# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/hmmpfm_19785.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       NP_150137.1  [L=63]
Description: bpsp3 orf4 NC_003050 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
       0.12   15.0   0.0       0.13   14.9   0.0    1.1  1  PF06153  Protein of unknown function (DUF970)
        3.1    9.2   0.0        3.4    9.1   0.0    1.0  1  PF00248  Aldo/keto reductase family
        4.8    9.9   0.0          5    9.8   0.0    1.1  1  PF11388  Phagosome trafficking protein DotA
         12    8.5   0.0         22    7.7   0.0    1.5  1  PF02142  MGS-like domain
         18    7.8   0.1         38    6.8   0.0    1.5  1  PF01253  Translation initiation factor SUI1
         25    7.3   0.0         39    6.7   0.0    1.3  1  PF04509  CheC-like family
         27    7.3   0.0         32    7.1   0.0    1.2  1  PF11341  Protein of unknown function (DUF3143)
         30    7.1   0.0         27    7.2   0.0    1.2  1  PF11948  Protein of unknown function (DUF3465)
         36    6.5   0.1         37    6.4   0.0    1.2  1  PF04947  Poxvirus Late Transcription Factor VLTF3 like
         37    6.4   0.0         54    5.9   0.0    1.3  1  PF04366  Family of unknown function (DUF500)
         39    5.4   0.0         37    5.5   0.0    1.0  1  PF02898  Nitric oxide synthase, oxygenase domain
         54    5.7   0.0         58    5.6   0.0    1.1  1  PF11578  Protein of unknown function (DUF3237)
         57    5.6   0.0         66    5.4   0.0    1.1  1  PF10339  Velum formation protein
         71    6.0   0.0         95    5.6   0.0    1.2  1  PF07578  Lipid A Biosynthesis N-terminal domain
         80    5.5   0.0         81    5.5   0.0    1.1  1  PF12385  Papain-like cysteine protease AvrRpt2
         83    5.5   0.0    1.5e+02    4.7   0.0    1.4  1  PF07671  Protein of unknown function (DUF1601)
    1.1e+02    4.9   0.0      2e+02    4.1   0.0    1.4  1  PF08038  TOM7 family
    1.7e+02    5.0   0.1    2.7e+02    4.4   0.1    1.4  1  PF11532  Heterogeneous nuclear ribonucleoprotein M
    2.8e+02    3.4   0.0    2.8e+02    3.4   0.0    1.1  1  PF12334  Rickettsia outer membrane protein B
    2.8e+02    4.5   0.4    6.5e+02    3.4   0.0    1.8  1  PF08257  Sulfakinin family
    3.6e+02    3.4   0.0    3.6e+02    3.4   0.0    1.1  1  PF01928  CYTH domain
    1.5e+03    2.2   0.0    2.3e+03    1.5   0.0    1.2  1  PF04680  Opioid growth factor receptor repeat
    2.1e+03    1.5   0.4    4.1e+03    0.6   0.3    1.4  1  PF00357  Integrin alpha cytoplasmic region


Domain and alignment annotation for each model:
>> PF06153  Protein of unknown function (DUF970)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.9   0.0   2.9e-05      0.13      14      50 ..       9      45 ..       4      62 .. 0.81

  Alignments for each domain:
  == domain 1    score: 14.9 bits;  conditional E-value: 2.9e-05
      PF06153 14 eelvkaLtekgfrvtklastGGflkeGnttlliGved 50
                 e++ + L++kg + t la + Gf ++  t +l G+ +
  NP_150137.1  9 EKVNDFLKDKGIKKTSLAIAYGFKRQEVTNILSGTTK 45
                 678999****************************876 PP

>> PF00248  Aldo/keto reductase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.1   0.0   0.00079       3.4     220     256 ..       9      45 ..       4      56 .. 0.89

  Alignments for each domain:
  == domain 1    score: 9.1 bits;  conditional E-value: 0.00079
      PF00248 220 eelselakehgvsiaqlalryalsrpavgvvipgass 256
                  e+++++ k++g++   la++y ++r+ v+ ++ g+++
  NP_150137.1   9 EKVNDFLKDKGIKKTSLAIAYGFKRQEVTNILSGTTK 45 
                  789999***********************99999998 PP

>> PF11388  Phagosome trafficking protein DotA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.8   0.0    0.0012         5      56     101 ..      15      62 ..       5      63 .] 0.84

  Alignments for each domain:
  == domain 1    score: 9.8 bits;  conditional E-value: 0.0012
      PF11388  56 lsqdgvkqpdls..ddpkrasvegplsstvygfvnnsmmvqlpgqpgi 101
                  l + g+k+  l+     kr+ v   ls t  g   ns+++q+  + gi
  NP_150137.1  15 LKDKGIKKTSLAiaYGFKRQEVTNILSGTTKGPRANSFILQVIEDYGI 62 
                  66779999887621567************************9888887 PP

>> PF02142  MGS-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.7   0.0     0.005        22      45      91 ..       4      62 ..       1      63 [] 0.62

  Alignments for each domain:
  == domain 1    score: 7.7 bits;  conditional E-value: 0.005
                 B-B..BHHHHHHHHHT-S.............EEEEE--SCHHHHH.HHHHHHHHHHHTT- CS
      PF02142 45 rlggrvsildlikegeid.............lvintlypfkatvakdgykirraaenidi 91
                 +++gr ++ d +k+++i+              v n+l++ ++ ++ ++  i +++e+++i
  NP_150137.1  4 ITNGREKVNDFLKDKGIKktslaiaygfkrqEVTNILSGTTKGPR-ANSFILQVIEDYGI 62
                 566777777777777777766555555555556666666666665.66667777777766 PP

>> PF01253  Translation initiation factor SUI1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0    0.0086        38      67      81 ..       8      22 ..       5      24 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.0086
      PF01253 67 rdkvkefLeekgilp 81
                 r+kv++fL++kgi++
  NP_150137.1  8 REKVNDFLKDKGIKK 22
                 99**********997 PP

>> PF04509  CheC-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.7   0.0     0.009        39       7      16 ..      34      43 ..      34      45 .. 0.89

  Alignments for each domain:
  == domain 1    score: 6.7 bits;  conditional E-value: 0.009
                 HH-------- CS
      PF04509  7 gEigNIlaGs 16
                 +E++NIl+G 
  NP_150137.1 34 QEVTNILSGT 43
                 7*******96 PP

>> PF11341  Protein of unknown function (DUF3143)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.1   0.0    0.0075        32      38      60 ..      18      40 ..       9      43 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.1 bits;  conditional E-value: 0.0075
      PF11341 38 sgeqdtqrsFpYsLsReDvEaAi 60
                 +g ++t+++  Y+  R++v + +
  NP_150137.1 18 KGIKKTSLAIAYGFKRQEVTNIL 40
                 34489999***********9865 PP

>> PF11948  Protein of unknown function (DUF3465)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0    0.0062        27      42      67 ..      33      58 ..       5      63 .] 0.81

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0062
      PF11948 42 eGtvvkilpddnegsrhqkfilrlss 67
                 + +v+ il+  ++g r   fil++ +
  NP_150137.1 33 RQEVTNILSGTTKGPRANSFILQVIE 58
                 5689******************9865 PP

>> PF04947  Poxvirus Late Transcription Factor VLTF3 like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0    0.0086        37      56      71 ..       8      23 ..       3      45 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.0086
      PF04947 56 kakvlkfLKelgysky 71
                 ++kv +fLK++g++k+
  NP_150137.1  8 REKVNDFLKDKGIKKT 23
                 689*********9985 PP

>> PF04366  Family of unknown function (DUF500)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.012        54      95     125 ..      28      59 ..      20      60 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.012
      PF04366  95 fYg.rkvtvkdIlkgeveappaakkLlevlkk 125
                   Yg ++ +v++Il+g ++ p+a + +l+v+++
  NP_150137.1  28 AYGfKRQEVTNILSGTTKGPRANSFILQVIED 59 
                  6999999************9999999998876 PP

>> PF02898  Nitric oxide synthase, oxygenase domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0    0.0086        37     274     304 ..       9      39 ..       4      59 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.0086
                  TSGGG-HHHHHHHHHHHHHHHHHHHTT--EB CS
      PF02898 274 rklsslwkdkalveinvavlhsfqkekvtiv 304
                  +k+  + kdk + +  +a+ + f++++vt +
  NP_150137.1   9 EKVNDFLKDKGIKKTSLAIAYGFKRQEVTNI 39 
                  5667789*********************954 PP

>> PF11578  Protein of unknown function (DUF3237)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.013        58      26      53 ..      33      60 ..      16      62 .. 0.83

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.013
                 -EEEE-EEE-EEE-------B-----EE CS
      PF11578 26 srqvvpitgGtvegprlkGevlpgGaDw 53
                 ++ v +i +Gt +gpr +  +l++  D+
  NP_150137.1 33 RQEVTNILSGTTKGPRANSFILQVIEDY 60
                 5678999*********999999887776 PP

>> PF10339  Velum formation protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.015        66      16      42 ..      33      59 ..      21      62 .. 0.79

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.015
      PF10339 16 rfdltdlecsrlrgphcgtyllkvvgt 42
                 r ++t++     +gp   +++l+v+ +
  NP_150137.1 33 RQEVTNILSGTTKGPRANSFILQVIED 59
                 66899999****************965 PP

>> PF07578  Lipid A Biosynthesis N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.022        95      41      58 ..      24      41 ..      19      45 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.022
      PF07578 41 llllvyfliksdpvvill 58
                 +l+++y++ ++++ +il+
  NP_150137.1 24 SLAIAYGFKRQEVTNILS 41
                 799*************97 PP

>> PF12385  Papain-like cysteine protease AvrRpt2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.019        81      67     106 ..       2      41 ..       1      56 [. 0.87

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.019
      PF12385  67 PkglqdrsdverlirkekLkevdlPesksftaeelaalLs 106
                  P+  ++r++v+++++ +++k+ +l  +  f+ +e++++Ls
  NP_150137.1   2 PDITNGREKVNDFLKDKGIKKTSLAIAYGFKRQEVTNILS 41 
                  6667899*******************************96 PP

>> PF07671  Protein of unknown function (DUF1601)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.034   1.5e+02      28      37 .]      31      40 ..      28      40 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.034
      PF07671 28 FNpQsIANtL 37
                 F+ Q+++N+L
  NP_150137.1 31 FKRQEVTNIL 40
                 888*****98 PP

>> PF08038  TOM7 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.046     2e+02       7      19 ..      19      31 ..      16      31 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.046
      PF08038  7 vlkvskvaihYGF 19
                  +k++  ai YGF
  NP_150137.1 19 GIKKTSLAIAYGF 31
                 5899********9 PP

>> PF11532  Heterogeneous nuclear ribonucleoprotein M
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.1     0.062   2.7e+02       6      18 ..      12      24 ..       7      25 .. 0.80

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.062
      PF11532  6 nekRKEkgiKrgg 18
                 n+  K kgiK+ +
  NP_150137.1 12 NDFLKDKGIKKTS 24
                 66679******54 PP

>> PF12334  Rickettsia outer membrane protein B
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0     0.064   2.8e+02      44      59 ..      37      52 ..      19      61 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.064
      PF12334 44 tnivsGtvgGqqgnkl 59
                 tni+sGt  G ++n +
  NP_150137.1 37 TNILSGTTKGPRANSF 52
                 99******99999977 PP

>> PF08257  Sulfakinin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.15   6.5e+02       2       5 ..      58      61 ..      57      62 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.15
      PF08257  2 dDYG 5 
                 +DYG
  NP_150137.1 58 EDYG 61
                 9**9 PP

>> PF01928  CYTH domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0     0.083   3.6e+02      68      96 ..      14      48 ..       5      62 .. 0.69

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.083
                 EEEEEB-STTEEEEEEEESHHCHCCCHH......S CS
      PF01928 68 tlKgpgvdgereevegevsreEyeapls......e 96
                 +lK +g  +++  ++  ++r+E++++ls      +
  NP_150137.1 14 FLKDKGIKKTSLAIAYGFKRQEVTNILSgttkgpR 48
                 5677765555788899999******9997755441 PP

>> PF04680  Opioid growth factor receptor repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.54   2.3e+03       5      10 ..      44      49 ..      44      50 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.54
      PF04680  5 TLGPRA 10
                 T GPRA
  NP_150137.1 44 TKGPRA 49
                 67***9 PP

>> PF00357  Integrin alpha cytoplasmic region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.3      0.94   4.1e+03       5       8 ..      31      34 ..      31      34 .. 0.91

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.94
                 CCCH CS
      PF00357  5 FKRk 8 
                 FKR+
  NP_150137.1 31 FKRQ 34
                 ***7 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (63 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       309  (0.0259402); expected 238.2 (0.02)
Passed bias filter:                      299  (0.0251007); expected 238.2 (0.02)
Passed Vit filter:                        23  (0.00193083); expected 11.9 (0.001)
Passed Fwd filter:                        23  (0.00193083); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              23  [number of targets reported over threshold]
# CPU time: 0.11u 0.04s 00:00:00.15 Elapsed: 00:00:00
# Mc/sec: 1236.46
//