BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAK87211.2 atum0 metF.1 GIB00072CH01 "methylenetetrahydrofolate
reductase"
         (306 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

MTHR_HUMAN RecName: Full=Methylenetetrahydrofolate reductase;   ...    39   5e-05
MTHR_MOUSE RecName: Full=Methylenetetrahydrofolate reductase;   ...    38   1e-04
MTHR_MACFA RecName: Full=Methylenetetrahydrofolate reductase;   ...    38   1e-04
MTHR_BOVIN RecName: Full=Methylenetetrahydrofolate reductase;   ...    38   1e-04

>MTHR_HUMAN RecName: Full=Methylenetetrahydrofolate reductase;      
             EC=1.5.1.20;
          Length = 656

 Score = 39.3 bits (90), Expect = 5e-05
 Identities = 38/162 (23%), Positives = 70/162 (43%), Gaps = 33/162 (20%)

Query: 112 LGGGQKQPAGSFSSSIDMIETGLFDKMGFTHLHLAGHPEGNRDIDS-DGSSRGVDQALLW 170
           +G   ++  G F+ ++D+++    +   +  + +AG+P+G+ +  S +   + + + +  
Sbjct: 161 IGDQWEEEEGGFNYAVDLVKHIRSEFGDYFDICVAGYPKGHPEAGSFEADLKHLKEKVSA 220

Query: 171 KQDFASRTDARLALTTQFAFEAKVVIEWAKRIGNMGVTIPVHVG---IAGPTKLQTLIKF 227
             DF         + TQ  FEA     + K   +MG+T P+  G   I G   L+ L+K 
Sbjct: 221 GADF---------IITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQGYHSLRQLVK- 270

Query: 228 AIACGVGPSLKVLQKRALDLSRLFVPYEPTDFIAELIDHKAA 269
                              LS+L VP E  D I  + D+ AA
Sbjct: 271 -------------------LSKLEVPQEIKDVIEPIKDNDAA 293


>MTHR_MOUSE RecName: Full=Methylenetetrahydrofolate reductase;      
             EC=1.5.1.20;
          Length = 654

 Score = 38.1 bits (87), Expect = 1e-04
 Identities = 37/153 (24%), Positives = 65/153 (42%), Gaps = 33/153 (21%)

Query: 121 GSFSSSIDMIETGLFDKMGFTHLHLAGHPEGNRDIDS-DGSSRGVDQALLWKQDFASRTD 179
           G FS + D+++    +   +  + +AG+P G+ D +S +   + + + +    DF     
Sbjct: 169 GGFSYATDLVKHIRTEFADYFDICVAGYPRGHPDAESFEDDLKHLKEKVSAGADF----- 223

Query: 180 ARLALTTQFAFEAKVVIEWAKRIGNMGVTIPVHVG---IAGPTKLQTLIKFAIACGVGPS 236
               + TQ  FEA     + K    +G++ P+  G   I G T L+ L+K          
Sbjct: 224 ----IITQLFFEASTFFSFVKACTEIGISCPILPGIFPIQGYTSLRQLVK---------- 269

Query: 237 LKVLQKRALDLSRLFVPYEPTDFIAELIDHKAA 269
                     LS+L VP +  D I  + D+ AA
Sbjct: 270 ----------LSKLEVPQKIKDVIEPIKDNDAA 292


>MTHR_MACFA RecName: Full=Methylenetetrahydrofolate reductase;      
             EC=1.5.1.20;
          Length = 656

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 38/162 (23%), Positives = 69/162 (42%), Gaps = 33/162 (20%)

Query: 112 LGGGQKQPAGSFSSSIDMIETGLFDKMGFTHLHLAGHPEGNRDIDS-DGSSRGVDQALLW 170
           +G   ++  G F+ ++D+++    +   +  L +AG+P+G+ +  S +   + + + +  
Sbjct: 161 IGDQWEEEEGGFNYAVDLVKHIRSEFGDYFDLCVAGYPKGHPEAGSFEADLKHLKEKVSA 220

Query: 171 KQDFASRTDARLALTTQFAFEAKVVIEWAKRIGNMGVTIPVHVG---IAGPTKLQTLIKF 227
             DF         + TQ  FEA     + K   +MG+T P+  G   I G   L+ L+K 
Sbjct: 221 GADF---------IITQLFFEADTFFRFVKACTDMGITCPIVPGIFPIQGYHSLRQLVK- 270

Query: 228 AIACGVGPSLKVLQKRALDLSRLFVPYEPTDFIAELIDHKAA 269
                               S+L VP E  D I  + D+ AA
Sbjct: 271 -------------------QSKLEVPQEIKDVIEPIKDNDAA 293


>MTHR_BOVIN RecName: Full=Methylenetetrahydrofolate reductase;      
             EC=1.5.1.20;
          Length = 655

 Score = 37.7 bits (86), Expect = 1e-04
 Identities = 41/161 (25%), Positives = 70/161 (43%), Gaps = 31/161 (19%)

Query: 112 LGGGQKQPAGSFSSSIDMIETGLFDKMGFTHLHLAGHPEGNRDIDSDGSSRGVDQALLWK 171
           +G   ++  G F+ + D+++    +   +  + +AG+P+G+     +G S   D   L K
Sbjct: 160 IGDQWEEEEGGFNYATDLVKHIRNEFGDYFDVCVAGYPKGH----PEGESFEADLKHL-K 214

Query: 172 QDFASRTDARLALTTQFAFEAKVVIEWAKRIGNMGVTIPVHVG---IAGPTKLQTLIKFA 228
           +  A+  D    + TQ  FEA+    + K    +G+T PV  G   I G   L+ L+K  
Sbjct: 215 EKVAAGADF---IITQLFFEAETFFRFVKACSEIGITCPVLPGIFPIQGYHSLRQLVK-- 269

Query: 229 IACGVGPSLKVLQKRALDLSRLFVPYEPTDFIAELIDHKAA 269
                             LS+L VP +  D I  + D+ AA
Sbjct: 270 ------------------LSKLEVPQQIKDVIEPIKDNDAA 292


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.323    0.140    0.441 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 8,598,753,931
Number of extensions: 348377747
Number of successful extensions: 894323
Number of sequences better than 1.0e-03: 19550
Number of HSP's gapped: 873701
Number of HSP's successfully gapped: 24521
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)