BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= CAB13610.1 bsub0 aprX GIB00011CH01 "alkaline serine protease"
         (442 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1y4dE [x.x.x] SUBTILISIN BPN'                                         130   7e-33
1supA [c.41.1 (1sbnE)] SUBTILISIN BPN'                                130   7e-33
2sniE [c.41.1] SUBTILISIN NOVO                                        130   7e-33
1s02A [x.x.x] SUBTILISIN BPN'                                         130   7e-33
1lw6E [c.41.1] SUBTILISIN BPN'                                        129   1e-32
1suaA [c.41.1] SUBTILISIN BPN'                                        127   5e-32
1sueA [x.x.x] SUBTILISIN BPN'                                         127   6e-32
1sbiA [x.x.x] SUBTILISIN 8397                                         126   1e-31
1s01A [x.x.x] SUBTILISIN BPN'                                         126   1e-31
1sbtA [x.x.x] SUBTILISIN BPN'                                         125   2e-31
1subA [x.x.x] SUBTILISIN BPN' CRB-S3                                  125   2e-31
1spbS [c.41.1] SUBTILISIN BPN'                                        124   4e-31
1v5iA [c.41.1 (1ubnA)] SUBTILISIN BPN'                                124   5e-31
1duiA [c.41.1] PROTEIN (SUBTILISIN BPN')                              124   5e-31
1sbhA [x.x.x] SUBTILISIN 8397+1                                       124   7e-31
1sudA [x.x.x] SUBTILISIN BPN' CRB-S3                                  123   9e-31
1ak9A [x.x.x] SUBTILISIN 8321                                         123   9e-31
1aqnA [x.x.x] SUBTILISIN 8324                                         122   2e-30
1gnvA [c.41.1] SUBTILISIN BPN'                                        121   4e-30
1bh6A [c.41.1] SUBTILISIN DY                                          120   1e-29
1a2qA [x.x.x] SUBTILISIN BPN'                                         119   2e-29
1q5pA [c.41.1] SERINE PROTEASE                                        118   3e-29
1gnsA [c.41.1] SUBTILISIN BPN'                                        118   4e-29
1st2A [x.x.x] SUBTILISIN BPN'                                         116   1e-28
1st3A [x.x.x] SUBTILISIN BL                                           114   7e-28
1dbiA [c.41.1] AK.1 SERINE PROTEASE                                   111   5e-27
1nduA [c.41.1] SUBTILISIN SAVINASE                                    107   7e-26
1sucA [x.x.x] SUBTILISIN BPN' CRB-S3                                  105   3e-25
3f49S [x.x.x] SUBTILISIN BPN'                                         104   6e-25
3cnqS [x.x.x] SUBTILISIN BPN'                                         103   1e-24
3bgoS [x.x.x] SUBTILISIN BPN'                                         103   1e-24
1meeA [c.41.1] MESENTERICOPEPTIDASE                                   102   2e-24
2tecE [c.41.1] THERMITASE                                             100   1e-23
1scjA [c.41.1] SUBTILISIN E                                           100   1e-23
1c9mA [c.41.1] SERINE PROTEASE                                         99   2e-23
2ixtB [x.x.x] 36KDA PROTEASE                                           99   2e-23
2ixtA [x.x.x] 36KDA PROTEASE                                           99   2e-23
1wsdA [c.41.1] M-PROTEASE                                              98   4e-23
1wmdA [c.41.1 - b.18.1] PROTEASE                                       98   4e-23
1gciA [c.41.1 (1ndqA)] SUBTILISIN                                      97   9e-23
1c13A [x.x.x] SUBTILISIN                                               97   9e-23
2gkoA [x.x.x] MICROBIAL SERINE PROTEINASES SUBTILISIN                  96   3e-22
2zwpB [x.x.x] TK-SUBTILISIN                                            95   4e-22
1c3lA [c.41.1] SUBTILISIN-CARLSBERG                                    94   1e-21
1ea7A [c.41.1] SERINE PROTEASE                                         93   2e-21
2zwpA [x.x.x] TK-SUBTILISIN                                            91   5e-21
2zwoC [x.x.x] TK-SUBTILISIN                                            91   5e-21
2zwoB [x.x.x] TK-SUBTILISIN                                            91   5e-21
2zwoA [x.x.x] TK-SUBTILISIN                                            91   5e-21
2z56A [x.x.x] TK-SUBTILISIN                                            91   5e-21
2z30A [x.x.x] TK-SUBTILISIN                                            91   5e-21
2z2zA [x.x.x] TK-SUBTILISIN PRECURSOR                                  91   5e-21
2e1pA [x.x.x] TK-SUBTILISIN                                            91   5e-21
3a3nA [x.x.x] TK-SUBTILISIN                                            91   5e-21
1iavA [c.41.1] SUBTILISIN SAVINASE                                     91   6e-21
1cseE [c.41.1] SUBTILISIN CARLSBERG                                    91   6e-21
1a1yE [x.x.x] ALCALASE                                                 91   6e-21
2z2yA [x.x.x] TK-SUBTILISIN                                            91   8e-21
1sh7B [x.x.x] EXTRACELLULAR SUBTILISIN-LIKE SERINE PROTEINASE          90   1e-20
1sh7A [x.x.x] EXTRACELLULAR SUBTILISIN-LIKE SERINE PROTEINASE          90   1e-20
1s2nB [x.x.x] EXTRACELLULAR SUBTILISIN-LIKE SERINE PROTEINASE          90   1e-20
1thmA [x.x.x] THERMITASE                                               89   2e-20
3a3pA [x.x.x] TK-SUBTILISIN                                            89   2e-20
1wmfA [c.41.1 - b.18.1] PROTEASE                                       87   1e-19
2z2xA [x.x.x] TK-SUBTILISIN                                            86   2e-19
1av7A [c.41.1 (1selA)] SUBTILISIN CARLSBERG, TYPE VIII                 85   5e-19
2b6nA [x.x.x] PROTEINASE K                                             79   3e-17
1r6vA [c.41.1] SUBTILISIN-LIKE SERINE PROTEASE                         74   6e-16
1c9nA [c.41.1] SERINE PROTEASE                                         67   1e-13
1c9jA [c.41.1] SERINE PROTEASE                                         67   1e-13
1ic6A [c.41.1] PROTEINASE K                                            62   2e-12
3dw3X [c.41.1 (1bjrE)] PROTEINASE K                                    62   2e-12
1ht3A [c.41.1] PROTEINASE K                                            61   7e-12
2w2qA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            59   3e-11
2w2mA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            59   3e-11
3gcwA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            59   3e-11
3bpsA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            59   3e-11
2w2pA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            59   4e-11
2w2oA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            58   5e-11
2w2nA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            58   5e-11
1r64A [c.41.1 - b.18.1] KEXIN                                          58   5e-11
1ot5A [c.41.1 - b.18.1] KEXIN                                          58   5e-11
2id4B [x.x.x] KEXIN                                                    58   5e-11
2id4A [x.x.x] KEXIN                                                    58   5e-11
3eifA [x.x.x] C5A PEPTIDASE                                            56   2e-10
2pmwB [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            56   2e-10
2qtwB [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            55   3e-10
2p4eA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            55   3e-10
3h42B [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9            52   4e-09
1xf1A [x.x.x] C5A PEPTIDASE                                            44   7e-07
1p8jH [c.41.1 - b.18.1] FURIN PRECURSOR                                44   7e-07
1p8jF [c.41.1 - b.18.1] FURIN PRECURSOR                                44   7e-07
1p8jC [c.41.1 - b.18.1] FURIN PRECURSOR                                44   7e-07
1p8jB [c.41.1 - b.18.1] FURIN PRECURSOR                                44   7e-07
1p8jA [c.41.1 - b.18.1] FURIN PRECURSOR                                44   7e-07
1v6cB [c.41.1] ALKALINE SERINE PROTEASE                                40   2e-05
1v6cA [c.41.1] ALKALINE SERINE PROTEASE                                40   2e-05
2iy9A [x.x.x] SUBA                                                     34   0.001

>1y4dE [x.x.x] SUBTILISIN BPN'
          Length = 276

 Score =  130 bits (327), Expect = 7e-33
 Identities = 108/309 (34%), Positives = 143/309 (46%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A MV  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   +GTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 263 YGKGLINVQ 271


>1supA [c.41.1 (1sbnE)] SUBTILISIN BPN'
          Length = 275

 Score =  130 bits (327), Expect = 7e-33
 Identities = 108/309 (34%), Positives = 143/309 (46%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A MV  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   +GTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 263 YGKGLINVQ 271


>2sniE [c.41.1] SUBTILISIN NOVO
          Length = 275

 Score =  130 bits (327), Expect = 7e-33
 Identities = 108/309 (34%), Positives = 143/309 (46%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A MV  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   +GTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 263 YGKGLINVQ 271


>1s02A [x.x.x] SUBTILISIN BPN'
          Length = 275

 Score =  130 bits (327), Expect = 7e-33
 Identities = 108/309 (34%), Positives = 143/309 (46%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + +  TG  V VAV+D+GI   HPDL  ++ G A MV  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSEGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   +GTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N E
Sbjct: 263 YGKGLINVE 271


>1lw6E [c.41.1] SUBTILISIN BPN'
          Length = 281

 Score =  129 bits (325), Expect = 1e-32
 Identities = 108/307 (35%), Positives = 142/307 (46%), Gaps = 50/307 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A MV  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   +GTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 262

Query: 428 YGAGAVN 434
           YG G +N
Sbjct: 263 YGKGLIN 269


>1suaA [c.41.1] SUBTILISIN BPN'
          Length = 263

 Score =  127 bits (320), Expect = 5e-32
 Identities = 107/309 (34%), Positives = 140/309 (45%), Gaps = 59/309 (19%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL   + G A  V  +T P+ D+N HGT
Sbjct: 6   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLN--VAGGASFVPSETNPFQDNNSHGT 63

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V              AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 64  HVAGTVLAV-----------APSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 106

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 107 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 159

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I+            
Sbjct: 160 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSIV------------ 194

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGT+MA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 195 --STLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 250

Query: 428 YGAGAVNAE 436
           YG G +N E
Sbjct: 251 YGKGLINVE 259


>1sueA [x.x.x] SUBTILISIN BPN'
          Length = 266

 Score =  127 bits (319), Expect = 6e-32
 Identities = 108/309 (34%), Positives = 139/309 (44%), Gaps = 59/309 (19%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL   + G A  V  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLN--VAGGASFVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V              AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVLAV-----------APSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 109

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 110 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 162

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 163 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSIC------------ 197

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 198 --STLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 253

Query: 428 YGAGAVNAE 436
           YG G +N E
Sbjct: 254 YGKGLINVE 262


>1sbiA [x.x.x] SUBTILISIN 8397
          Length = 274

 Score =  126 bits (317), Expect = 1e-31
 Identities = 107/309 (34%), Positives = 140/309 (45%), Gaps = 51/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A  V  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASFVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALDNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  P   
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPAKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 --STLPGNKYGAYSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 261

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 262 YGKGLINVQ 270


>1s01A [x.x.x] SUBTILISIN BPN'
          Length = 275

 Score =  126 bits (317), Expect = 1e-31
 Identities = 107/309 (34%), Positives = 140/309 (45%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A  V  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASFVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALDNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  P   
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPAKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSIC------------ 206

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 207 --STLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 263 YGKGLINVQ 271


>1sbtA [x.x.x] SUBTILISIN BPN'
          Length = 275

 Score =  125 bits (315), Expect = 2e-31
 Identities = 107/309 (34%), Positives = 141/309 (45%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A MV  +T  + DDN HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETPNFQDDNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP + L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSSALYAVKVLGDAGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGSTGSSSTVGYPGKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   +GTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLQNTTTKLGDS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 263 YGKGLINVQ 271


>1subA [x.x.x] SUBTILISIN BPN' CRB-S3
          Length = 274

 Score =  125 bits (314), Expect = 2e-31
 Identities = 108/309 (34%), Positives = 142/309 (45%), Gaps = 51/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A MV  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   SGT MA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAYSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 261

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 262 YGKGLINVQ 270


>1spbS [c.41.1] SUBTILISIN BPN'
          Length = 264

 Score =  124 bits (312), Expect = 4e-31
 Identities = 105/309 (33%), Positives = 140/309 (45%), Gaps = 59/309 (19%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+++GI   HPDL   + G A  V  +T P+ D+N HGT
Sbjct: 7   SQIKAPALHSQGYTGSNVKVAVINSGIDSSHPDLN--VAGGASFVPSETNPFQDNNSHGT 64

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V              AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 65  HVAGTVLAV-----------APSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 107

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 108 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 160

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I+            
Sbjct: 161 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSIV------------ 195

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGT+MA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 196 --STLPGNKYGAKSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 251

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 252 YGKGLINVQ 260


>1v5iA [c.41.1 (1ubnA)] SUBTILISIN BPN'
          Length = 274

 Score =  124 bits (311), Expect = 5e-31
 Identities = 107/309 (34%), Positives = 142/309 (45%), Gaps = 51/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A MV  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   +GT MA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAYNGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 261

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 262 YGKGLINVQ 270


>1duiA [c.41.1] PROTEIN (SUBTILISIN BPN')
          Length = 266

 Score =  124 bits (311), Expect = 5e-31
 Identities = 106/309 (34%), Positives = 139/309 (44%), Gaps = 59/309 (19%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL   + G A  V  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLN--VAGGASFVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V              AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVLAV-----------APSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 109

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 110 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 162

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 163 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSIC------------ 197

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  +     
Sbjct: 198 --STLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGNS--FY 253

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 254 YGKGLINVQ 262


>1sbhA [x.x.x] SUBTILISIN 8397+1
          Length = 274

 Score =  124 bits (310), Expect = 7e-31
 Identities = 106/309 (34%), Positives = 139/309 (44%), Gaps = 51/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A  V  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASFVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALDNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  P   
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPAKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGTSMA+P  AG AALIL ++P+ T  +V+  L+N T    D     
Sbjct: 206 --STLPGNKYGAYSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTYLGDS--FY 261

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 262 YGKGLINVQ 270


>1sudA [x.x.x] SUBTILISIN BPN' CRB-S3
          Length = 274

 Score =  123 bits (309), Expect = 9e-31
 Identities = 107/309 (34%), Positives = 141/309 (45%), Gaps = 51/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A  V  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASFVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   SGT MA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAKSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 261

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 262 YGKGLINVQ 270


>1ak9A [x.x.x] SUBTILISIN 8321
          Length = 275

 Score =  123 bits (309), Expect = 9e-31
 Identities = 106/309 (34%), Positives = 140/309 (45%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q   G  V VAV+D+GI   HPDL  ++ G A  V  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYCGSNVKVAVIDSGIDSSHPDL--KVAGGASFVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPCASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  P   
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPAKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   SGTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 263 YGKGLINVQ 271


>1aqnA [x.x.x] SUBTILISIN 8324
          Length = 275

 Score =  122 bits (307), Expect = 2e-30
 Identities = 106/309 (34%), Positives = 139/309 (44%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q   G  V VAV+D+GI   HPDL  ++ G A  V  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYCGSNVKVAVIDSGIDSSHPDL--KVAGGASFVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPCASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  P   
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPAKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSIC------------ 206

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGTSMA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 207 --STLPGNKYGAKSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 263 YGKGLINVQ 271


>1gnvA [c.41.1] SUBTILISIN BPN'
          Length = 265

 Score =  121 bits (303), Expect = 4e-30
 Identities = 107/309 (34%), Positives = 138/309 (44%), Gaps = 60/309 (19%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL   + G A  V  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLN--VAGGASFVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V              AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVLAV-----------APSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 109

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 110 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 162

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 163 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSIC------------ 197

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGT MA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 198 --STLPGNKYGAKSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 252

Query: 428 YGAGAVNAE 436
           YG G +N E
Sbjct: 253 YGKGLINVE 261


>1bh6A [c.41.1] SUBTILISIN DY
          Length = 274

 Score =  120 bits (300), Expect = 1e-29
 Identities = 98/298 (32%), Positives = 138/298 (46%), Gaps = 49/298 (16%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXX 200
           Q   G  V V ++DTGI   H DL  +++G A  V+ ++   D NGHGTH AG V     
Sbjct: 19  QGYKGANVKVGIIDTGIASSHTDL--KVVGGASFVSGESYNTDGNGHGTHVAGTVAALDN 76

Query: 201 XXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGG 260
                  G AP  +L  +KVLN             +EW  Q         +D+++MSLGG
Sbjct: 77  TTGVL--GVAPNVSLYAIKVLNXXXXXXXXXXXXXIEWATQNG-------LDVINMSLGG 127

Query: 261 DALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQ--TIASPGVSEKVITVGXXXX 318
            +          L +AV++A+++GIVV  AAGNSG      TI  P   + VI VG    
Sbjct: 128 PS------GSTALKQAVDKAYASGIVVVAAAGNSGNSGSQNTIGYPAKYDSVIAVGAVDS 181

Query: 319 XXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYF 378
                      ASFSS G  +      +++APGV++ S    N+Y               
Sbjct: 182 NKNR-------ASFSSVGSEL------EVMAPGVSVYSTYPSNTYT-------------- 214

Query: 379 TMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
           +++GTSMA+P  AG AALIL + P L+  +V+  L +      D     YG G +N E
Sbjct: 215 SLNGTSMASPHVAGAAALILSKYPTLSASQVRNRLSSTATNLGDS--FYYGKGLINVE 270


>1a2qA [x.x.x] SUBTILISIN BPN'
          Length = 274

 Score =  119 bits (298), Expect = 2e-29
 Identities = 106/309 (34%), Positives = 140/309 (45%), Gaps = 51/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q   G  V VAV+D+GI   HPDL  ++ G A MV  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYCGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPCASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  P   
Sbjct: 119 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPAKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 172 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   SGT MA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 206 -QSTLPGNKYGAYSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 261

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 262 YGKGLINVQ 270


>1q5pA [c.41.1] SERINE PROTEASE
          Length = 268

 Score =  118 bits (296), Expect = 3e-29
 Identities = 103/305 (33%), Positives = 137/305 (44%), Gaps = 49/305 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL   I G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPI 251
           AG +            G AP A L  VKVL            +G+EW         +  +
Sbjct: 67  AGTIAALDNSIG--VLGVAPSAELYAVKVLXXXXXXXXXXXXQGLEWA-------GNNGM 117

Query: 252 DIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVI 311
            + ++SLG  +     EQ      AV  A S G++V  A+GN G  S  I  P      +
Sbjct: 118 HVANLSLGSPSPSATLEQ------AVNSATSRGVLVVAASGNEGAGS--IDYPARYANAM 169

Query: 312 TVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSS 371
            VG               ASFS  G  +      DI+APGVN+              +S+
Sbjct: 170 AVGATDQNNNR-------ASFSQYGAGL------DIVAPGVNV--------------QST 202

Query: 372 RVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAG 431
             GS Y +++GT MATP  AG AAL+ Q+NP  +  +++  LKN          N+YG+G
Sbjct: 203 YPGSTYASLNGT-MATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL--GSTNLYGSG 259

Query: 432 AVNAE 436
            VNAE
Sbjct: 260 LVNAE 264


>1gnsA [c.41.1] SUBTILISIN BPN'
          Length = 262

 Score =  118 bits (295), Expect = 4e-29
 Identities = 106/309 (34%), Positives = 138/309 (44%), Gaps = 60/309 (19%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HP L  ++ G A  V  +T P+ D+N HGT
Sbjct: 6   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPAL--KVAGGASFVPSETNPFQDNNSHGT 63

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V              AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 64  HVAGTVLAV-----------APSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 106

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
            +D+++MSLGG +                             GN G    S T+  PG  
Sbjct: 107 -MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 159

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 160 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 193

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
             S+  G++Y   SGT MA+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 194 -WSTLPGNKYGAKSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 249

Query: 428 YGAGAVNAE 436
           YG G +N E
Sbjct: 250 YGKGLINVE 258


>1st2A [x.x.x] SUBTILISIN BPN'
          Length = 272

 Score =  116 bits (291), Expect = 1e-28
 Identities = 106/309 (34%), Positives = 140/309 (45%), Gaps = 53/309 (17%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A MV  +T P+ D+N HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASMVPSETNPFQDNNSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG V            G AP A+L  VKVL   GSG  + II G+EW I  N      
Sbjct: 67  HVAGTVAALNNSIGVL--GVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVS 307
             D+++ SLGG +                             GN G    S T+  PG  
Sbjct: 119 --DVIN-SLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKY 169

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
             VI VG               ASFSS GP +      D++APGV+I             
Sbjct: 170 PSVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI------------- 203

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G++Y   +GTS A+P  AG AALIL ++P+ T  +V+  L+N T K  D     
Sbjct: 204 -QSTLPGNKYGAYNGTS-ASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FY 259

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 260 YGKGLINVQ 268


>1st3A [x.x.x] SUBTILISIN BL
          Length = 269

 Score =  114 bits (284), Expect = 7e-28
 Identities = 99/305 (32%), Positives = 132/305 (43%), Gaps = 48/305 (15%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL   I G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPI 251
           AG +            G AP A L  VKVL   G G ++ I +G+EW         +  +
Sbjct: 67  AGTIAALNNSIG--VLGVAPSAELYAVKVLGADGRGAISSIAQGLEWA-------GNNGM 117

Query: 252 DIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVI 311
            + ++SLG  +     EQ      AV  A S                     P      +
Sbjct: 118 HVANLSLGSPSPSATLEQ------AVNSATSRXXXXXXXXXXXXXXXXXY--PARYANAM 169

Query: 312 TVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSS 371
            VG               ASFS  G  +      DI+APGVN+              +S+
Sbjct: 170 AVGATDQNNNR-------ASFSQYGAGL------DIVAPGVNV--------------QST 202

Query: 372 RVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAG 431
             GS Y +++GTSMATP  AG AAL+ Q+NP  +  +++  LKN          N+YG+G
Sbjct: 203 YPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL--GSTNLYGSG 260

Query: 432 AVNAE 436
            VNAE
Sbjct: 261 LVNAE 265


>1dbiA [c.41.1] AK.1 SERINE PROTEASE
          Length = 271

 Score =  111 bits (277), Expect = 5e-27
 Identities = 92/298 (30%), Positives = 136/298 (45%), Gaps = 56/298 (18%)

Query: 143 TLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXX 201
           T    G  +AV+DTG+ Y HPDL+G++I   D V+   +P D N HGTH AG +      
Sbjct: 27  TKGSSGQEIAVIDTGVDYTHPDLDGKVIKGYDFVDNDYDPMDLNNHGTHVAG-IAAAETN 85

Query: 202 XXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGD 261
                 G AP   ++ V+ L++ GSGTL+                     +++++SLG D
Sbjct: 86  NATGIAGMAPNTRILAVRALDRNGSGTLS-------XXXXXXXXXXXSGAEVINLSLGCD 138

Query: 262 ALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXX 321
                      L  AV  AW+ G VV  AAGN+             E VI VG       
Sbjct: 139 C------HTTTLENAVNYAWNKGSVVVAAAGNNS-----------YENVIAVG------- 174

Query: 322 XXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMS 381
                  +ASFS+ G  V      D++APGV+I+              S+  G++Y  MS
Sbjct: 175 AVDQYDRLASFSNYGTWV------DVVAPGVDIV--------------STITGNRYAYMS 214

Query: 382 GTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAENSV 439
           GTSMA+P  AG+AAL+  Q  +    E+++ ++   DK        +  G +N+ N+V
Sbjct: 215 GTSMASPHVAGLAALLASQGRNNI--EIRQAIEQTADKISGTG-TYFKYGRINSYNAV 269


>1nduA [c.41.1] SUBTILISIN SAVINASE
          Length = 269

 Score =  107 bits (267), Expect = 7e-26
 Identities = 98/305 (32%), Positives = 130/305 (42%), Gaps = 48/305 (15%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL   I G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPI 251
           AG +            G AP A L  VKVL          I +G+EW         +  +
Sbjct: 67  AGTIAALNNSIG--VLGVAPNAELYAVKVLXXXXXXXXXXIAQGLEWA-------GNNGM 117

Query: 252 DIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVI 311
            + ++SLG  +     EQ      AV  A S                  I+ P      +
Sbjct: 118 HVANLSLGSPSPSATLEQ------AVNSATSR--XXXXXXXXXXXXXXXISYPARYANAM 169

Query: 312 TVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSS 371
            VG               ASFS  G  +      DI+APGVN+              +S+
Sbjct: 170 AVGATDQNNNR-------ASFSQYGAGL------DIVAPGVNV--------------QST 202

Query: 372 RVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAG 431
             GS Y +++GTSMATP  AG AAL+ Q+NP  +  +++  LKN          N+YG+G
Sbjct: 203 YPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL--GSTNLYGSG 260

Query: 432 AVNAE 436
            VNAE
Sbjct: 261 LVNAE 265


>1sucA [x.x.x] SUBTILISIN BPN' CRB-S3
          Length = 262

 Score =  105 bits (262), Expect = 3e-25
 Identities = 103/308 (33%), Positives = 136/308 (44%), Gaps = 58/308 (18%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPYDDNGHGTH 190
           S  K    + Q  TG  V VAV+D+GI   HPDL  ++ G A  V  +T P+ DN     
Sbjct: 6   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDL--KVAGGASFVPSETNPFQDNNSXXX 63

Query: 191 CAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEP 250
                               P A+L  VKVL   GSG  + II G+EW I  N       
Sbjct: 64  XXXXXXXXXX----------PSASLYAVKVLGADGSGQYSWIINGIEWAIANN------- 106

Query: 251 IDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGP--DSQTIASPGVSE 308
           +D+++MSLGG +                             GN G    S T+  PG   
Sbjct: 107 MDVINMSLGGPS------GSXXXXXXXXXXXXXXXXXXXXXGNEGTSGSSSTVGYPGKYP 160

Query: 309 KVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQ 368
            VI VG               ASFSS GP +      D++APGV+I              
Sbjct: 161 SVIAVGAVDSSNQR-------ASFSSVGPEL------DVMAPGVSI-------------- 193

Query: 369 KSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIY 428
           +S+  G++Y   SGT MA+P  AG AALIL ++P+ T  +V+  L+N T K  D     Y
Sbjct: 194 QSTLPGNKYGAKSGT-MASPHVAGAAALILSKHPNWTNTQVRSSLENTTTKLGDS--FYY 250

Query: 429 GAGAVNAE 436
           G G +N +
Sbjct: 251 GKGLINVQ 258


>3f49S [x.x.x] SUBTILISIN BPN'
          Length = 266

 Score =  104 bits (259), Expect = 6e-25
 Identities = 96/299 (32%), Positives = 126/299 (42%), Gaps = 55/299 (18%)

Query: 140 NGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGTHCAGDVXX 197
           + Q  TG  V VAV+ +GI   HPDL   + G A  V  +T P+ D+N HGTH AG V  
Sbjct: 17  HSQGYTGSNVKVAVLASGIDSSHPDLN--VAGGASFVPSETNPFQDNNSHGTHVAGTVLA 74

Query: 198 XXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMS 257
                       AP A+L  VKVL   GSG  + II G+EW I  N       +D+++MS
Sbjct: 75  V-----------APSASLYAVKVLGADGSGQASWIINGIEWAIANN-------MDVINMS 116

Query: 258 LGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXX 317
           LG  +                                         P     VI VG   
Sbjct: 117 LGSPS----GSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPAKYPSVIAVGAVD 172

Query: 318 XXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQY 377
                       A FSS GP +      D++APGV+I               S+  G +Y
Sbjct: 173 SSNQR-------APFSSVGPEL------DVMAPGVSIC--------------STLPGGKY 205

Query: 378 FTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
             +SGTSMA+P  AG AALIL ++P+ T  +V+  L+N   K  D     YG G +N E
Sbjct: 206 GALSGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDS--FYYGKGLINVE 262


>3cnqS [x.x.x] SUBTILISIN BPN'
          Length = 264

 Score =  103 bits (256), Expect = 1e-24
 Identities = 95/299 (31%), Positives = 126/299 (42%), Gaps = 55/299 (18%)

Query: 140 NGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGTHCAGDVXX 197
           + Q  TG  V VAV+ +GI   HPDL   + G A  V  +T P+ D+N HGTH AG V  
Sbjct: 15  HSQGYTGSNVKVAVLASGIDSSHPDLN--VAGGASFVPSETNPFQDNNSHGTHVAGTVLA 72

Query: 198 XXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMS 257
                       AP A+L  VKVL   GSG  + II G+EW I  N       +D+++MS
Sbjct: 73  V-----------APSASLYAVKVLGADGSGQASWIINGIEWAIANN-------MDVINMS 114

Query: 258 LGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXX 317
           LG  +                                         P     VI VG   
Sbjct: 115 LGSPS----GSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPAKYPSVIAVGAVD 170

Query: 318 XXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQY 377
                       A FSS GP +      D++APGV+I               S+  G +Y
Sbjct: 171 SSNQR-------APFSSVGPEL------DVMAPGVSIC--------------STLPGGKY 203

Query: 378 FTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
             +SGT+MA+P  AG AALIL ++P+ T  +V+  L+N   K  D     YG G +N E
Sbjct: 204 GALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDS--FYYGKGLINVE 260


>3bgoS [x.x.x] SUBTILISIN BPN'
          Length = 263

 Score =  103 bits (256), Expect = 1e-24
 Identities = 95/299 (31%), Positives = 126/299 (42%), Gaps = 55/299 (18%)

Query: 140 NGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-DDNGHGTHCAGDVXX 197
           + Q  TG  V VAV+ +GI   HPDL   + G A  V  +T P+ D+N HGTH AG V  
Sbjct: 14  HSQGYTGSNVKVAVLASGIDSSHPDLN--VAGGASFVPSETNPFQDNNSHGTHVAGTVLA 71

Query: 198 XXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMS 257
                       AP A+L  VKVL   GSG  + II G+EW I  N       +D+++MS
Sbjct: 72  V-----------APSASLYAVKVLGADGSGQASWIINGIEWAIANN-------MDVINMS 113

Query: 258 LGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXX 317
           LG  +                                         P     VI VG   
Sbjct: 114 LGSPS----GSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPAKYPSVIAVGAVD 169

Query: 318 XXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQY 377
                       A FSS GP +      D++APGV+I               S+  G +Y
Sbjct: 170 SSNQR-------APFSSVGPEL------DVMAPGVSIC--------------STLPGGKY 202

Query: 378 FTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
             +SGT+MA+P  AG AALIL ++P+ T  +V+  L+N   K  D     YG G +N E
Sbjct: 203 GALSGTAMASPHVAGAAALILSKHPNWTNTQVRSSLENTATKLGDS--FYYGKGLINVE 259


>1meeA [c.41.1] MESENTERICOPEPTIDASE
          Length = 275

 Score =  102 bits (255), Expect = 2e-24
 Identities = 98/309 (31%), Positives = 130/309 (42%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPYDD-NGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  R  G A  V  +T PY D + HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVR--GGASFVPSETNPYQDGSSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG +            G AP A+L  VKVL+  GSG  + II G+EW I  N      
Sbjct: 67  HVAGTIAALNNSIGVL--GVAPSASLYAVKVLDSTGSGQYSWIINGIEWAISNN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIAS--PGVS 307
            +D+++MSLGG            L   V++                          P   
Sbjct: 119 -MDVINMSLGGPT------GSTALKTVVDKXXXXXXXXXXXXXXXXXXXXXXXXXYPAKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
              I VG               ASFSS G  +      D++APGV+I             
Sbjct: 172 PSTIAVGAVNSANQR-------ASFSSAGSEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G  Y   +GTSMATP  AG AALIL ++P  T  +V++ L++            
Sbjct: 206 -QSTLPGGTYGAYNGTSMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGSS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 263 YGKGLINVQ 271


>2tecE [c.41.1] THERMITASE
          Length = 279

 Score =  100 bits (248), Expect = 1e-23
 Identities = 85/295 (28%), Positives = 126/295 (42%), Gaps = 47/295 (15%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXX 204
           G G  +A+VDTG+   HPDL G+++G  D V+  + P + NGHGTHCAG +         
Sbjct: 29  GSGAKIAIVDTGVQSNHPDLAGKVVGGWDFVDNDSTPQNGNGHGTHCAG-IAAAVTNNST 87

Query: 205 QYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALR 264
              G AP+A+++ V+VL+  GSGT   +  G+ +         D+   ++S+SLGG    
Sbjct: 88  GIAGTAPKASILAVRVLDNSGSGTWTAVANGITYA-------ADQGAKVISLSLGGTV-- 138

Query: 265 YDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXX 324
                   L +AV  AW+ G         S                              
Sbjct: 139 ----GNSGLQQAVNYAWNKG---------SXXXXXXXXXXXXXXXXXXXXSNAIAVASTD 185

Query: 325 XXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTS 384
                +SFS+ G  V      D+ APG          S+I     S+   S Y ++SGTS
Sbjct: 186 QNDNKSSFSTYGSVV------DVAAPG----------SWI----YSTYPTSTYASLSGTS 225

Query: 385 MATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAENSV 439
           MATP  AG+A L+  Q    +   ++  ++N  DK        +  G VNA  +V
Sbjct: 226 MATPHVAGVAGLLASQG--RSASNIRAAIENTADKISGTG-TYWAKGRVNAYKAV 277


>1scjA [c.41.1] SUBTILISIN E
          Length = 275

 Score =  100 bits (248), Expect = 1e-23
 Identities = 96/309 (31%), Positives = 130/309 (42%), Gaps = 50/309 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPYDD-NGHGT 189
           S  K    + Q  TG  V VAV+D+GI   HPDL  R  G A  V  +T PY D + HGT
Sbjct: 9   SQIKAPALHSQGYTGSNVKVAVIDSGIDSSHPDLNVR--GGASFVPSETNPYQDGSSHGT 66

Query: 190 HCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDE 249
           H AG +            G +P A+L  VKVL+  GSG  + II G+EW I  N      
Sbjct: 67  HVAGTIAALNNSIGVL--GVSPSASLYAVKVLDSTGSGQYSWIINGIEWAISNN------ 118

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIAS--PGVS 307
            +D+++MSLGG            L   V++                          P   
Sbjct: 119 -MDVINMSLGGPT------GSTALKTVVDKXXXXXXXXXXXXXXXXXXXXXXXXXYPAKY 171

Query: 308 EKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKL 367
              I VG               ASFSS G  +      D++APGV+I             
Sbjct: 172 PSTIAVGAVNSSNQR-------ASFSSAGSEL------DVMAPGVSI------------- 205

Query: 368 QKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNI 427
            +S+  G  Y   +GT MATP  AG AALIL ++P  T  +V++ L++      +     
Sbjct: 206 -QSTLPGGTYGAYNGTCMATPHVAGAAALILSKHPTWTNAQVRDRLESTATYLGNS--FY 262

Query: 428 YGAGAVNAE 436
           YG G +N +
Sbjct: 263 YGKGLINVQ 271


>1c9mA [c.41.1] SERINE PROTEASE
          Length = 268

 Score = 99.4 bits (246), Expect = 2e-23
 Identities = 96/305 (31%), Positives = 128/305 (41%), Gaps = 49/305 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL   I G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPI 251
           AG +            G AP A L  VKVL            +G+EW         +  +
Sbjct: 67  AGTIAALDNSIG--VLGVAPSAELYAVKVLXXXXXXXXXXXXQGLEWA-------GNNGM 117

Query: 252 DIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVI 311
            + ++SLG  +     EQ      AV  A S                  I+ P      +
Sbjct: 118 HVANLSLGSPSPSATLEQ------AVNSATSR--XXXXXXXXXXXXXXXISYPARYANAM 169

Query: 312 TVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSS 371
            VG               ASFS  G  +      DI+APGVN+              +S+
Sbjct: 170 AVGATDQNNNR-------ASFSQYGAGL------DIVAPGVNV--------------QST 202

Query: 372 RVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAG 431
             GS Y +++GT MATP  AG AAL+ Q+NP  +  +++  LKN          N+YG+G
Sbjct: 203 YPGSTYASLNGT-MATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL--GSTNLYGSG 259

Query: 432 AVNAE 436
            VNAE
Sbjct: 260 LVNAE 264


>2ixtB [x.x.x] 36KDA PROTEASE
          Length = 310

 Score = 99.0 bits (245), Expect = 2e-23
 Identities = 91/288 (31%), Positives = 123/288 (42%), Gaps = 27/288 (9%)

Query: 136 EVVRNGQTLT----GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKT----EPYDDNG 186
           + + N  TLT    G G+ +AV+DTG+   HPDL   +    D     T       D NG
Sbjct: 11  KAIYNNDTLTSTTGGSGINIAVLDTGVNTSHPDLVNNVEQCKDFTGATTPINNSCTDRNG 70

Query: 187 HGTHCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDN 246
           HGTH AG              G AP+A+L   KVL   GSG                   
Sbjct: 71  HGTHVAGTALADGGSDQAGIYGVAPDADLWAYKVLLDSGSGYSXXXXXXXXXXXXXXXXX 130

Query: 247 PDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGV 306
             + I  +SMSLG  A          +  AV  A+S G+++  AAGNSG    TI  PG 
Sbjct: 131 GTKTI--ISMSLGSSA------NNSLISSAVNYAYSKGVLIVAAAGNSGYSQGTIGYPGA 182

Query: 307 SEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDK 366
               I V               VA +SSRG   Y     D +    +I  + +P S +  
Sbjct: 183 LPNAIAVAALENVQQNGTYR--VADYSSRG---YISTAGDYVIQEGDI-EISAPGSSV-- 234

Query: 367 LQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLK 414
              S+     Y T+SGTSMATP  +G+AA I  +NP L+  +++  L+
Sbjct: 235 --YSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSNLQ 280


>2ixtA [x.x.x] 36KDA PROTEASE
          Length = 309

 Score = 99.0 bits (245), Expect = 2e-23
 Identities = 91/288 (31%), Positives = 123/288 (42%), Gaps = 27/288 (9%)

Query: 136 EVVRNGQTLT----GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKT----EPYDDNG 186
           + + N  TLT    G G+ +AV+DTG+   HPDL   +    D     T       D NG
Sbjct: 11  KAIYNNDTLTSTTGGSGINIAVLDTGVNTSHPDLVNNVEQCKDFTGATTPINNSCTDRNG 70

Query: 187 HGTHCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDN 246
           HGTH AG              G AP+A+L   KVL   GSG                   
Sbjct: 71  HGTHVAGTALADGGSDQAGIYGVAPDADLWAYKVLLDSGSGYSXXXXXXXXXXXXXXXXX 130

Query: 247 PDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGV 306
             + I  +SMSLG  A          +  AV  A+S G+++  AAGNSG    TI  PG 
Sbjct: 131 GTKTI--ISMSLGSSA------NNSLISSAVNYAYSKGVLIVAAAGNSGYSQGTIGYPGA 182

Query: 307 SEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDK 366
               I V               VA +SSRG   Y     D +    +I  + +P S +  
Sbjct: 183 LPNAIAVAALENVQQNGTYR--VADYSSRG---YISTAGDYVIQEGDI-EISAPGSSV-- 234

Query: 367 LQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLK 414
              S+     Y T+SGTSMATP  +G+AA I  +NP L+  +++  L+
Sbjct: 235 --YSTWYNGGYNTISGTSMATPHVSGLAAKIWAENPSLSNTQLRSNLQ 280


>1wsdA [c.41.1] M-PROTEASE
          Length = 269

 Score = 98.2 bits (243), Expect = 4e-23
 Identities = 93/305 (30%), Positives = 127/305 (41%), Gaps = 48/305 (15%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL  R  G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPI 251
           AG +            G AP A L                  +G+EW         +  +
Sbjct: 67  AGTIAALNNSIGVL--GVAPSAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGM 117

Query: 252 DIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVI 311
            + ++SLG  +     EQ      AV  A S                  I+ P      +
Sbjct: 118 HVANLSLGSPSPSATLEQ------AVNSATSRXXXXXXXXXXXXXXX--ISYPARYANAM 169

Query: 312 TVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSS 371
            VG               ASFS  G  +      DI+APGVN+              +S+
Sbjct: 170 AVGATDQNNNR-------ASFSQYGAGL------DIVAPGVNV--------------QST 202

Query: 372 RVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAG 431
             GS Y +++GTSMATP  AG+AAL+ Q+NP  +  +++  LKN        + N+YG+G
Sbjct: 203 YPGSTYASLNGTSMATPHVAGVAALVKQKNPSWSNVQIRNHLKNTATGL--GNTNLYGSG 260

Query: 432 AVNAE 436
            VNAE
Sbjct: 261 LVNAE 265


>1wmdA [c.41.1 - b.18.1] PROTEASE
          Length = 434

 Score = 98.2 bits (243), Expect = 4e-23
 Identities = 90/288 (31%), Positives = 125/288 (43%), Gaps = 35/288 (12%)

Query: 136 EVVRNGQTLTGKGVTVAVVDTGIYP-------HPDLEGRIIGFADMVNQKTEPYDDNGHG 188
           +V ++   L G+G  VAV DTG+         H    G+I     +  +     D NGHG
Sbjct: 11  DVAQSSYGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYAL-GRTNNANDTNGHG 69

Query: 189 THCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPD 248
           TH AG V           +G AP+ANL+   +++               +   Y+     
Sbjct: 70  THVAGSVLGNGSTN----KGMAPQANLVFQSIMDSXXXXXXXPSNLQTLFSQAYSAG--- 122

Query: 249 EPIDIMSMSLGG---DALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPG 305
               I + S G     A   D    D  VR  +      + +  AAGN GP+  TI++PG
Sbjct: 123 --ARIHTNSWGAAVNGAYTTDSRNVDDYVRKND------MTILFAAGNEGPNGGTISAPG 174

Query: 306 VSEKVITVGXXXXXXXXXXXXXX----VASFSSRGPTVYGKEKPDILAPGVNIISLRSPN 361
            ++  ITVG                  VA FSSRGPT  G+ KPD++APG  I+S RS  
Sbjct: 175 TAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTKDGRIKPDVMAPGTFILSARS-- 232

Query: 362 SYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQ---QNPDLTP 406
           S        +   S+Y  M GTSMATPI AG  A + +   +N  +TP
Sbjct: 233 SLAPDSSFWANHDSKYAYMGGTSMATPIVAGNVAQLREHFVKNRGITP 280


>1gciA [c.41.1 (1ndqA)] SUBTILISIN
          Length = 269

 Score = 97.1 bits (240), Expect = 9e-23
 Identities = 93/305 (30%), Positives = 125/305 (40%), Gaps = 48/305 (15%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL  R  G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPI 251
           AG +            G AP A L                  +G+EW         +  +
Sbjct: 67  AGTIAALNNSIGVL--GVAPSAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGM 117

Query: 252 DIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVI 311
            + ++SLG  +     EQ      AV  A S                  I+ P      +
Sbjct: 118 HVANLSLGSPSPSATLEQ------AVNSATSRXXXXXXXXXXXXXXX--ISYPARYANAM 169

Query: 312 TVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSS 371
            VG               ASFS  G  +      DI+APGVN+              +S+
Sbjct: 170 AVGATDQNNNR-------ASFSQYGAGL------DIVAPGVNV--------------QST 202

Query: 372 RVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAG 431
             GS Y +++GTSMATP  AG AAL+ Q+NP  +  +++  LKN          N+YG+G
Sbjct: 203 YPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL--GSTNLYGSG 260

Query: 432 AVNAE 436
            VNAE
Sbjct: 261 LVNAE 265


>1c13A [x.x.x] SUBTILISIN
          Length = 269

 Score = 97.1 bits (240), Expect = 9e-23
 Identities = 93/305 (30%), Positives = 125/305 (40%), Gaps = 48/305 (15%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL  R  G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIR--GGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPI 251
           AG +            G AP A L                  +G+EW         +  +
Sbjct: 67  AGTIAALNNSIGVL--GVAPNAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGM 117

Query: 252 DIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVI 311
            + ++SLG  +     EQ      AV  A S                  I+ P      +
Sbjct: 118 HVANLSLGSPSPSATLEQ------AVNSATSRXXXXXXXXXXXXXXX--ISYPARYANAM 169

Query: 312 TVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSS 371
            VG               ASFS  G  +      DI+APGVN+              +S+
Sbjct: 170 AVGATDQNNNR-------ASFSQYGAGL------DIVAPGVNV--------------QST 202

Query: 372 RVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAG 431
             GS Y +++GTSMATP  AG AAL+ Q+NP  +  +++  LKN          N+YG+G
Sbjct: 203 YPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL--GSTNLYGSG 260

Query: 432 AVNAE 436
            VNAE
Sbjct: 261 LVNAE 265


>2gkoA [x.x.x] MICROBIAL SERINE PROTEINASES SUBTILISIN
          Length = 309

 Score = 95.5 bits (236), Expect = 3e-22
 Identities = 93/293 (31%), Positives = 126/293 (43%), Gaps = 46/293 (15%)

Query: 136 EVVRNGQTLT----GKGVTVAVVDTGIYP-HPDLEGRIIGFADMV-------NQKTEPYD 183
           + + N   LT    G G+ +AV+DTG+   HPDL   +    D         N  T   D
Sbjct: 11  KAIYNNSNLTSTSGGAGINIAVLDTGVNTNHPDLSNNVEQCKDFTVGTNFTDNSCT---D 67

Query: 184 DNGHGTHCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYN 243
             GHGTH AG            Y G APEA+L   KVL   GSG   DI E +      +
Sbjct: 68  RQGHGTHVAGSALANGGTGSGVY-GVAPEADLWAYKVLGDDGSGYADDIAEAIRHA--GD 124

Query: 244 EDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIAS 303
           +        +++MSLG         +   +  AV+ A+  G+++  AAGNSGP   +I  
Sbjct: 125 QATALNTKVVINMSLGSSG------ESSLITNAVDYAYDKGVLIIAAAGNSGPKPGSIGY 178

Query: 304 PGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPT------VYGKEKPDILAPGVNIISL 357
           PG                       VA FSSRG        V  K   +I APG  + S 
Sbjct: 179 PGXXXXXXXXXXXENTIQNGTYR--VADFSSRGHKRTAGDYVIQKGDVEISAPGAAVYS- 235

Query: 358 RSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVK 410
               ++ D           Y T+SGTSMA+P  AG+AA I  Q+P  +  +V+
Sbjct: 236 ----TWFD---------GGYATISGTSMASPHAAGLAAKIWAQSPAASNVDVR 275


>2zwpB [x.x.x] TK-SUBTILISIN
          Length = 383

 Score = 94.7 bits (234), Expect = 4e-22
 Identities = 84/263 (31%), Positives = 119/263 (45%), Gaps = 57/263 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 103 IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 162

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPD--------EPIDIM 254
                G AP   +  V+VL+ +GSG+ +DI  G+E  I      PD           +++
Sbjct: 163 GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAIL----GPDGVXXXXXXXXXEVI 216

Query: 255 SMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVG 314
           SMSLGG A       +  L   + +A++AGIV+  A+GN G             +VI VG
Sbjct: 217 SMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXEVIAVG 268

Query: 315 XXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVG 374
                         +ASFS+R        +P++ APGV+I+S     +Y D         
Sbjct: 269 -------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD--------- 299

Query: 375 SQYFTMSGTSMATPICAGIAALI 397
             Y T+ GT+MATP  +G+ ALI
Sbjct: 300 DSYETLMGTAMATPHVSGVVALI 322


>1c3lA [c.41.1] SUBTILISIN-CARLSBERG
          Length = 274

 Score = 93.6 bits (231), Expect = 1e-21
 Identities = 89/298 (29%), Positives = 123/298 (41%), Gaps = 49/298 (16%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXX 200
           Q   G  V VAV+DTGI   HPDL   ++G A  V  +    D NGHGTH AG V     
Sbjct: 19  QGFKGANVKVAVLDTGIQASHPDLN--VVGGASFVAGEAYNTDGNGHGTHVAGTVAALDN 76

Query: 201 XXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGG 260
                  G AP  +L  VKVLN             +EW            +D+++MSLGG
Sbjct: 77  TTGVL--GVAPSVSLYAVKVLNXXXXXXXXXXXXXIEWATTNG-------MDVINMSLGG 127

Query: 261 DALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPD--SQTIASPGVSEKVITVGXXXX 318
            +          + +AV+ A+                  + TI  P   + VI VG    
Sbjct: 128 AS------GSTAMKQAVDNAYXXXXXXXXXXXXXXXXXXTNTIGYPAKYDSVIAVGAVDS 181

Query: 319 XXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYF 378
                      ASFSS G  +      +++APG  + S    N+Y               
Sbjct: 182 NSNR-------ASFSSVGAEL------EVMAPGAGVYSTYPTNTYA-------------- 214

Query: 379 TMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
           T++GTSMA+P  AG AALIL ++P+L+  +V+  L +            YG G +N E
Sbjct: 215 TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSS--FYYGKGLINVE 270


>1ea7A [c.41.1] SERINE PROTEASE
          Length = 309

 Score = 92.8 bits (229), Expect = 2e-21
 Identities = 90/288 (31%), Positives = 122/288 (42%), Gaps = 28/288 (9%)

Query: 136 EVVRNGQTLT----GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKT----EPYDDNG 186
           + + N  TLT    G G+ +AV+DTG+   HPDL   +    D     T       D NG
Sbjct: 11  KAIYNNDTLTSTTGGSGINIAVLDTGVNTSHPDLVNNVEQCKDFTGATTPINNSCTDRNG 70

Query: 187 HGTHCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDN 246
           HGTH AG              G AP+A+L   KVL   GSG                   
Sbjct: 71  HGTHVAGTALADGGSDQAGIYGVAPDADLWAYKVLLDSGSGYSXXXXXXXXXXXXXXXXX 130

Query: 247 PDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGV 306
             +   I+SMSLG  A          +  AV  A+S G+++  AAGNSG    TI  PG 
Sbjct: 131 GTK--TIISMSLGSSA------NNSLISSAVNYAYSKGVLIVAAAGNSGYSQGTIGYPGA 182

Query: 307 SEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDK 366
               I V               VA +SSRG   Y     D +    + I + +P S +  
Sbjct: 183 LPNAIAVA--ALENVQQNGTYRVADYSSRG---YISTAGDYVIQEGD-IEISAPGSSV-- 234

Query: 367 LQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLK 414
              S+     Y T+SGT MATP  +G+AA I  +NP L+  +++  L+
Sbjct: 235 --YSTWYNGGYNTISGT-MATPHVSGLAAKIWAENPSLSNTQLRSNLQ 279


>2zwpA [x.x.x] TK-SUBTILISIN
          Length = 389

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 100 IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 159

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 160 GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 217

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 218 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 269

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 270 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 305

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 306 -----DSYETLMGTAMATPHVSGVVALI 328


>2zwoC [x.x.x] TK-SUBTILISIN
          Length = 389

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 100 IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 159

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 160 GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 217

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 218 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 269

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 270 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 305

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 306 -----DSYETLMGTAMATPHVSGVVALI 328


>2zwoB [x.x.x] TK-SUBTILISIN
          Length = 393

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 104 IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 163

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 164 GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 221

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 222 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 273

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 274 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 309

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 310 -----DSYETLMGTAMATPHVSGVVALI 332


>2zwoA [x.x.x] TK-SUBTILISIN
          Length = 395

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 106 IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 165

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 166 GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 223

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 224 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 275

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 276 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 311

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 312 -----DSYETLMGTAMATPHVSGVVALI 334


>2z56A [x.x.x] TK-SUBTILISIN
          Length = 318

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 29  IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 88

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 89  GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 146

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 147 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 198

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 199 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 234

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 235 -----DSYETLMGTAMATPHVSGVVALI 257


>2z30A [x.x.x] TK-SUBTILISIN
          Length = 320

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 31  IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 90

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 91  GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 148

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 149 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 200

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 201 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 236

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 237 -----DSYETLMGTAMATPHVSGVVALI 259


>2z2zA [x.x.x] TK-SUBTILISIN PRECURSOR
          Length = 389

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 100 IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 159

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 160 GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 217

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 218 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 269

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 270 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 305

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 306 -----DSYETLMGTAMATPHVSGVVALI 328


>2e1pA [x.x.x] TK-SUBTILISIN
          Length = 395

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 106 IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 165

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 166 GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 223

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 224 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 275

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 276 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 311

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 312 -----DSYETLMGTAMATPHVSGVVALI 334


>3a3nA [x.x.x] TK-SUBTILISIN
          Length = 319

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 82/268 (30%), Positives = 117/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 30  IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 89

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 90  GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 147

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 148 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 199

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 200 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 235

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 236 -----DSYETLMGTAMATPHVSGVVALI 258


>1iavA [c.41.1] SUBTILISIN SAVINASE
          Length = 268

 Score = 90.9 bits (224), Expect = 6e-21
 Identities = 92/305 (30%), Positives = 124/305 (40%), Gaps = 49/305 (16%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL   I G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPI 251
           AG +            G AP A L                  +G+EW         +  +
Sbjct: 67  AGTIAALNNSIG--VLGVAPNAELYXXXXXXXXXXXXXXXXXQGLEWA-------GNNGM 117

Query: 252 DIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVI 311
            + ++SLG  +     EQ      AV  A S                  I+ P      +
Sbjct: 118 HVANLSLGSPSPSATLEQ------AVNSATSR--XXXXXXXXXXXXXXXISYPARYANAM 169

Query: 312 TVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSS 371
            VG               ASFS  G  +      DI+APGVN+              +S+
Sbjct: 170 AVGATDQNNNR-------ASFSQYGAGL------DIVAPGVNV--------------QST 202

Query: 372 RVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAG 431
             GS Y +++GT MATP  AG AAL+ Q+NP  +  +++  LKN          N+YG+G
Sbjct: 203 YPGSTYASLNGT-MATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSL--GSTNLYGSG 259

Query: 432 AVNAE 436
            VNAE
Sbjct: 260 LVNAE 264


>1cseE [c.41.1] SUBTILISIN CARLSBERG
          Length = 274

 Score = 90.9 bits (224), Expect = 6e-21
 Identities = 88/298 (29%), Positives = 122/298 (40%), Gaps = 49/298 (16%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXX 200
           Q   G  V VAV+DTGI   HPDL   ++G A  V  +    D NGHGTH AG V     
Sbjct: 19  QGFKGANVKVAVLDTGIQASHPDLN--VVGGASFVAGEAYNTDGNGHGTHVAGTVAALDN 76

Query: 201 XXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGG 260
                  G AP  +L  VKVLN             +EW            +D+++MSLGG
Sbjct: 77  TTGVL--GVAPSVSLYAVKVLNXXXXXXXXXXXXXIEWATTNG-------MDVINMSLGG 127

Query: 261 DALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQT--IASPGVSEKVITVGXXXX 318
            +          + +AV+ A++                    I  P   + VI VG    
Sbjct: 128 AS------GSTAMKQAVDNAYARXXXXXXXXXXXXXXXXXXXIGYPAKYDSVIAVGAVDS 181

Query: 319 XXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYF 378
                      ASFSS G  +      +++APG  + S    N+Y               
Sbjct: 182 NSNR-------ASFSSVGAEL------EVMAPGAGVYSTYPTNTYA-------------- 214

Query: 379 TMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
           T++GTSMA+P  AG AALIL ++P+L+  +V+  L +            YG G +N E
Sbjct: 215 TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSS--FYYGKGLINVE 270


>1a1yE [x.x.x] ALCALASE
          Length = 274

 Score = 90.9 bits (224), Expect = 6e-21
 Identities = 88/298 (29%), Positives = 122/298 (40%), Gaps = 49/298 (16%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXX 200
           Q   G  V VAV+DTGI   HPDL   ++G A  V  +    D NGHGTH AG V     
Sbjct: 19  QGFKGANVKVAVLDTGIQASHPDLN--VVGGASFVAGEAYNTDGNGHGTHVAGTVAALDN 76

Query: 201 XXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGG 260
                  G AP  +L  VKVLN             +EW            +D+++MSLGG
Sbjct: 77  TTGVL--GVAPSVSLYAVKVLNXXXXXXXXXXXXXIEWATTNG-------MDVINMSLGG 127

Query: 261 DALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQT--IASPGVSEKVITVGXXXX 318
            +          + +AV+ A++                    I  P   + VI VG    
Sbjct: 128 AS------GSTAMKQAVDNAYARXXXXXXXXXXXXXXXXXXXIGYPAKYDSVIAVGAVDS 181

Query: 319 XXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYF 378
                      ASFSS G  +      +++APG  + S    N+Y               
Sbjct: 182 NSNR-------ASFSSVGAEL------EVMAPGAGVYSTYPTNTYA-------------- 214

Query: 379 TMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
           T++GTSMA+P  AG AALIL ++P+L+  +V+  L +            YG G +N E
Sbjct: 215 TLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSS--FYYGKGLINVE 270


>2z2yA [x.x.x] TK-SUBTILISIN
          Length = 318

 Score = 90.5 bits (223), Expect = 8e-21
 Identities = 82/268 (30%), Positives = 116/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 29  IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 88

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 89  GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 146

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 147 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 198

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 199 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 234

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT MATP  +G+ ALI
Sbjct: 235 -----DSYETLMGTCMATPHVSGVVALI 257


>1sh7B [x.x.x] EXTRACELLULAR SUBTILISIN-LIKE SERINE PROTEINASE
          Length = 274

 Score = 89.7 bits (221), Expect = 1e-20
 Identities = 100/280 (35%), Positives = 128/280 (45%), Gaps = 48/280 (17%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXX 204
           G GVT  V+DTG+   H +  GR +   D V+   +  D NGHGTH AG +         
Sbjct: 28  GFGVTAYVIDTGVNNNHEEFGGRSVSGYDFVDNDADSSDCNGHGTHVAGTI------GGS 81

Query: 205 QYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALR 264
           QY G A   N++GV+VL+              +W  Q N   P     + +MSLGG    
Sbjct: 82  QY-GVAKNVNIVGVRVLSCXXXXXXXXXXXXXDWVAQ-NASGP----SVANMSLGGG--- 132

Query: 265 YDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXX 324
               Q   L  AV+ A  +G+   +AAGNS  D+    SP                    
Sbjct: 133 ----QSTALDSAVQGAIQSGVSFMLAAGNSNADACN-TSPARXXXXXXXXXXXXXXXXXX 187

Query: 325 XXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTS 384
                                D+ APG  I              KS+     Y T+SGTS
Sbjct: 188 XXXXXXCV-------------DLFAPGSQI--------------KSAWYDGGYKTISGTS 220

Query: 385 MATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDED 424
           MATP  AG+AAL LQ+N  LTP ++  LL +   + K  D
Sbjct: 221 MATPHVAGVAALYLQENNGLTPLQLTGLLNSRASENKVSD 260


>1sh7A [x.x.x] EXTRACELLULAR SUBTILISIN-LIKE SERINE PROTEINASE
          Length = 281

 Score = 89.7 bits (221), Expect = 1e-20
 Identities = 100/280 (35%), Positives = 128/280 (45%), Gaps = 48/280 (17%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXX 204
           G GVT  V+DTG+   H +  GR +   D V+   +  D NGHGTH AG +         
Sbjct: 28  GFGVTAYVIDTGVNNNHEEFGGRSVSGYDFVDNDADSSDCNGHGTHVAGTI------GGS 81

Query: 205 QYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALR 264
           QY G A   N++GV+VL+              +W  Q N   P     + +MSLGG    
Sbjct: 82  QY-GVAKNVNIVGVRVLSCXXXXXXXXXXXXXDWVAQ-NASGP----SVANMSLGGG--- 132

Query: 265 YDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXX 324
               Q   L  AV+ A  +G+   +AAGNS  D+    SP                    
Sbjct: 133 ----QSTALDSAVQGAIQSGVSFMLAAGNSNADACN-TSPARXXXXXXXXXXXXXXXXXX 187

Query: 325 XXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTS 384
                                D+ APG  I              KS+     Y T+SGTS
Sbjct: 188 XXXXXXCV-------------DLFAPGSQI--------------KSAWYDGGYKTISGTS 220

Query: 385 MATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDED 424
           MATP  AG+AAL LQ+N  LTP ++  LL +   + K  D
Sbjct: 221 MATPHVAGVAALYLQENNGLTPLQLTGLLNSRASENKVSD 260


>1s2nB [x.x.x] EXTRACELLULAR SUBTILISIN-LIKE SERINE PROTEINASE
          Length = 273

 Score = 89.7 bits (221), Expect = 1e-20
 Identities = 100/280 (35%), Positives = 128/280 (45%), Gaps = 48/280 (17%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXX 204
           G GVT  V+DTG+   H +  GR +   D V+   +  D NGHGTH AG +         
Sbjct: 27  GFGVTAYVIDTGVNNNHEEFGGRSVSGYDFVDNDADSSDCNGHGTHVAGTI------GGS 80

Query: 205 QYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALR 264
           QY G A   N++GV+VL+              +W  Q N   P     + +MSLGG    
Sbjct: 81  QY-GVAKNVNIVGVRVLSCXXXXXXXXXXXXXDWVAQ-NASGP----SVANMSLGGG--- 131

Query: 265 YDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXX 324
               Q   L  AV+ A  +G+   +AAGNS  D+    SP                    
Sbjct: 132 ----QSTALDSAVQGAIQSGVSFMLAAGNSNADACN-TSPARXXXXXXXXXXXXXXXXXX 186

Query: 325 XXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTS 384
                                D+ APG  I              KS+     Y T+SGTS
Sbjct: 187 XXXXXXCV-------------DLFAPGSQI--------------KSAWYDGGYKTISGTS 219

Query: 385 MATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDED 424
           MATP  AG+AAL LQ+N  LTP ++  LL +   + K  D
Sbjct: 220 MATPHVAGVAALYLQENNGLTPLQLTGLLNSRASENKVSD 259


>1thmA [x.x.x] THERMITASE
          Length = 279

 Score = 89.0 bits (219), Expect = 2e-20
 Identities = 79/295 (26%), Positives = 116/295 (39%), Gaps = 47/295 (15%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXX 204
           G G  +A+VDTG+   HPDL G+++G  D V+  + P + NGHGTHCAG +         
Sbjct: 29  GSGAKIAIVDTGVQSNHPDLAGKVVGGWDFVDNDSTPQNGNGHGTHCAG-IAAAVTNNST 87

Query: 205 QYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALR 264
              G AP+A+++ V+VL+  GSGT   +  G+ +         D+   ++S+SLGG    
Sbjct: 88  GIAGTAPKASILAVRVLDNSGSGTWTAVANGITYA-------ADQGAKVISLSLGGTV-- 138

Query: 265 YDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXX 324
                   L +AV  AW+ G         S                              
Sbjct: 139 ----GNSGLQQAVNYAWNKG---------SXXXXXXXXXXXXXXXXXXXXSNAIAVASTD 185

Query: 325 XXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTS 384
                +SFS+ G  V      D+ APG                              GTS
Sbjct: 186 QNDNKSSFSTYGSWV------DVAAPG--------------XXXXXXXXXXXXXXXXGTS 225

Query: 385 MATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAENSV 439
           MATP  AG+A L+  Q    +   ++  ++N  DK        +  G VNA  +V
Sbjct: 226 MATPHVAGVAGLLASQG--RSASNIRAAIENTADKISGTG-TYWAKGRVNAYKAV 277


>3a3pA [x.x.x] TK-SUBTILISIN
          Length = 318

 Score = 89.0 bits (219), Expect = 2e-20
 Identities = 81/268 (30%), Positives = 116/268 (43%), Gaps = 58/268 (21%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 29  IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 88

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+   I                      
Sbjct: 89  GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIAQAILGPXXXXXXXXXXXXXXXXXXX 146

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 147 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 198

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 199 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 234

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT+MATP  +G+ ALI
Sbjct: 235 -----DSYETLMGTAMATPHVSGVVALI 257


>1wmfA [c.41.1 - b.18.1] PROTEASE
          Length = 432

 Score = 86.7 bits (213), Expect = 1e-19
 Identities = 88/291 (30%), Positives = 123/291 (42%), Gaps = 43/291 (14%)

Query: 136 EVVRNGQTLTGKGVTVAVVDTGIYP-------HPDLEGRIIGFADMVNQKTEPYDDNGHG 188
           +V ++   L G+G  VAV DTG+         H    G+I     +  +     D NGHG
Sbjct: 11  DVAQSSYGLYGQGQIVAVADTGLDTGRNDSSMHEAFRGKITALYAL-GRTNNANDTNGHG 69

Query: 189 THCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPD 248
           TH AG V           +G AP+ANL+   +++               +   Y+     
Sbjct: 70  THVAGSVLGNGSTN----KGMAPQANLVFQSIMDSXXXXXXXPSNLQTLFSQAYSAG--- 122

Query: 249 EPIDIMSMSLGG---DALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPG 305
               I + S G     A   D    D  VR  +      + +  AAGN GP+  TI++PG
Sbjct: 123 --ARIHTNSWGAAVNGAYTTDSRNVDDYVRKND------MTILFAAGNEGPNGGTISAPG 174

Query: 306 VSEKVITVGXXXXXXXXXXXXXX----VASFSSRGPTVYGKEKPDILAPGVNIISLRS-- 359
            ++  ITVG                  VA FSSRGPT  G+ KPD++APG  I+S RS  
Sbjct: 175 TAKNAITVGATENLRPSFGSYADNINHVAQFSSRGPTKDGRIKPDVMAPGTFILSARSSL 234

Query: 360 -PNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQ---QNPDLTP 406
            P+S       S       +   GTS ATPI AG  A + +   +N  +TP
Sbjct: 235 APDSSFWANHDSK------YAYGGTS-ATPIVAGNVAQLREHFVKNRGITP 278


>2z2xA [x.x.x] TK-SUBTILISIN
          Length = 317

 Score = 86.3 bits (212), Expect = 2e-19
 Identities = 82/268 (30%), Positives = 116/268 (43%), Gaps = 59/268 (22%)

Query: 149 VTVAVVDTGI-YPHPDLEGRIIGFADMVNQKTEPY-----DDNGHGTHCAGDVXXXXXXX 202
           + VAV+DTG+ Y HPDL   I      +  K         D NGHGTH  G +       
Sbjct: 29  IQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDI 88

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCI-------------QYNEDNPDE 249
                G AP   +  V+VL+ +GSG+ +DI  G+E  I                      
Sbjct: 89  GVV--GVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPXXXXXXXXXXXXXXXXXXX 146

Query: 250 PIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEK 309
             +++SMSLGG A       +  L   + +A++AGIV+  A+GN G             +
Sbjct: 147 XXEVISMSLGGPA------DDSYLYDMIIQAYNAGIVIVAASGNEG--XXXXXXXXXXXE 198

Query: 310 VITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
           VI VG              +ASFS+R        +P++ APGV+I+S     +Y D    
Sbjct: 199 VIAVG-------AIDSNDNIASFSNR--------QPEVSAPGVDILS-----TYPD---- 234

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALI 397
                  Y T+ GT MATP  +G+ ALI
Sbjct: 235 -----DSYETLMGT-MATPHVSGVVALI 256


>1av7A [c.41.1 (1selA)] SUBTILISIN CARLSBERG, TYPE VIII
          Length = 273

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 87/298 (29%), Positives = 121/298 (40%), Gaps = 50/298 (16%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXX 200
           Q   G  V VAV+DTGI   HPDL   ++G A  V  +    D NGHGTH AG V     
Sbjct: 19  QGFKGANVKVAVLDTGIQASHPDLN--VVGGASFVAGEAYNTDGNGHGTHVAGTVAALDN 76

Query: 201 XXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGG 260
                  G AP  +L  VKVLN             +EW            +D+++MSLGG
Sbjct: 77  TTGVL--GVAPSVSLYAVKVLNXXXXXXXXXXXXXIEWATTNG-------MDVINMSLGG 127

Query: 261 DALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQT--IASPGVSEKVITVGXXXX 318
            +          + +AV+ A++                    I  P   + VI VG    
Sbjct: 128 AS------GSTAMKQAVDNAYARXXXXXXXXXXXXXXXXXXXIGYPAKYDSVIAVGAVDS 181

Query: 319 XXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYF 378
                      ASFSS G  +      +++APG  + S    N+Y               
Sbjct: 182 NSNR-------ASFSSVGAEL------EVMAPGAGVYSTYPTNTYA-------------- 214

Query: 379 TMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
           T++GT MA+P  AG AALIL ++P+L+  +V+  L +            YG G +N E
Sbjct: 215 TLNGT-MASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSS--FYYGKGLINVE 269


>2b6nA [x.x.x] PROTEINASE K
          Length = 278

 Score = 78.6 bits (192), Expect = 3e-17
 Identities = 80/270 (29%), Positives = 105/270 (38%), Gaps = 46/270 (17%)

Query: 146 GKGVTVAVVDTGIY-PHPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXX 204
           G GVT  V+DTG+   H +  GR     D ++   +  D NGHGTH AG +         
Sbjct: 30  GSGVTAFVIDTGVLNTHNEFGGRASSGYDFIDNDYDATDCNGHGTHVAGTIGGSTY---- 85

Query: 205 QYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALR 264
              G                GSG+ + +I G+ W ++ N   P     + +MSLGG A  
Sbjct: 86  ---GXXXXXXXXXXXXXXCSGSGSNSGVIAGINW-VKNNASGP----AVANMSLGGGA-- 135

Query: 265 YDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXX 324
                              GI   VAAGN   ++    SP  +   ITVG          
Sbjct: 136 -----SQXXXXXXXXXXXXGITFVVAAGNDNSNACNY-SPARAADAITVG---------- 179

Query: 325 XXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTS 384
                          YG    DI APG                           T+SGTS
Sbjct: 180 --XXXXXXXXXXXXXYG-TCLDIYAPGXXXXXXXXXXXXATN------------TISGTS 224

Query: 385 MATPICAGIAALILQQNPDLTPDEVKELLK 414
           MA+P  AG+AAL L +NP+L+P +V  LLK
Sbjct: 225 MASPHVAGVAALYLDENPNLSPAQVTNLLK 254


>1r6vA [c.41.1] SUBTILISIN-LIKE SERINE PROTEASE
          Length = 671

 Score = 74.3 bits (181), Expect = 6e-16
 Identities = 80/287 (27%), Positives = 120/287 (41%), Gaps = 42/287 (14%)

Query: 145 TGKGVTVAVVDTGIY-PHPDLEGRII-GFADMVNQKTEPYDDNGHG----THCAGDVXXX 198
           +G  + VAVVDTG+   HPDLEG++I G+    +++     D+ +G    TH AG +   
Sbjct: 152 SGTNIIVAVVDTGVDGTHPDLEGQVIAGYRPAFDEELPAGTDSSYGGSAGTHVAGTIAAK 211

Query: 199 XXXXXXQYRGPAPEANLIGVKVLNKQG------SGTLADIIEGVEWCIQYNEDNPDEPID 252
                    G AP A ++ + + +                  G+ W         D    
Sbjct: 212 KDGKGIV--GVAPGAKIMPIVIFDDPALXXXXXXXXXXXXAAGIIWAT-------DHGAK 262

Query: 253 IMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVIT 312
           +M+ S GG    Y  ++      A + A   G+V+ V+AGN+  DS     P     VI 
Sbjct: 263 VMNHSWGGWGYSYTMKE------AFDYAMEHGVVMVVSAGNNTSDSHH-QYPAGYPGVIQ 315

Query: 313 VGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSR 372
           V               VA FSSR   V       + APGV I+S       I     +  
Sbjct: 316 VAALDYYGGTFR----VAGFSSRSDGV------SVGAPGVTILSTVPGEDSIGYEGHNEN 365

Query: 373 V----GSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKN 415
           V    G  Y    GTSMA P   G+ A++LQ+ P+  P ++++LL+N
Sbjct: 366 VPATNGGTYDYYQGTSMAAPHVTGVVAVLLQKFPNAKPWQIRKLLEN 412


>1c9nA [c.41.1] SERINE PROTEASE
          Length = 268

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/107 (40%), Positives = 51/107 (47%), Gaps = 4/107 (3%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL   I G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVRVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEW 238
           AG +            G AP A L  VKVL          I +G+EW
Sbjct: 67  AGTIAALNNSIG--VLGVAPSAELYAVKVLXXXXXXXXXXIAQGLEW 111



 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 41/107 (38%), Positives = 57/107 (53%), Gaps = 23/107 (21%)

Query: 330 ASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPI 389
           ASFS  G  +      DI+APGVN+              +S+  GS Y +++GT MATP 
Sbjct: 181 ASFSQYGAGL------DIVAPGVNV--------------QSTYPGSTYASLNGT-MATPH 219

Query: 390 CAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
            AG AAL+ Q+NP  +  +++  LKN          N+YG+G VNAE
Sbjct: 220 VAGAAALVKQKNPSWSNVQIRNHLKNTATSL--GSTNLYGSGLVNAE 264


>1c9jA [c.41.1] SERINE PROTEASE
          Length = 269

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/107 (40%), Positives = 51/107 (47%), Gaps = 4/107 (3%)

Query: 132 SHAKEVVRNGQTLTGKGVTVAVVDTGIYPHPDLEGRIIGFADMVNQKTEPYDDNGHGTHC 191
           S  +    + + LTG GV VAV+DTGI  HPDL   I G A  V  +    D NGHGTH 
Sbjct: 9   SRVQAPAAHNRGLTGSGVRVAVLDTGISTHPDL--NIRGGASFVPGEPSTQDGNGHGTHV 66

Query: 192 AGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEW 238
           AG +            G AP A L  VKVL          I +G+EW
Sbjct: 67  AGTIAALNNSIG--VLGVAPSAELYAVKVLXXXXXXXXXXIAQGLEW 111



 Score = 62.4 bits (150), Expect = 2e-12
 Identities = 42/107 (39%), Positives = 58/107 (54%), Gaps = 22/107 (20%)

Query: 330 ASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPI 389
           ASFS  G  +      DI+APGVN+              +S+  GS Y +++GTSMATP 
Sbjct: 181 ASFSQYGAGL------DIVAPGVNV--------------QSTYPGSTYASLNGTSMATPH 220

Query: 390 CAGIAALILQQNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAE 436
            AG AAL+ Q+NP  +  +++  LKN          N+YG+G VNAE
Sbjct: 221 VAGAAALVKQKNPSWSNVQIRNHLKNTATSL--GSTNLYGSGLVNAE 265


>1ic6A [c.41.1] PROTEINASE K
          Length = 279

 Score = 62.4 bits (150), Expect = 2e-12
 Identities = 44/97 (45%), Positives = 54/97 (55%), Gaps = 17/97 (17%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPY---DDNGHGTHCAGDVXXXXXX 201
           G+G  V V+DTGI   HP+ EGR    A MV  KT  Y   D NGHGTHCAG V      
Sbjct: 30  GQGSCVYVIDTGIEASHPEFEGR----AQMV--KTYYYSSRDGNGHGTHCAGTV------ 77

Query: 202 XXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEW 238
              +  G A +  L GVKVL+  GSG  + II G+++
Sbjct: 78  -GSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDF 113


>3dw3X [c.41.1 (1bjrE)] PROTEINASE K
          Length = 279

 Score = 62.4 bits (150), Expect = 2e-12
 Identities = 44/97 (45%), Positives = 54/97 (55%), Gaps = 17/97 (17%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPY---DDNGHGTHCAGDVXXXXXX 201
           G+G  V V+DTGI   HP+ EGR    A MV  KT  Y   D NGHGTHCAG V      
Sbjct: 30  GQGSCVYVIDTGIEASHPEFEGR----AQMV--KTYYYSSRDGNGHGTHCAGTV------ 77

Query: 202 XXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEW 238
              +  G A +  L GVKVL+  GSG  + II G+++
Sbjct: 78  -GSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDF 113


>1ht3A [c.41.1] PROTEINASE K
          Length = 279

 Score = 60.8 bits (146), Expect = 7e-12
 Identities = 43/97 (44%), Positives = 53/97 (54%), Gaps = 17/97 (17%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPY---DDNGHGTHCAGDVXXXXXX 201
           G+G  V V+DTGI   HP+ EGR    A MV  KT  Y   D NGHGTHCAG V      
Sbjct: 30  GQGSCVYVIDTGIEASHPEFEGR----AQMV--KTYYYSSRDGNGHGTHCAGTV------ 77

Query: 202 XXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEW 238
              +  G   +  L GVKVL+  GSG  + II G+++
Sbjct: 78  -GSRTYGVVKKTQLFGVKVLDDNGSGQYSTIIAGMDF 113


>2w2qA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 275

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 76/294 (25%), Positives = 115/294 (39%), Gaps = 45/294 (15%)

Query: 149 VTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXXQYR 207
           V V ++DT I   H ++EGR++   D  N   E    + HGTH AG V            
Sbjct: 16  VEVYLLDTSIQSDHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA------- 67

Query: 208 GPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDH 267
           G A  A++  ++VLN QG GT++  + G+E    +   +                  Y  
Sbjct: 68  GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR 123

Query: 268 EQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXXXXX 327
                L  A +    AG+V+  AAGN   D+  + SP  + +VITVG             
Sbjct: 124 ----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGT 178

Query: 328 XVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMAT 387
              +F   G  V      D+ APG +II              SS   + + + SGTS   
Sbjct: 179 LGTNF---GRCV------DLFAPGEDIIG------------ASSHCSTCFVSQSGTSQXX 217

Query: 388 PICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
                   ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 218 XXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 271


>2w2mA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 277

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 77/297 (25%), Positives = 116/297 (39%), Gaps = 45/297 (15%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXX 204
           G  V V ++DT I   H ++EGR++   D  N   E    + HGTH AG V         
Sbjct: 15  GSLVEVYLLDTSIQSDHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA---- 69

Query: 205 QYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALR 264
              G A  A++  ++VLN QG GT++  + G+E    +   +                  
Sbjct: 70  ---GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXX 122

Query: 265 YDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXX 324
           Y       L  A +    AG+V+  AAGN   D+  + SP  + +VITVG          
Sbjct: 123 YSR----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVT 177

Query: 325 XXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTS 384
                 +F   G  V      D+ APG +II              SS   + + + SGTS
Sbjct: 178 LGTLGTNF---GRCV------DLFAPGEDIIG------------ASSDCSTCFVSQSGTS 216

Query: 385 MATPICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
                      ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 217 QXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 273


>3gcwA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 434

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 77/297 (25%), Positives = 116/297 (39%), Gaps = 45/297 (15%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXX 204
           G  V V ++DT I   H ++EGR++   D  N   E    + HGTH AG V         
Sbjct: 21  GSLVEVYLLDTSIQSDHREIEGRVM-VTDFENVPEEASKCDSHGTHLAGVVSGRDA---- 75

Query: 205 QYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALR 264
              G A  A++  ++VLN QG GT++  + G+E    +   +                  
Sbjct: 76  ---GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXX 128

Query: 265 YDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXX 324
           Y       L  A +    AG+V+  AAGN   D+  + SP  + +VITVG          
Sbjct: 129 YSR----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVT 183

Query: 325 XXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTS 384
                 +F   G  V      D+ APG +II              SS   + + + SGTS
Sbjct: 184 LGTLGTNF---GRCV------DLFAPGEDIIG------------ASSDCSTCFVSQSGTS 222

Query: 385 MATPICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
                      ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 223 QXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 279


>3bpsA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 435

 Score = 58.9 bits (141), Expect = 3e-11
 Identities = 77/297 (25%), Positives = 116/297 (39%), Gaps = 45/297 (15%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXX 204
           G  V V ++DT I   H ++EGR++   D  N   E    + HGTH AG V         
Sbjct: 21  GSLVEVYLLDTSIQSDHREIEGRVM-VTDFENVPEEASKCDSHGTHLAGVVSGRDA---- 75

Query: 205 QYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALR 264
              G A  A++  ++VLN QG GT++  + G+E    +   +                  
Sbjct: 76  ---GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXX 128

Query: 265 YDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXX 324
           Y       L  A +    AG+V+  AAGN   D+  + SP  + +VITVG          
Sbjct: 129 YSR----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVT 183

Query: 325 XXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTS 384
                 +F   G  V      D+ APG +II              SS   + + + SGTS
Sbjct: 184 LGTLGTNF---GRCV------DLFAPGEDIIG------------ASSDCSTCFVSQSGTS 222

Query: 385 MATPICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
                      ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 223 QXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 279


>2w2pA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 274

 Score = 58.5 bits (140), Expect = 4e-11
 Identities = 76/294 (25%), Positives = 115/294 (39%), Gaps = 45/294 (15%)

Query: 149 VTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXXQYR 207
           V V ++DT I   H ++EGR++   D  N   E    + HGTH AG V            
Sbjct: 15  VEVYLLDTSIQSDHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA------- 66

Query: 208 GPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDH 267
           G A  A++  ++VLN QG GT++  + G+E    +   +                  Y  
Sbjct: 67  GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR 122

Query: 268 EQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXXXXX 327
                L  A +    AG+V+  AAGN   D+  + SP  + +VITVG             
Sbjct: 123 ----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGT 177

Query: 328 XVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMAT 387
              +F   G  V      D+ APG +II              SS   + + + SGTS   
Sbjct: 178 LGTNF---GRCV------DLFAPGEDIIG------------ASSACSTCFVSQSGTSQXX 216

Query: 388 PICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
                   ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 217 XXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 270


>2w2oA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 274

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 76/294 (25%), Positives = 115/294 (39%), Gaps = 45/294 (15%)

Query: 149 VTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXXQYR 207
           V V ++DT I   H ++EGR++   D  N   E    + HGTH AG V            
Sbjct: 16  VEVYLLDTSIQSDHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA------- 67

Query: 208 GPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDH 267
           G A  A++  ++VLN QG GT++  + G+E    +   +                  Y  
Sbjct: 68  GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR 123

Query: 268 EQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXXXXX 327
                L  A +    AG+V+  AAGN   D+  + SP  + +VITVG             
Sbjct: 124 ----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGT 178

Query: 328 XVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMAT 387
              +F   G  V      D+ APG +II              SS   + + + SGTS   
Sbjct: 179 LGTNF---GRCV------DLFAPGEDIIG------------ASSYCSTCFVSQSGTSQXX 217

Query: 388 PICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
                   ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 218 XXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 271


>2w2nA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 273

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 76/294 (25%), Positives = 115/294 (39%), Gaps = 45/294 (15%)

Query: 149 VTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXXXQYR 207
           V V ++DT I   H ++EGR++   D  N   E    + HGTH AG V            
Sbjct: 15  VEVYLLDTSIQSDHREIEGRVM-VTDFENVPEEDSKCDSHGTHLAGVVSGRDA------- 66

Query: 208 GPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDALRYDH 267
           G A  A++  ++VLN QG GT++  + G+E    +   +                  Y  
Sbjct: 67  GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXXXYSR 122

Query: 268 EQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXXXXXX 327
                L  A +    AG+V+  AAGN   D+  + SP  + +VITVG             
Sbjct: 123 ----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPVTLGT 177

Query: 328 XVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMAT 387
              +F   G  V      D+ APG +II              SS   + + + SGTS   
Sbjct: 178 LGTNF---GRCV------DLFAPGEDIIG------------ASSDCSTCFVSQSGTSQXX 216

Query: 388 PICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
                   ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 217 XXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 270


>1r64A [c.41.1 - b.18.1] KEXIN
          Length = 481

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 79/323 (24%), Positives = 122/323 (37%), Gaps = 60/323 (18%)

Query: 144 LTGKGVTVAVVDTGI-YPHPDLEGRIIG-----FADMVNQKTEPYDDNGHGTHCAGDVXX 197
           +TG GV  A+VD G+ Y + DL+          F D  N       D+ HGT CAG++  
Sbjct: 44  ITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGEIAA 103

Query: 198 XXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMS 257
                     G    A + G+++L+  G  T  D    + + +  N        DI S S
Sbjct: 104 KKGNNFCGV-GVGYNAKISGIRILS--GDITTEDEAASLIYGLDVN--------DIYSCS 152

Query: 258 LG-GDALRYDHEQED----PLVRAVEEAW-SAGIVVCVAAGNSGPDSQTIASPGVSEKV- 310
            G  D  R+     D     LV+ V E   S G +   A+GN G         G +  + 
Sbjct: 153 WGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIY 212

Query: 311 -ITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
            IT+G                         Y +    ++A    +        YI     
Sbjct: 213 SITIGAIDHKDLHPP---------------YSEGCSAVMA----VTYSSGSGEYIHSSDI 253

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELL--------KNGTDKWK 421
           + R  + +    GTS A P+ AG+  L+L+ NP+LT  +V+ L         KN    W+
Sbjct: 254 NGRCSNSH---GGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSILSAVGLEKNADGDWR 310

Query: 422 D-----EDPNIYGAGAVNAENSV 439
           D     +  + YG G ++A   +
Sbjct: 311 DSAMGKKYSHRYGFGKIDAHKLI 333


>1ot5A [c.41.1 - b.18.1] KEXIN
          Length = 477

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 79/323 (24%), Positives = 122/323 (37%), Gaps = 60/323 (18%)

Query: 144 LTGKGVTVAVVDTGI-YPHPDLEGRIIG-----FADMVNQKTEPYDDNGHGTHCAGDVXX 197
           +TG GV  A+VD G+ Y + DL+          F D  N       D+ HGT CAG++  
Sbjct: 42  ITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGEIAA 101

Query: 198 XXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMS 257
                     G    A + G+++L+  G  T  D    + + +  N        DI S S
Sbjct: 102 KKGNNFCGV-GVGYNAKISGIRILS--GDITTEDEAASLIYGLDVN--------DIYSCS 150

Query: 258 LG-GDALRYDHEQED----PLVRAVEEAW-SAGIVVCVAAGNSGPDSQTIASPGVSEKV- 310
            G  D  R+     D     LV+ V E   S G +   A+GN G         G +  + 
Sbjct: 151 WGPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIY 210

Query: 311 -ITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQK 369
            IT+G                         Y +    ++A    +        YI     
Sbjct: 211 SITIGAIDHKDLHPP---------------YSEGCSAVMA----VTYSSGSGEYIHSSDI 251

Query: 370 SSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELL--------KNGTDKWK 421
           + R  + +    GTS A P+ AG+  L+L+ NP+LT  +V+ L         KN    W+
Sbjct: 252 NGRCSNSH---GGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSILSAVGLEKNADGDWR 308

Query: 422 D-----EDPNIYGAGAVNAENSV 439
           D     +  + YG G ++A   +
Sbjct: 309 DSAMGKKYSHRYGFGKIDAHKLI 331


>2id4B [x.x.x] KEXIN
          Length = 478

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 79/322 (24%), Positives = 122/322 (37%), Gaps = 59/322 (18%)

Query: 144 LTGKGVTVAVVDTGI-YPHPDLEGRII----GFADMVNQKTEPYDDNGHGTHCAGDVXXX 198
           +TG GV  A+VD G+ Y + DL+         F D  N       D+ HGT CAG++   
Sbjct: 43  ITGAGVVAAIVDDGLDYENEDLKDNFAEGSWDFNDNTNLPKPRLSDDYHGTRCAGEIAAK 102

Query: 199 XXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSL 258
                    G    A + G+++L+  G  T  D    + + +  N        DI S S 
Sbjct: 103 KGNNFCGV-GVGYNAKISGIRILS--GDITTEDEAASLIYGLDVN--------DIYSCSW 151

Query: 259 G-GDALRYDHEQED----PLVRAVEEAW-SAGIVVCVAAGNSGPDSQTIASPGVSEKV-- 310
           G  D  R+     D     LV+ V E   S G +   A+GN G         G +  +  
Sbjct: 152 GPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIYS 211

Query: 311 ITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKS 370
           IT+G                         Y +    ++A    +        YI     +
Sbjct: 212 ITIGAIDHKDLHPP---------------YSEGCSAVMA----VTYSSGSGEYIHSSDIN 252

Query: 371 SRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELL--------KNGTDKWKD 422
            R  + +    GTS A P+ AG+  L+L+ NP+LT  +V+ L         KN    W+D
Sbjct: 253 GRCSNSH---GGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSILSAVGLEKNADGDWRD 309

Query: 423 -----EDPNIYGAGAVNAENSV 439
                +  + YG G ++A   +
Sbjct: 310 SAMGKKYSHRYGFGKIDAHKLI 331


>2id4A [x.x.x] KEXIN
          Length = 479

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 79/322 (24%), Positives = 122/322 (37%), Gaps = 59/322 (18%)

Query: 144 LTGKGVTVAVVDTGI-YPHPDLEGRII----GFADMVNQKTEPYDDNGHGTHCAGDVXXX 198
           +TG GV  A+VD G+ Y + DL+         F D  N       D+ HGT CAG++   
Sbjct: 43  ITGAGVVAAIVDDGLDYENEDLKDNFAEGSWDFNDNTNLPKPRLSDDYHGTRCAGEIAAK 102

Query: 199 XXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSL 258
                    G    A + G+++L+  G  T  D    + + +  N        DI S S 
Sbjct: 103 KGNNFCGV-GVGYNAKISGIRILS--GDITTEDEAASLIYGLDVN--------DIYSCSW 151

Query: 259 G-GDALRYDHEQED----PLVRAVEEAW-SAGIVVCVAAGNSGPDSQTIASPGVSEKV-- 310
           G  D  R+     D     LV+ V E   S G +   A+GN G         G +  +  
Sbjct: 152 GPADDGRHLQGPSDLVKKALVKGVTEGRDSKGAIYVFASGNGGTRGDNCNYDGYTNSIYS 211

Query: 311 ITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKS 370
           IT+G                         Y +    ++A    +        YI     +
Sbjct: 212 ITIGAIDHKDLHPP---------------YSEGCSAVMA----VTYSSGSGEYIHSSDIN 252

Query: 371 SRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELL--------KNGTDKWKD 422
            R  + +    GTS A P+ AG+  L+L+ NP+LT  +V+ L         KN    W+D
Sbjct: 253 GRCSNSH---GGTSAAAPLAAGVYTLLLEANPNLTWRDVQYLSILSAVGLEKNADGDWRD 309

Query: 423 -----EDPNIYGAGAVNAENSV 439
                +  + YG G ++A   +
Sbjct: 310 SAMGKKYSHRYGFGKIDAHKLI 331


>3eifA [x.x.x] C5A PEPTIDASE
          Length = 936

 Score = 56.2 bits (134), Expect = 2e-10
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 22/108 (20%)

Query: 329 VASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATP 388
           ++ FSS G T  G  KPDI APG +I+              SS   ++Y  +SGTSM+ P
Sbjct: 375 LSRFSSWGLTADGNIKPDIAAPGQDIL--------------SSVANNKYAKLSGTSMSAP 420

Query: 389 ICAGIAALILQ----QNPDLTPDE----VKELLKNGTDKWKDEDPNIY 428
           + AGI  L+ +    Q PD+TP E     K++L +      DED   Y
Sbjct: 421 LVAGIMGLLQKQYETQYPDMTPSERLDLAKKVLMSSATALYDEDEKAY 468


>2pmwB [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 489

 Score = 55.8 bits (133), Expect = 2e-10
 Identities = 76/299 (25%), Positives = 118/299 (39%), Gaps = 48/299 (16%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRII--GFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXX 202
           G  V V ++DT I   H ++EGR++   F ++  ++    D   HGTH AG V       
Sbjct: 17  GSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEQASKCDS--HGTHLAGVVSGRDA-- 72

Query: 203 XXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDA 262
                G A  A++  ++VLN QG GT++  + G+E    +   +                
Sbjct: 73  -----GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXX 123

Query: 263 LRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXX 322
             Y       L  A +    AG+V+  AAGN   D+  + SP  + +VITVG        
Sbjct: 124 XXYSR----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQP 178

Query: 323 XXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSG 382
                   +F   G  V      D+ APG +II              SS   + + + SG
Sbjct: 179 VTLGTLGTNF---GRCV------DLFAPGEDIIG------------ASSDCSTCFVSQSG 217

Query: 383 TSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
           TS           ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 218 TSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 276


>2qtwB [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 486

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 77/298 (25%), Positives = 116/298 (38%), Gaps = 46/298 (15%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDD-NGHGTHCAGDVXXXXXXXX 203
           G  V V ++DT I   H ++EGR++   D  N   E     + HGTH AG V        
Sbjct: 17  GSLVEVYLLDTSIQSDHREIEGRVM-VTDFENVPEEDASKCDSHGTHLAGVVSGRDA--- 72

Query: 204 XQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDAL 263
               G A  A++  ++VLN QG GT++  + G+E    +   +                 
Sbjct: 73  ----GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXX 124

Query: 264 RYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXX 323
            Y       L  A +    AG+V+  AAGN   D+  + SP  + +VITVG         
Sbjct: 125 XYSR----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPV 179

Query: 324 XXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGT 383
                  +F   G  V      D+ APG +II              SS   + + + SGT
Sbjct: 180 TLGTLGTNF---GRCV------DLFAPGEDIIG------------ASSDCSTCFVSQSGT 218

Query: 384 SMATPICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
           S           ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 219 SQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 276


>2p4eA [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 494

 Score = 55.5 bits (132), Expect = 3e-10
 Identities = 75/298 (25%), Positives = 118/298 (39%), Gaps = 45/298 (15%)

Query: 146 GKGVTVAVVDTGIYP-HPDLEGRI-IGFADMVNQKTEPYDDNGHGTHCAGDVXXXXXXXX 203
           G  V V ++DT I   H ++EGR+ +   + V ++ +    + HGTH AG V        
Sbjct: 18  GSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDQASKCDSHGTHLAGVVSGRDA--- 74

Query: 204 XQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSMSLGGDAL 263
               G A  A++  ++VLN QG GT++  + G+E    +   +                 
Sbjct: 75  ----GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXXXXXXXXX 126

Query: 264 RYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXXXXXXXXX 323
            Y       L  A +    AG+V+  AAGN   D+  + SP  + +VITVG         
Sbjct: 127 XYSR----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGATNAQDQPV 181

Query: 324 XXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGT 383
                  +F   G  V      D+ APG +II              SS   + + + SGT
Sbjct: 182 TLGTLGTNF---GRCV------DLFAPGEDIIG------------ASSDCSTCFVSQSGT 220

Query: 384 SMATPICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGAGAVNA 435
           S           ++L   P+LT  E+++ L + + K      W  ED  +     V A
Sbjct: 221 SQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAA 278


>3h42B [x.x.x] PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
          Length = 492

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 75/305 (24%), Positives = 118/305 (38%), Gaps = 59/305 (19%)

Query: 149 VTVAVVDTGIYP-HPDLEGRIIGFADMVNQKTEPYDD-----------NGHGTHCAGDVX 196
           V V ++DT I   H ++EGR++    + + +  P +D           + HGTH AG V 
Sbjct: 17  VEVYLLDTSIQSDHREIEGRVM----VTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVS 72

Query: 197 XXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPIDIMSM 256
                      G A  A++  ++VLN QG GT++  + G+E    +   +          
Sbjct: 73  GRDA-------GVAKGASMRSLRVLNCQGKGTVSGTLIGLE----FIRKSXXXXXXXXXX 121

Query: 257 SLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSGPDSQTIASPGVSEKVITVGXX 316
                   Y       L  A +    AG+V+  AAGN   D+  + SP  + +VITVG  
Sbjct: 122 XXXXXXXXYSR----VLNAACQRLARAGVVLVTAAGNFRDDA-CLYSPASAPEVITVGAT 176

Query: 317 XXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQ 376
                         +F   G  V      D+ APG +II              SS   + 
Sbjct: 177 NAQDQPVTLGTLGTNF---GRCV------DLFAPGEDIIG------------ASSDCSTC 215

Query: 377 YFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELLKNGTDK------WKDEDPNIYGA 430
           + + SGTS           ++L   P+LT  E+++ L + + K      W  ED  +   
Sbjct: 216 FVSQSGTSQXXXXXXXXXXMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTP 275

Query: 431 GAVNA 435
             V A
Sbjct: 276 NLVAA 280


>1xf1A [x.x.x] C5A PEPTIDASE
          Length = 910

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 41/107 (38%), Positives = 53/107 (49%), Gaps = 24/107 (22%)

Query: 329 VASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATP 388
           ++ FSS G T  G  KPDI APG +I+              SS   ++Y  +SGTS A P
Sbjct: 361 LSRFSSWGLTADGNIKPDIAAPGQDIL--------------SSVANNKYAKLSGTSSA-P 405

Query: 389 ICAGIAALILQ---QNPDLTPDE----VKELLKNGTDKWKDEDPNIY 428
           + AGI  L  Q   Q PD TP E     K++L + T  + DED   Y
Sbjct: 406 LVAGIGLLQKQYETQYPD-TPSERLDLAKKVLSSATALY-DEDEKAY 450


>1p8jH [c.41.1 - b.18.1] FURIN PRECURSOR
          Length = 466

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 78/290 (26%), Positives = 120/290 (41%), Gaps = 50/290 (17%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFA--DMVNQKTEP------YDDNGHGTHCA 192
           Q  TG G+ V+++D GI   HPDL G     A  D+ +Q  +P       +DN HGT   
Sbjct: 31  QGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRXX 90

Query: 193 GDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPID 252
                               A + GV++L+    G + D +E     +  N       I 
Sbjct: 91  XXXXXXXXXXXXXXXXXY-NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IH 139

Query: 253 IMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGI---------VVCVAAGNSGPDSQTIAS 303
           I S S G +    D +  D   R  EEA+  G+         +   A+GN G +  +   
Sbjct: 140 IYSASWGPED---DGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNC 196

Query: 304 PGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSY 363
            G +  + T+                A  S+   T     + +       I++       
Sbjct: 197 DGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE-----KQIVT------- 244

Query: 364 IDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELL 413
            D  QK +       + +GTS + P+ AGI AL L+ N +LT  +++ L+
Sbjct: 245 TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV 288


>1p8jF [c.41.1 - b.18.1] FURIN PRECURSOR
          Length = 468

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 78/290 (26%), Positives = 120/290 (41%), Gaps = 50/290 (17%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFA--DMVNQKTEP------YDDNGHGTHCA 192
           Q  TG G+ V+++D GI   HPDL G     A  D+ +Q  +P       +DN HGT   
Sbjct: 33  QGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRXX 92

Query: 193 GDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPID 252
                               A + GV++L+    G + D +E     +  N       I 
Sbjct: 93  XXXXXXXXXXXXXXXXXY-NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IH 141

Query: 253 IMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGI---------VVCVAAGNSGPDSQTIAS 303
           I S S G +    D +  D   R  EEA+  G+         +   A+GN G +  +   
Sbjct: 142 IYSASWGPED---DGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNC 198

Query: 304 PGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSY 363
            G +  + T+                A  S+   T     + +       I++       
Sbjct: 199 DGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE-----KQIVT------- 246

Query: 364 IDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELL 413
            D  QK +       + +GTS + P+ AGI AL L+ N +LT  +++ L+
Sbjct: 247 TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV 290


>1p8jC [c.41.1 - b.18.1] FURIN PRECURSOR
          Length = 467

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 78/290 (26%), Positives = 120/290 (41%), Gaps = 50/290 (17%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFA--DMVNQKTEP------YDDNGHGTHCA 192
           Q  TG G+ V+++D GI   HPDL G     A  D+ +Q  +P       +DN HGT   
Sbjct: 32  QGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRXX 91

Query: 193 GDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPID 252
                               A + GV++L+    G + D +E     +  N       I 
Sbjct: 92  XXXXXXXXXXXXXXXXXY-NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IH 140

Query: 253 IMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGI---------VVCVAAGNSGPDSQTIAS 303
           I S S G +    D +  D   R  EEA+  G+         +   A+GN G +  +   
Sbjct: 141 IYSASWGPED---DGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNC 197

Query: 304 PGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSY 363
            G +  + T+                A  S+   T     + +       I++       
Sbjct: 198 DGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE-----KQIVT------- 245

Query: 364 IDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELL 413
            D  QK +       + +GTS + P+ AGI AL L+ N +LT  +++ L+
Sbjct: 246 TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV 289


>1p8jB [c.41.1 - b.18.1] FURIN PRECURSOR
          Length = 468

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 78/290 (26%), Positives = 120/290 (41%), Gaps = 50/290 (17%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFA--DMVNQKTEP------YDDNGHGTHCA 192
           Q  TG G+ V+++D GI   HPDL G     A  D+ +Q  +P       +DN HGT   
Sbjct: 32  QGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRXX 91

Query: 193 GDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPID 252
                               A + GV++L+    G + D +E     +  N       I 
Sbjct: 92  XXXXXXXXXXXXXXXXXY-NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IH 140

Query: 253 IMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGI---------VVCVAAGNSGPDSQTIAS 303
           I S S G +    D +  D   R  EEA+  G+         +   A+GN G +  +   
Sbjct: 141 IYSASWGPED---DGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNC 197

Query: 304 PGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSY 363
            G +  + T+                A  S+   T     + +       I++       
Sbjct: 198 DGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE-----KQIVT------- 245

Query: 364 IDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELL 413
            D  QK +       + +GTS + P+ AGI AL L+ N +LT  +++ L+
Sbjct: 246 TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV 289


>1p8jA [c.41.1 - b.18.1] FURIN PRECURSOR
          Length = 470

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 78/290 (26%), Positives = 120/290 (41%), Gaps = 50/290 (17%)

Query: 142 QTLTGKGVTVAVVDTGIYP-HPDLEGRIIGFA--DMVNQKTEP------YDDNGHGTHCA 192
           Q  TG G+ V+++D GI   HPDL G     A  D+ +Q  +P       +DN HGT   
Sbjct: 32  QGFTGHGIVVSILDDGIEKNHPDLAGNYDPGASFDVNDQDPDPQPRYTQMNDNRHGTRXX 91

Query: 193 GDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWCIQYNEDNPDEPID 252
                               A + GV++L+    G + D +E     +  N       I 
Sbjct: 92  XXXXXXXXXXXXXXXXXY-NARIGGVRMLD----GEVTDAVEARSLGLNPNH------IH 140

Query: 253 IMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGI---------VVCVAAGNSGPDSQTIAS 303
           I S S G +    D +  D   R  EEA+  G+         +   A+GN G +  +   
Sbjct: 141 IYSASWGPED---DGKTVDGPARLAEEAFFRGVSQGRGGLGSIFVWASGNGGREHDSCNC 197

Query: 304 PGVSEKVITVGXXXXXXXXXXXXXXVASFSSRGPTVYGKEKPDILAPGVNIISLRSPNSY 363
            G +  + T+                A  S+   T     + +       I++       
Sbjct: 198 DGYTNSIYTLSISSATQFGNVPWYSEACSSTLATTYSSGNQNE-----KQIVT------- 245

Query: 364 IDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQQNPDLTPDEVKELL 413
            D  QK +       + +GTS + P+ AGI AL L+ N +LT  +++ L+
Sbjct: 246 TDLRQKCTE------SHTGTSASAPLAAGIIALTLEANKNLTWRDMQHLV 289


>1v6cB [c.41.1] ALKALINE SERINE PROTEASE
          Length = 436

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 27/116 (23%), Positives = 49/116 (42%), Gaps = 12/116 (10%)

Query: 180 EPYDDNGHGTHCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWC 239
           +P ++N HGTH AG +             P   AN+  VKV N+ G G  + ++  ++ C
Sbjct: 58  QPGNNNAHGTHVAGTIAAIANNEGVVGVMPNQNANIHIVKVFNEAGWGYSSSLVAAIDTC 117

Query: 240 IQYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSG 295
           +     N      +++M                   A+   ++ G+++  AAGN+G
Sbjct: 118 VNSGGAN------VVTMXXXXXXXXXXER------NALNTHYNNGVLLIAAAGNAG 161



 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 16/100 (16%)

Query: 346 DILAPGVNI-----ISLRSPNSYIDKLQKSSRVGSQ----YFTMSGTSMATPICAGIAAL 396
           DI  P V++     ++L++      KL +S+ V +Q    Y   +GTSMATP  +G+A L
Sbjct: 328 DITVPSVSVDRATGLALKA------KLGQSTTVSNQGNQDYEYYNGTSMATPHVSGVATL 381

Query: 397 ILQQNPDLTPDEVKELLKNGTDKWKDED-PNIYGAGAVNA 435
           +   +P+ +  +V+  L    D        N  G G +NA
Sbjct: 382 VWSYHPECSASQVRAALNATADDLSVAGRDNQTGYGMINA 421


>1v6cA [c.41.1] ALKALINE SERINE PROTEASE
          Length = 435

 Score = 39.7 bits (91), Expect = 2e-05
 Identities = 27/116 (23%), Positives = 49/116 (42%), Gaps = 12/116 (10%)

Query: 180 EPYDDNGHGTHCAGDVXXXXXXXXXQYRGPAPEANLIGVKVLNKQGSGTLADIIEGVEWC 239
           +P ++N HGTH AG +             P   AN+  VKV N+ G G  + ++  ++ C
Sbjct: 58  QPGNNNAHGTHVAGTIAAIANNEGVVGVMPNQNANIHIVKVFNEAGWGYSSSLVAAIDTC 117

Query: 240 IQYNEDNPDEPIDIMSMSLGGDALRYDHEQEDPLVRAVEEAWSAGIVVCVAAGNSG 295
           +     N      +++M                   A+   ++ G+++  AAGN+G
Sbjct: 118 VNSGGAN------VVTMXXXXXXXXXXER------NALNTHYNNGVLLIAAAGNAG 161



 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 16/100 (16%)

Query: 346 DILAPGVNI-----ISLRSPNSYIDKLQKSSRVGSQ----YFTMSGTSMATPICAGIAAL 396
           DI  P V++     ++L++      KL +S+ V +Q    Y   +GTSMATP  +G+A L
Sbjct: 328 DITVPSVSVDRATGLALKA------KLGQSTTVSNQGNQDYEYYNGTSMATPHVSGVATL 381

Query: 397 ILQQNPDLTPDEVKELLKNGTDKWKDED-PNIYGAGAVNA 435
           +   +P+ +  +V+  L    D        N  G G +NA
Sbjct: 382 VWSYHPECSASQVRAALNATADDLSVAGRDNQTGYGMINA 421


>2iy9A [x.x.x] SUBA
          Length = 309

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 26/100 (26%), Positives = 38/100 (38%), Gaps = 14/100 (14%)

Query: 340 YGKEKPDILAPGVNIISLRSPNSYIDKLQKSSRVGSQYFTMSGTSMATPICAGIAALILQ 399
           +G    DI APG NI  LR                ++         AT I +G+ A +  
Sbjct: 219 FGNNWVDIAAPGQNITFLRPD--------------AKXXXXXXXXEATAIVSGVLAAMTS 264

Query: 400 QNPDLTPDEVKELLKNGTDKWKDEDPNIYGAGAVNAENSV 439
            NP  T  E+K  L    DK+      +     +NAE ++
Sbjct: 265 CNPRATATELKRTLLESADKYPSLVDKVTEGRVLNAEKAI 304


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.312    0.131    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 1,342,601,184
Number of extensions: 56317435
Number of successful extensions: 144005
Number of sequences better than 1.0e-03: 2204
Number of HSP's gapped: 140076
Number of HSP's successfully gapped: 3146
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.0 bits)