RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= AAQ81341.1 bp441 dda AY375531 "DNA helicase"
         (439 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3e1sA [x.x.x] EXODEOXYRIBONUCLEASE V, SUBUNIT RECD                     49   2e-08
3dmnA [x.x.x] PUTATIVE DNA HELICASE                                    37   9e-05

>3e1sA [x.x.x] EXODEOXYRIBONUCLEASE V, SUBUNIT RECD
          Length = 517

 Score = 49.4 bits (116), Expect = 2e-08
 Identities = 26/91 (28%), Positives = 38/91 (41%), Gaps = 7/91 (7%)

Query: 57  IVLAAPTHQAKKELSKHALRKAYTIQSLLKINPSTLEENQIFEQKGTPDFSKIRVLICDE 116
           + L APT +A + L +   R A T+  LL   P     N +             +LI DE
Sbjct: 181 VGLCAPTGKAARRLGEVTGRTASTVHRLLGYGPQGFRHNHLEPAP-------YDLLIVDE 233

Query: 117 VSFYTRKLFNILMKTVPSHCVIIGIGDKAQI 147
           VS     L   L+  VP    ++ +GD  Q+
Sbjct: 234 VSMMGDALMLSLLAAVPPGARVLLVGDTDQL 264


>3dmnA [x.x.x] PUTATIVE DNA HELICASE
          Length = 159

 Score = 37.2 bits (85), Expect = 9e-05
 Identities = 8/65 (12%), Positives = 21/65 (32%), Gaps = 2/65 (3%)

Query: 372 WKDFWAIKNTFTKVRPLGAMTFHKSQGSTFKNAYLFTPCLHSYCRDPDVAQELIYVGNTR 431
            +    I+        +  +    ++G  F    +     +      +  ++L+Y   +R
Sbjct: 74  GEQVTLIQTENRLAPGVIVVPSFLAKGLEFDAVIV--WNANQENYQREDERQLLYTICSR 131

Query: 432 ARENV 436
           A E  
Sbjct: 132 AHELT 136


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.318    0.137    0.415 

Gapped
Lambda     K      H
   0.267   0.0471    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 12,355,113
Number of extensions: 734539
Number of successful extensions: 7108
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 2880
Number of HSP's successfully gapped: 49
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.2 bits)