[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for tthe0:AAS82289.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1fm0E.bssp"
#ERROR : Can't open dsspfile "1g3pA2.bssp"
#ERROR : Can't open dsspfile "1vjkA.bssp"
#ERROR : Can't open dsspfile "2hj1A1.bssp"
#ERROR : Can't open dsspfile "1fm0D.bssp"
#ERROR : Can't open dsspfile "1wgkA.bssp"
#ERROR : Can't open dsspfile "1rwsA.bssp"
#ERROR : Can't open dsspfile "1v8cA1.bssp"
#ERROR : Can't open dsspfile "1zud21.bssp"
#ERROR : Can't open dsspfile "1wxqA2.bssp"
#ERROR : Can't open dsspfile "1tygB.bssp"
#ERROR : Can't open dsspfile "1qf6A2.bssp"

## Summary of PDB Search
:223
    6e-33  42%  1fm0E  [d.41.5.1] MOLYBDOPTERIN CONVERTIN FACTOR, SUBUNIT 2
    1e-30  11%  1g3pA2 [b.37.1.1] MINOR COAT PROTEIN A:91 -- 217
    2e-17  37%  1vjkA  [d.15.3.1] MOLYBDOPTERIN CONVERTING FACTOR, SUBUNIT 1
    1e-16  22%  2hj1A1 [d.15.3.4] HYPOTHETICAL PROTEIN A:11 -- 87
    7e-16  42%  1fm0D  [d.15.3.1] MOLYBDOPTERIN CONVERTIN FACTOR, SUBUNIT 1
    2e-14  16%  1wgkA  [d.15.3.3] RIKEN CDNA 2900073H19 PROTEIN
    5e-12  35%  1rwsA  [d.15.3.2] HYPOTHETICAL PROTEIN PF1061
    2e-11  34%  1v8cA1 [d.15.3.1] MOAD RELATED PROTEIN A:1 -- 87
    7e-09  21%  1zud21 [d.15.3.2] THIS PROTEIN 2:2 -- 66
    3e-06  16%  1wxqA2 [d.15.10.2] GTP-BINDING PROTEIN A:320 -- 395
    2e-05  15%  1tygB  [d.15.3.2] YJBS
    1e-04  14%  1qf6A2 [d.15.10.1] THREONYL-TRNA SYNTHETASE A:2 -- 62
:223

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MRIEVRLFALYREQAGTDRLALELPEGARVREAQKALEERFPGLRLEGGMAAVNQALAGAETPLKEGDEV
1fm0E           ----------------------------------------------------------------------
1g3pA2          ---------------------------------------------------------IPGYTYINP-LDG
1vjkA           VKVKVKYFARFRQLAGVDEEEIELPEGARVRDLIEEIKKRHEKFKDADVNIAVNGRYVSWDEELKDGDVV
2hj1A1          INIEIAYAFPERYYLKS----FQVDEGITVQTAITQSGILFPEIDLSTNKIGIFSRPIKLTDVLKEGDRI
1fm0D           --IKVLFFAQVRELVGTDATEVAAD-FPTVEALRQHMAAQSDRWALEDGLAAVNQTLVSFDHPLTDGDEV
1wgkA           LCVKVEFGGGAELLFDGVKKHQVAEEPWDIRNLLVWIKKNLLKERPELFLVLINDALGELDYQLQDQDSI
1rwsA           --IKVKVIGRNIEKE------IEWREGMKVRDILRAV-----GFNTESAIAKVNGKVVLEDDEVKDGDFV
1v8cA1          ---KVNLYATFRDLTGKSQLELP---GATVGEVLENLVRAYPALKAERVSVFLEGRDVGLSTPLSPGATL
1zud21          ---------------------MQCAAGQTVHELLEQLDQRQAGAALAINQQ-IVPREQWAQHIVQDGDQI
1wxqA2          ----IPVYPVHDEQFGLPH-VFLXKKGSTPRDLAFKVHTDL-GKGFLYAINARTKRRVGEDYELQFNDIV
1tygB           --------------------DVKWKKDTGTIQDLLA----SYQLENKIVIVERNKEIRYHEVELCDRDVI
1qf6A2          ---------------------RHYDHAVSPMDVALDI---GPGLAKACIAGRVNGELVDACDLIENDAQL


                         .         .         *         .         .         .         .:140
query           AFLPPVSGGQDSYGLTQEPLDLEALVAWATAPEYGAVVSFLGTTRSPNRGEEVAFLEYEAYPEMAEKVMA
1fm0E           --------------VGPQPFSVGEEYPWAERDEDGAVVTFTGKVR-------VNALTLEHYPGMTEKALA
1g3pA2          TYPPGTEQNPNPSLEESQPLNTFMFQNNRFRNRQGALTVYTGTVTQGTDPVKT----YYQYTPVSSKAMY
1vjkA           GVFPPV----------------------------------------------------------------
2hj1A1          EIYRPL----------------------------------------------------------------
1fm0D           AFFPPVTGG-------------------------------------------------------------
1wgkA           LFISTLHGGS------------------------------------------------------------
1rwsA           EVIPVVSGG-------------------------------------------------------------
1v8cA1          DLFPPVAGG-------------------------------------------------------------
1zud21          LLFQVIAGG-------------------------------------------------------------
1wxqA2          KIV-------------------------------------------------------------------
1tygB           EIVHFVGG--------------------------------------------------------------
1qf6A2          SII-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           EILAEMRARWPLGRIALWHRLGRVDPGEASIAIVVSARHRKEAFAACQYAIDRVKQILPVWKKEHRKDGS
1fm0E           EIVDEARNRWPLGRVTVIHRIGELWPGDEIVFVGVTSAHRSSAFEAGQFIMDYLKTRAPFWKREATPEGD
1g3pA2          DA--YWNGKFRDCAFHSGFNEDIFVCE-----------YQGQSSDLPQPPVN------------------
1vjkA           ----------------------------------------------------------------------
2hj1A1          ----------------------------------------------------------------------
1fm0D           ----------------------------------------------------------------------
1wgkA           ----------------------------------------------------------------------
1rwsA           ----------------------------------------------------------------------
1v8cA1          ----------------------------------------------------------------------
1zud21          ----------------------------------------------------------------------
1wxqA2          ----------------------------------------------------------------------
1tygB           ----------------------------------------------------------------------
1qf6A2          ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           FWVExxxxxxxxx
1fm0E           RWVE---------
1g3pA2          -------------
1vjkA           -------------
2hj1A1          -------------
1fm0D           -------------
1wgkA           -------------
1rwsA           -------------
1v8cA1          -------------
1zud21          -------------
1wxqA2          -------------
1tygB           -------------
1qf6A2          -------------