H1.bssp"
#ERROR : Can't open dsspfile "2nn6H1.bssp"
#ERROR : Can't open dsspfile "2nn6H1.bssp"
#ERROR : Can't open dsspfile "1t9hA1.bssp"
#ERROR : Can't open dsspfile "1t9hA1.bssp"
#ERROR : Can't open dsspfile "1t9hA1.bssp"
#ERROR : Can't open dsspfile "1hr0W.bssp"
#ERROR : Can't open dsspfile "1hr0W.bssp"
#ERROR : Can't open dsspfile "1hr0W.bssp"
#ERROR : Can't open dsspfile "1hr0W.bssp"
#ERROR : Can't open dsspfile "1hh2P1.bssp"
#ERROR : Can't open dsspfile "1hh2P1.bssp"
#ERROR : Can't open dsspfile "1hh2P1.bssp"
#ERROR : Can't open dsspfile "1hh2P1.bssp"
#ERROR : Can't open dsspfile "1k3rA1.bssp"
#ERROR : Can't open dsspfile "1k3rA1.bssp"
#ERROR : Can't open dsspfile "1k3rA1.bssp"
#ERROR : Can't open dsspfile "1luzA.bssp"
#ERROR : Can't open dsspfile "1luzA.bssp"
#ERROR : Can't open dsspfile "1luzA.bssp"
#ERROR : Can't open dsspfile "1luzA.bssp"
#ERROR : Can't open dsspfile "1kl9A2.bssp"
#ERROR : Can't open dsspfile "1kl9A2.bssp"
#ERROR : Can't open dsspfile "1kl9A2.bssp"
#ERROR : Can't open dsspfile "1t3eA1.bssp"

## Summary of PDB Search
:536
    5e-19  27%  2ba0A1 [b.40.4.5] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4 A:53 --
    5e-19  18%  2nn6I1 [b.40.4.5] 3'-5' EXORIBONUCLEASE CSL4 HOMOLOG I:61 -- 185
    2e-18  18%  1wi5A  [b.40.4.5] RRP5 PROTEIN HOMOLOG
    4e-17  38%  1sroA  [b.40.4.5] PNPASE
    2e-16  38%  2oceA4 [b.40.4.5] HYPOTHETICAL PROTEIN PA5201 A:637 -- 730
    2e-16  12%  1jjgA  [b.40.4.5] M156R
    2e-16  12%  1d7qA  [b.40.4.5] TRANSLATION INITIATION FACTOR 1A
    2e-15  25%  1go3E1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE SUBUNIT E E:79 -- 184
    9e-15  13%  1y14B1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE II 19 KDA B:81 -- 171
    2e-14  18%  2id0A1 [b.40.4.5] EXORIBONUCLEASE 2 A:558 -- 644
    5e-14  25%  2ahoB2 [b.40.4.5] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT B:1
    1e-13  20%  2ot2A1 [b.40.14.1] HYDROGENASE ISOENZYMES FORMATION PROTEIN HYPC
    2e-13  12%  1bmfD1 [a.69.1.1] BOVINE MITOCHONDRIAL F1-ATPASE D:358 -- 475
    4e-13  14%  2ja9A1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP40 A:62 -- 151
    4e-13  23%  2nn6H1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP4 H:73 -- 167
    2e-12  15%  1t9hA1 [b.40.4.5] PROBABLE GTPASE ENGC A:1 -- 67
    3e-12  25%  1hr0W  [b.40.4.5] TRANSLATION INITIATION FACTOR
    1e-11  20%  1hh2P1 [b.40.4.5] N UTILIZATION SUBSTANCE PROTEIN A P:127 -- 198
    2e-10  18%  1k3rA1 [b.40.4.10] CONSERVED PROTEIN MT0001 A:93 -- 163
    5e-10  16%  1luzA  [b.40.4.5] PROTEIN K3
    1e-09  30%  1kl9A2 [b.40.4.5] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 A:3 --
    1e-07  10%  1gu9A  [a.152.1.1] ALKYLHYDROPEROXIDASE D
    5e-07  13%  1t3eA1 [b.85.6.1] GEPHYRIN A:654 -- 736
    6e-06  31%  1k0rA1 [b.40.4.5] NUSA A:108 -- 183
    3e-04  27%  1smxA  [b.40.4.5] RIBONUCLEASE E
    3e-04  19%  1wfqA  [b.40.4.5] UNR PROTEIN
    1e-12  31%  2ba0A1 [b.40.4.5] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4 A:53 --(query 377->440)
    1e-11  23%  2ba0A1 [b.40.4.5] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4 A:53 --(query 31->112)
    4e-10  33%  2ba0A1 [b.40.4.5] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4 A:53 --(query 229->284)
    4e-07  21%  2ba0A1 [b.40.4.5] ARCHEAL EXOSOME RNA BINDING PROTEIN RRP4 A:53 --(query 119->196)
    4e-10  20%  2nn6I1 [b.40.4.5] 3'-5' EXORIBONUCLEASE CSL4 HOMOLOG I:61 -- 185(query 31->125)
    2e-05  14%  1wi5A  [b.40.4.5] RRP5 PROTEIN HOMOLOG(query 102->202)
    2e-16  45%  1sroA  [b.40.4.5] PNPASE(query 377->440)
    9e-13  38%  1sroA  [b.40.4.5] PNPASE(query 30->105)
    2e-11  44%  1sroA  [b.40.4.5] PNPASE(query 229->277)
    1e-08  30%  1sroA  [b.40.4.5] PNPASE(query 119->188)
    6e-13  28%  2oceA4 [b.40.4.5] HYPOTHETICAL PROTEIN PA5201 A:637 -- 730(query 191->279)
    7e-07  24%  2oceA4 [b.40.4.5] HYPOTHETICAL PROTEIN PA5201 A:637 -- 730(query 104->190)
    5e-06  13%  1jjgA  [b.40.4.5] M156R(query 188->275)
    3e-04  19%  1jjgA  [b.40.4.5] M156R(query 102->187)
    9e-06  14%  1d7qA  [b.40.4.5] TRANSLATION INITIATION FACTOR 1A(query 102->200)
    2e-07  19%  1go3E1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE SUBUNIT E E:79 -- 184(query 120->202)
    2e-10   9%  1y14B1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE II 19 KDA B:81 -- 171(query 227->284)
    7e-10  14%  1y14B1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE II 19 KDA B:81 -- 171(query 381->440)
    1e-09  13%  1y14B1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE II 19 KDA B:81 -- 171(query 33->104)
    8e-06  14%  1y14B1 [b.40.4.5] DNA-DIRECTED RNA POLYMERASE II 19 KDA B:81 -- 171(query 120->193)
    2e-12  17%  2id0A1 [b.40.4.5] EXORIBONUCLEASE 2 A:558 -- 644(query 381->439)
    6e-08  10%  2id0A1 [b.40.4.5] EXORIBONUCLEASE 2 A:558 -- 644(query 229->278)
    2e-07  19%  2id0A1 [b.40.4.5] EXORIBONUCLEASE 2 A:558 -- 644(query 31->102)
    7e-04  21%  2id0A1 [b.40.4.5] EXORIBONUCLEASE 2 A:558 -- 644(query 120->186)
    7e-10  24%  2ahoB2 [b.40.4.5] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT B:1(query 372->439)
    3e-08  29%  2ahoB2 [b.40.4.5] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT B:1(query 26->105)
    9e-08  22%  2ahoB2 [b.40.4.5] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT B:1(query 199->277)
    3e-06  34%  2ahoB2 [b.40.4.5] TRANSLATION INITIATION FACTOR 2 ALPHA SUBUNIT B:1(query 115->188)
    2e-04  17%  2ot2A1 [b.40.14.1] HYDROGENASE ISOENZYMES FORMATION PROTEIN HYPC(query 125->208)
    5e-08  10%  1bmfD1 [a.69.1.1] BOVINE MITOCHONDRIAL F1-ATPASE D:358 -- 475(query 174->259)
    3e-10  12%  2ja9A1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP40 A:62 -- 151(query 377->440)
    3e-09  14%  2ja9A1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP40 A:62 -- 151(query 238->289)
    3e-05   9%  2ja9A1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP40 A:62 -- 151(query 116->197)
    5e-11  16%  2nn6H1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP4 H:73 -- 167(query 27->107)
    1e-10  16%  2nn6H1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP4 H:73 -- 167(query 377->440)
    1e-06  23%  2nn6H1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP4 H:73 -- 167(query 229->279)
    6e-06  19%  2nn6H1 [b.40.4.5] EXOSOME COMPLEX EXONUCLEASE RRP4 H:73 -- 167(query 119->190)
    6e-10  15%  1t9hA1 [b.40.4.5] PROBABLE GTPASE ENGC A:1 -- 67(query 384->439)
    1e-05  11%  1t9hA1 [b.40.4.5] PROBABLE GTPASE ENGC A:1 -- 67(query 231->277)
    4e-05  14%  1t9hA1 [b.40.4.5] PROBABLE GTPASE ENGC A:1 -- 67(query 35->104)
    4e-10  25%  1hr0W  [b.40.4.5] TRANSLATION INITIATION FACTOR(query 377->440)
    3e-08  19%  1hr0W  [b.40.4.5] TRANSLATION INITIATION FACTOR(query 29->103)
    6e-07  22%  1hr0W  [b.40.4.5] TRANSLATION INITIATION FACTOR(query 231->275)
    2e-06  12%  1hr0W  [b.40.4.5] TRANSLATION INITIATION FACTOR(query 119->187)
    4e-10  21%  1hh2P1 [b.40.4.5] N UTILIZATION SUBSTANCE PROTEIN A P:127 -- 198(query 371->440)
    2e-09  23%  1hh2P1 [b.40.4.5] N UTILIZATION SUBSTANCE PROTEIN A P:127 -- 198(query 27->105)
    1e-07  20%  1hh2P1 [b.40.4.5] N UTILIZATION SUBSTANCE PROTEIN A P:127 -- 198(query 227->277)
    4e-06  12%  1hh2P1 [b.40.4.5] N UTILIZATION SUBSTANCE PROTEIN A P:127 -- 198(query 120->188)
    3e-08  17%  1k3rA1 [b.40.4.10] CONSERVED PROTEIN MT0001 A:93 -- 163(query 376->440)
    9e-08  23%  1k3rA1 [b.40.4.10] CONSERVED PROTEIN MT0001 A:93 -- 163(query 28->108)
    4e-04  15%  1k3rA1 [b.40.4.10] CONSERVED PROTEIN MT0001 A:93 -- 163(query 248->284)
    7e-10  17%  1luzA  [b.40.4.5] PROTEIN K3(query 229->282)
    6e-09  24%  1luzA  [b.40.4.5] PROTEIN K3(query 381->440)
    1e-05  13%  1luzA  [b.40.4.5] PROTEIN K3(query 120->194)
    3e-05  21%  1luzA  [b.40.4.5] PROTEIN K3(query 31->110)
    9e-08  29%  1kl9A2 [b.40.4.5] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 A:3 --(query 27->105)
    3e-06  26%  1kl9A2 [b.40.4.5] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 A:3 --(query 376->440)
    9e-05  27%  1kl9A2 [b.40.4.5] EUKARYOTIC TRANSLATION INITIATION FACTOR 2 A:3 --(query 248->277)
    9e-05  16%  1t3eA1 [b.85.6.1] GEPHYRIN A:654 -- 736(query 378->437)
:536

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxLEKRVRPGQILTGKVVLVGSEGVAVDIGAKTEGIIPFNQLTTKPL
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1gu9A           ----------------------------------------------------------------------
1t3eA1          ----------------------------------------------------------------------
1k0rA1          ------------------------------REGEIVAGVIQRDSRANVVVRIGTASEGVIPAAEQ----V
1smxA           --------------------------------ANIYKGKIIEPSLEAAFVDYGAERHGFLPLKEIAREYF
1wfqA           ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ------------------------------SVGDVVIGIIREVAANGWAVDIYSPYQAFLPVSENPEMK-
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ------------------------------DVGAIVTCKVSSINSRFAKVHILYVGSMPLKNSDVRATEK
1wi5A           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           -----------------------------IEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRV
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          --------------------------------GEVVDGTVVSCSQHGFEVQVGPM-KVFVTKHLMPQDLT
1y14B1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ------------------------------GTDTRFAAEIVDISRGGXRVRLVDGAIAFIPAPFLHAVRD
2id0A1          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          -------------------------RSKLPSEGEILIATVKQVFDYGSYVSLDGGLQAFLPWSEVSNI--
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2nn6H1          --------------------------RYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNELAM
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------MPEGKIIKALSGFYYVLDESEDSDKVIQCRGRGIFR
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------KEKDTIRTEGVVTEALPNATRVKLDSGPEILAYISGKMRMH-
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          --------------------------KYSELKGTVTTAEVIRVMGEWADIRIGKL-ETRLPKKEWIPG--
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1k3rA1          ---------------------------GKPVTGEYRQGLTVKRVKKGTLVDIGADKLALC----------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ------------------------------NAGDVIKGRVYEKDYALIYLFDYPHFEAILAESVKXHXDR
1kl9A2          --------------------------HKFPEVEDVVXVNVRSIAEXGAYVSLLEYNEGXIL---------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1t3eA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           SEEELRNLLSPGDEVKVQVLRVDPETGQILLSRKKIEAQEKWDRIQELYEKGEPVTVTIKERVKGGVVAE
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1gu9A           ------------SSITRSSVLDQEQLWGTLLASAAATRNPQVLADIGAEATDHARHAALGAAAIXGXNNV
1t3eA1          ----------------------------------------------------------------------
1k0rA1          PGESYE----HGNRLRCYVVGVTRGAPLITLSR-------------------------------------
1smxA           PANYIKDVLREGQEVIVQIDK-------------------------------------------------
1wfqA           ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          PNKKPNEVLDIGDAIIAKVLNIDPK-MKVTLTMKDRI-CRPI----------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ------------------------------------------------PSVGDVVIGIIREVAANGWAVD
2nn6I1          DKVEIYKSFRPGDIVLAKVISLGDAQSNYLLTTAENE-LGVVVAHSESGIQMVPI---------------
1wi5A           -------------------------------SGSSGKNVNRVLSAEA-LKPGMLLTGTVSSLEDHGYLVD
1sroA           ----------------------------------------------------------------------
1sroA           --EKVTDYLQMGQEVPVKVLEVDRQ-GRIRLSIKE-----------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ------------------------------------------------IEVGRVYTGKVTRIVDFGAFVA
2oceA4          ----------------------------------------------------------------------
2oceA4          ---------------------------------KTAEFQEGVESLKDL-KPGMVLEGVVTNVTNFGAFVD
1jjgA           ----------------------------------------------------------------------
1jjgA           -------------------------------SSRPRPRKNKNIKVNTYRTSPGSVHEGIVYFKDGIFKVR
1d7qA           -------------------------------NRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEA
1go3E1          -------------------------------------------------EMYELIEGEVVDVVEFGSFVR
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          FNASYQSVITIKSRIRVKIEGCISQVSSIHAIGS------------------------------------
1y14B1          -------------------------------------------------FKGEVVDGTVVSCSQHGFEVQ
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          SQENGTTVYKVTDVIDVTIAEVRXETRSIIAR--------------------------------------
2id0A1          -------------------------------------------------GTDTRFAAEIVDISRGGXRVR
2ahoB2          ----------------------------------------------------------------------
2ahoB2          -----RDVLKENRKVIVKVIRVDRRKGTVDVSLKK-----------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          --------------------------------------------RSKLPSEGEILIATVKQVFDYGSYVS
2ot2A1          ------------------------------------------------------VPGQIRTIDGNQAKVD
1bmfD1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2ja9A1          ---------------------------------------------RYIPSVNDFVIGVIIGTFSDSYKVS
2nn6H1          RG-----FLQEGDLISAEVQAVFSD-GAVSLHTRSLK---------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ------------------------------------------------GEVGDIVVGRITEVQQKRWKVE
1t9hA1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1t9hA1          KNKIT---PLVGDYVVYQAENDK--EGYLMEIKE------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           -----YIRILPGDRVVVEITPYDPTRGRIVYRK-------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ------------------------------------------------EKDTIRTEGVVTEALPNATFRV
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ------EEIKAGDLVKVYIIDVVKTTKGPKILVSR-----------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          -------------------------------------------------LKGTVTTAEVIRVMGEWADIR
1k3rA1          ----------------------------------------------------------------------
1k3rA1          -----REKLTVNRIMSFRVVRLGKE-ILIEPDEPEDRY--------------------------------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           -------------------------------------------------NAGDVIKGRVYEKDYALYIYL
1luzA           --YVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRXCRHQ------------------------------
1kl9A2          -----LSELRIGRNECVVVIRVDKEKGYIDLSKRR-----------------------------------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1t3eA1          ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           LDGIQGFMPASQLDLRRVPNLDEFVGQQVLAKIIEFHRRKGRVILSRRAVLEEEQKKAREAFLKSLEPGQ
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1gu9A           FYRGRGFLEGRYDDLRPGLRMNIIANPGIPKANFELWSFAVSAINGCSHCLVAHEHTLRTV---------
1t3eA1          ----------------------------------------------------------------------
1k0rA1          ----------------------------------------------------------------------
1smxA           ----------------------------------------------------------------------
1wfqA           ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          IYPYQAFLPVSENEMKPNKKPNEVIGDAIIAKVLNI-DPKMKVTLTMKDRICRPIR--------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           IGTRAFLPLLKAQEYIRQKNKGAKVGQYLNCIVEKVKGNGGVVSLSVGHSEVSTAIATEQQS--------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           IGGKEGLVHISQIADKRVEKVTDYMGQEVPVKVLEV-DRQGRIRLSIK----------------------
2oceA4          --------------------------------------------------FKTAEFQEGVESLKDLKPGM
2oceA4          IGHQDGLVHISALSEKFVKDPYEVAGDIVKVKVMEVDIPRNRVGLSMRMS--------------------
1jjgA           -----------------------------------------------RPRKNKNIKVNTYRTSAMDLSPG
1jjgA           LLGYEGECILLDYLNYRQDTLDRLVGRVIKTRVVRAD--GLYVDLRR-----------------------
1d7qA           MDGVKRLCHIRGKLRKKV---WINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGE----------
1go3E1          LGPLDGLIHVSQIMDDYVSYDPKAIGDYVRARIVAISLKASKIALTMRQPYLGKLEWIEEEK--------
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          VGPMKVFVTKHLMPQDLTFNASYTIKSRIRVKIEGCISQVSSIHAIGSIKEDY-----------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          LVGAIAFIPAPFLHAVRDELVCSQVTDVIDVTIAEVRXETRSIIAR------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------IYSRSKLPSEGE
2ahoB2          LDGLQAFLPWSEVSNIR----DVLENRKVIVKVIRVDRRKGTVDVSLK----------------------
2ot2A1          VCGIQRDVDLTLVGSCD-ENGQPRVGQWVLVHVGFAMSVEAEARDTLDALQNMFDVEPDVGALLYGEE--
1bmfD1          ---------------------------------QDIIAILGMDELSEEDKLTVSRARKQRFLSQPFQVAT
2ja9A1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2ja9A1          LQNFSSSVSSYMAFPNASKKNRPTVGDLVYARVCTA-EKELEAEIECFDSTTGRDAG-------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          TNRLDSVLLLSSMNELA-MRGFLQEGDLISAEVQAV-FSDGAVSLHTRSL--------------------
1t9hA1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           KSGPEILAYISGKMRMHYIRIL--PGDRVVVEITPYDPTRGRIVYRK-----------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          IGKLETRLPKKEWIPGEEIK----AGDLVKVYIIDVVKTTKGPKILVS----------------------
1k3rA1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           FDHFEAILAESVKXHXDRYVEYRDKGKTVKVKVIRVDYTKGYIDVNYKRXCRHQ----------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1t3eA1          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           XXXXXXXXXXXXXXXXNLGPVDGLVHRSEITWGRFNHPREVIQKGQKVKAQVLSVDPEKERVNLSIKALI
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1gu9A           ----------------------------------------------------------------------
1t3eA1          ---------------------------------------------TIIKARLSCDVKLDPRPEYHRCILT
1k0rA1          ----------------------------------------------------------------------
1smxA           ----------------------------------------------------------------------
1wfqA           ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ------------------SPYQAFLPVSENPEMKPNKPNEVLDIGDAIIAKVLNIDPKM-KVTLTMKDRI
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ------------------GGKEGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQG-RIRLSIK---
1sroA           ----------------------------------------------------------------------
2oceA4          VLEGVVTNVTNFGAFVDIGVQDGLVHISALSEKFVKDPYEVVKAGDIVKVKVMEVDIPRNRVGLSMRMS-
2oceA4          ----------------------------------------------------------------------
1jjgA           SVHEGIVYFKDGIFKVRLLGYEGECILLDYLNYRQDTLDRLKERGRVIKTRVVRAD--GLYVDLR-----
1jjgA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          ----------------QVGPMKVFVTKHLMPQDLTFSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKE
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ------------------NGAIAFIPAPFLHAVRDEKGETVYKVTDVIDVTIAEVRXETRSIIARPVA--
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ILIATVKQVFDYGSYVSLDELQAFLPWSEVS-----NIRDVLKENRKVIVKVIRVDRRKGTVDVSLK---
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          GHLGKLVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLA---------------------
2ja9A1          ----------------------------------------------------------------------
2ja9A1          ---------------------------YMAFPNASKKNRPTLQVGDLVYARVCTAEKEL-EAEIECFDST
2ja9A1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ------------------SRLDSVLLLSSMNELA---MRGFLQEGDLISAEVQAVFSDG-AVSLHTRSL-
2nn6H1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1t9hA1          --------------------DSDKVIQCRGRG-IFRKNKITPLVGDYVVYQAENDK--EGYLMEIKE---
1t9hA1          ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           --------------------PEILAYIS----GKMRMHYIRILPGDRVVVEITPYDPTRGRIVYR-----
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------RIGKLETRLPKKEW------IPGEEIKAGDLVKVYIIDVVKTTKGPKILVS---
1hh2P1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1k3rA1          -------------------------------------CREKLTVNRIMSFRVVRLGKEI-LIEPDEPED-
1luzA           ------------------PHFEAILAESVKXHXDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRXC
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          -------------------------------------LLSELRIGRNECVVVIRVDKEKGYIDLSKR---
1t3eA1          ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PDPWTTVAEKYPVGTRVRGKVVGLTQFGAFVEVEPGLEGLIHISELSWTKRPKHPSEVVKEGDEVEAVVL
2ba0A1          ---------TPSVGDVVIGIIREVAANGWAVDIYSPYQAFLPVSENPEMKPNKKPNEVLDIGDAIIAKVL
2nn6I1          ------------VGAIVTCKVSSINSRFAKVHILYSFRGTIRKEDVRATKDKVEIYKSFRPGDIVLAKVI
1wi5A           ------SAEALKPGMLLTGTVSSLEDHGYLVDIDGTRAFLPLLKAQEY-IRQKNKGAKLKVGQYLNCIVE
1sroA           ---------EIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIAD-KRVEKVTDYLQMGQEVPVKVL
2oceA4          ---------DLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSE-KFVKDPYEVVKAGDIVKVKVM
1jjgA           ----------------------------------------------------------------------
1d7qA           ---------VFKEDGQEYAQVIKMLGNGRLAMCFDGVKRLCHIRGKLRKK------VWINTSDIILVGLR
1go3E1          ------------MYELIEGEVVDVVEFGSFVRL-GPLDGLIHVSQIMDDYVSKETGKVLEIGDYVRARIV
1y14B1          ------------KGEVVDGTVVSCSQHGFEVQV-GPMKVFVTKHLMPQNASYQSSEDVITIKSRIRVKIE
2id0A1          ------------TDTRFAAEIVDISRGGXRVRLDNGAIAFIPAPFLHAVRDEIKGETVYKVTDVIDVTIA
2ahoB2          --------KLPSEGEILIATVKQVFDYGSYVSLDEGLQAFLPWSEVS------NIRDVLKENRKVIVKVI
2ot2A1          ----------------VPGQIRTIDGNQAKVDV-CGIQRDVDLTLVGS----CDENGQPRVGQWVLVHVS
1bmfD1          ---------------------------------DPNIVGSEHYDVARGVQKILQDYKSLQDIIAILGMD-
2ja9A1          ---------IPSVNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFP-NASKKNRPTLQVGDLVYARVC
2nn6H1          ---------IGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNE----LAMRGFLQEGDLISAEVQ
1t9hA1          ----------------PEGKIIKALSGFYYVLDESEDSDKVIQCRGRG--IFRKNKITPLVGDYVVYQAE
1hr0W           ---------KEKDTIRTEGVVTEALPNATFVKLDSGPEILAYISGKMR-----MHYIRILPGDRVVVEIT
1hh2P1          ------------KGTVTTAEVIRVMGEWADIRI-GKLETRLPKKEWI-------PGEEIKAGDLVKVYII
1k3rA1          --------GKPVTGEYRQGLTVKRVKKGTLVDIGADKLALCR--------------EKLTVNRIMSFRVV
1luzA           ------------AGDVIKGRVY-EKDYALYIYLYPHFEAILAESVKXH-XDRYVEYRDKLVGKTVKVKVI
1kl9A2          --------KFPEVEDVVXVNVRSIAEXGAYVSLLNNIEGXILLSEL-------------RIGRNECVVVI
1gu9A           ----------------------------------------------------------------------
1t3eA1          WHHQEPLP--WAQSTGNQMSLMSMRSANGLLMLPPKTEQYVELH----------------KGEVVDVMVI
1k0rA1          ----------------------------------------------------------------------
1smxA           ----------------------------------------------------------------------
1wfqA           -------PNGTSAALRETGVIEKLLTSYGFIQCSERQARLFHCSQYNGNLQD------LKVGDDVEFEVS
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          CRPI------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          DYLG------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2ja9A1          TGRDAGFGI-------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1k3rA1          -RYW------------------------------------------------------------------
1luzA           RH--------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1t3eA1          ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RLDPEERRLSLGLKQTQPDPWQQLTEKYPPGTVLKGKVTGVTDFGVFVEIEPGIEGLVHVSELDHKRVEN
2ba0A1          NID-PKMKVTLTMKDRICRPIR------------------------------------------------
2nn6I1          SLGDAQSNYLLTTAENELGVVVAHSESGIQMVPISWCEMQCPKTHTKE----------------------
1wi5A           KVKGNGGVVSLSVGHSEVSTAIATEQQSWNLNNLSGPSSG------------------------------
1sroA           EVD-RQGRIRLSIKE-------------------------------------------------------
2oceA4          EVDIPRNRVGLSMRMSDT----------------------------------------------------
1jjgA           --------MTVIKPSSRPRPRKNRTSAMDSPGSVHEGIVYFKDGIFKVRLLGYEGHECILLDYLNYRQDT
1d7qA           DYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFG------------------------------
1go3E1          AISLKASKIALTMRQPYLGKLEWIEEEKAKK---------------------------------------
1y14B1          GCISQVSSIHAIGSIKEDYLG-------------------------------------------------
2id0A1          EVRXETRSIIARPV--------------------------------------------------------
2ahoB2          RVDRRKGTVDVSLKK-------------------------------------------------------
2ot2A1          VINEAEARDTL-------DALQNMFDVEPDVGA-------------------------------------
1bmfD1          ELSEEDKLTVSRARKIQRF----LSQPFQVAEVFTGHLGKLVPLKETIKGQILAGEYDHLPEQAFYMVGP
2ja9A1          TAE-KELEAEIECFDSTTGRDAGF----------------------------------------------
2nn6H1          AVF-SDGAVSLHTRS-------------------------------------------------------
1t9hA1          NDK--EGYLMEIKERT------------------------------------------------------
1hr0W           PYDPTRGRIVY-----------------------------------------------------------
1hh2P1          DVVKTTKGPKILVS--------------------------------------------------------
1k3rA1          RLGK-EILIEPDEPEDRY----------------------------------------------------
1luzA           RVDYTKGYIDVNYKRXCRH---------------------------------------------------
1kl9A2          RVDKEKGYIDLSKRR-------------------------------------------------------
1gu9A           ----------------------------------------------------------------------
1t3eA1          G---------------------------------------------------------------------
1k0rA1          ----------------------------------------------------------------------
1smxA           ----------------------------------------------------------------------
1wfqA           SDRRTGKPIAVKLVK-------------------------------------------------------
2ba0A1          --------------------------TPSVGDVVIGIIREVAANGWAVDIYSPYQAFLPVSENEMKPNKK
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1sroA           --------------------------EIEVGRVYTGKVTRIVDFGAFVAIGGGKEGLVHISQIADKRVEK
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          ------------------------------GEVVDGTVVSCSQHGFEVQV-GPMKVFVTKHLMPNASYQS
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2id0A1          ------------------------------DTRFAAEIVDISRGGXRVRLDNGAIAFIPAPFLHAVRDEK
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2ahoB2          ---------------------YSRSKLPSEGEILIATVKQVFDYGSYVSLDGGLQAFLPWSEVSNIR---
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ja9A1          --------------------------RYIPNDFVIGVIIGTFSDSYKVSLQNFSSSVSLSYMAFPNASKK
2ja9A1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          --------------------------IGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNELAMRG
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1t9hA1          ---------------------------------PEGKIIKALSGFYYVLDESEDSDKVIQCRGRGI-FRK
1t9hA1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1hr0W           --------------------------KEKDTIRTEGVVTEALPNATFVKLDSGPEILAYISGKMRMHYIR
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          --------------------FEKYSEL--KGTVTTAEVIRVMGEWADIRI-GKLETRLPKKEWIPGEE--
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1k3rA1          -------------------------GKPVTGEYRQGLTVKRVKKGTLVDIGADKLALCR-----------
1k3rA1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ------------------------------GDVIKGRVY-EKDYALYIYLFPHFEAILAESVKXHXDRYV
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          -------------------------KFPEVEDVVXVNVRSIAEXGAYVSLLNNIEGXILLSE--------
1kl9A2          ----------------------------------------------------------------------
1t3eA1          ---------------------------WAQSTGNQMSLMSMRSANGLLMLPPKTEQYVELHK--------


                         .         .         +         .         .         .         .:490
query           PAALFKKGDEMEVVVLNIDPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
1jjgA           LDRLKERGRVIKTRVVRAD---------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          IEEAVAKADKLA----------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1gu9A           ----------------------------------------------------------------------
1t3eA1          ----------------------------------------------------------------------
1k0rA1          ----------------------------------------------------------------------
1smxA           ----------------------------------------------------------------------
1wfqA           ----------------------------------------------------------------------
2ba0A1          PNEVLDIGDAIIAKVLNIDP--------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2ba0A1          ----------------------------------------------------------------------
2nn6I1          ----------------------------------------------------------------------
1wi5A           ----------------------------------------------------------------------
1sroA           VTDYLQMGQEVPVKVLEVDR--------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
1sroA           ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
2oceA4          ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1jjgA           ----------------------------------------------------------------------
1d7qA           ----------------------------------------------------------------------
1go3E1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          SEDVITIKSRIRVKIEGCIS--------------------------------------------------
1y14B1          ----------------------------------------------------------------------
1y14B1          ----------------------------------------------------------------------
2id0A1          GETVYKVTDVIDVTIAEVR---------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2id0A1          ----------------------------------------------------------------------
2ahoB2          --DVLKENRKVIVKVIRVD---------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ahoB2          ----------------------------------------------------------------------
2ot2A1          ----------------------------------------------------------------------
1bmfD1          ----------------------------------------------------------------------
2ja9A1          NRPTLQVGDLVYARVCTAEK--------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2ja9A1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ---FLQEGDLISAEVQAVFS--------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
2nn6H1          ----------------------------------------------------------------------
1t9hA1          NKITPLVGDYVVYQAENDK---------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1t9hA1          ----------------------------------------------------------------------
1hr0W           ----ILPGDRVVVEITPYDP--------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hr0W           ----------------------------------------------------------------------
1hh2P1          ----IKAGDLVKVYIIDVVK--------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1hh2P1          ----------------------------------------------------------------------
1k3rA1          --EKLTVNRIMSFRVVRLGK--------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1k3rA1          ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           EYRDKLVGKTVKVKVIRVDY--------------------------------------------------
1luzA           ----------------------------------------------------------------------
1luzA           ----------------------------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1kl9A2          ----LRIGRNECVVVIRVDK--------------------------------------------------
1kl9A2          ----------------------------------------------------------------------
1t3eA1          -------GEVVDVMVIG-----------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2ba0A1          ----------------------------------------------
2nn6I1          ----------------------------------------------
1wi5A           ----------------------------------------------
1sroA           ----------------------------------------------
2oceA4          ----------------------------------------------
1jjgA           ----------------------------------------------
1d7qA           ----------------------------------------------
1go3E1          ----------------------------------------------
1y14B1          ----------------------------------------------
2id0A1          ----------------------------------------------
2ahoB2          ----------------------------------------------
2ot2A1          ----------------------------------------------
1bmfD1          ----------------------------------------------
2ja9A1          ----------------------------------------------
2nn6H1          ----------------------------------------------
1t9hA1          ----------------------------------------------
1hr0W           ----------------------------------------------
1hh2P1          ----------------------------------------------
1k3rA1          ----------------------------------------------
1luzA           ----------------------------------------------
1kl9A2          ----------------------------------------------
1gu9A           ----------------------------------------------
1t3eA1          ----------------------------------------------
1k0rA1          ----------------------------------------------
1smxA           ----------------------------------------------
1wfqA           ----------------------------------------------
2ba0A1          ----------------------------------------------
2ba0A1          ----------------------------------------------
2ba0A1          ----------------------------------------------
2ba0A1          ----------------------------------------------
2nn6I1          ----------------------------------------------
1wi5A           ----------------------------------------------
1sroA           ----------------------------------------------
1sroA           ----------------------------------------------
1sroA           ----------------------------------------------
1sroA           ----------------------------------------------
2oceA4          ----------------------------------------------
2oceA4          ----------------------------------------------
1jjgA           ----------------------------------------------
1jjgA           ----------------------------------------------
1d7qA           ----------------------------------------------
1go3E1          ----------------------------------------------
1y14B1          ----------------------------------------------
1y14B1          ----------------------------------------------
1y14B1          ----------------------------------------------
1y14B1          ----------------------------------------------
2id0A1          ----------------------------------------------
2id0A1          ----------------------------------------------
2id0A1          ----------------------------------------------
2id0A1          ----------------------------------------------
2ahoB2          ----------------------------------------------
2ahoB2          ----------------------------------------------
2ahoB2          ----------------------------------------------
2ahoB2          ----------------------------------------------
2ot2A1          ----------------------------------------------
1bmfD1          ----------------------------------------------
2ja9A1          ----------------------------------------------
2ja9A1          ----------------------------------------------
2ja9A1          ----------------------------------------------
2nn6H1          ----------------------------------------------
2nn6H1          ----------------------------------------------
2nn6H1          ----------------------------------------------
2nn6H1          ----------------------------------------------
1t9hA1          ----------------------------------------------
1t9hA1          ----------------------------------------------
1t9hA1          ----------------------------------------------
1hr0W           ----------------------------------------------
1hr0W           ----------------------------------------------
1hr0W           ----------------------------------------------
1hr0W           ----------------------------------------------
1hh2P1          ----------------------------------------------
1hh2P1          ----------------------------------------------
1hh2P1          ----------------------------------------------
1hh2P1          ----------------------------------------------
1k3rA1          ----------------------------------------------
1k3rA1          ----------------------------------------------
1k3rA1          ----------------------------------------------
1luzA           ----------------------------------------------
1luzA           ----------------------------------------------
1luzA           ----------------------------------------------
1luzA           ----------------------------------------------
1kl9A2          ----------------------------------------------
1kl9A2          ----------------------------------------------
1kl9A2          ----------------------------------------------
1t3eA1          ----------------------------------------------