BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= AAQ81509.1 bp441 30.2 AY375531 "hypothetical protein"
         (234 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1l6rA [c.108.1] HYPOTHETICAL PROTEIN TA0175                            36   1e-04

>1l6rA [c.108.1] HYPOTHETICAL PROTEIN TA0175
          Length = 225

 Score = 36.2 bits (82), Expect = 1e-04
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 14/110 (12%)

Query: 8   ILTDVDGVLVQWTS--GLPYFAQKNGIRTDEILKTLVDERFRTGEELFGVNGRIADILMR 65
           I+ D DG + ++ S  G   F ++   RT   +++++  R+R     F ++    D + +
Sbjct: 70  IMFDNDGSIKKFFSNEGTNKFLEEMSKRTS--MRSILTNRWREASTGFDIDPEDVDYVRK 127

Query: 66  EYNNSDFIKYLAGY--------VDAIDVVNRLKEHY--DFIAITALGDSN 105
           E  +  F+ + +GY         D    VN+LKE Y  ++  I  +GDSN
Sbjct: 128 EAESRGFVIFYSGYSWHLMNRGEDKAFAVNKLKEMYSLEYDEILVIGDSN 177


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.321    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 768,003,233
Number of extensions: 32417154
Number of successful extensions: 72386
Number of sequences better than 1.0e-03: 684
Number of HSP's gapped: 71831
Number of HSP's successfully gapped: 694
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.9 bits)