hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_6461.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: CAB13622.1
Accession:      [none]
Description:    bsub0 nrdE GIB00011CH01 "ribonucleoside-diphosphate reductase (major subu.."

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0042277  PFL-like glycyl radical enzymes                563.1     3e-165   1
0043302  PFL-like glycyl radical enzymes                534.1   1.6e-156   1
0042276  R1 subunit of ribonucleotide reductase, N-te   176.9    8.9e-51   1
0040352  PFL-like glycyl radical enzymes                136.4    8.9e-41   1
0049204  R1 subunit of ribonucleotide reductase, N-te    57.6    1.6e-15   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0042276    1/1       6   166 ..     1   162 []   176.9  8.9e-51
0049204    1/1      30   164 ..    82   212 .]    57.6  1.6e-15
0040352    1/1      73   682 ..     1   674 [.   136.4  8.9e-41
0042277    1/1     167   690 ..     1   525 []   563.1   3e-165
0043302    1/1     167   700 ..     1   525 []   534.1 1.6e-156

Alignments of top-scoring domains:
0042276: domain 1 of 1, from 6 to 166: score 176.9, E = 8.9e-51
                   *->ttkyiekvaikvladeigveefdkdyeAaklylfalvksvygqFssl
                        k+i++++++++  + g+ +fdkd+eA++ y+++++++++++F++l
  CAB13622.1     6    VPKWIQLNNEIMIQ-KDGKFQFDKDKEAVHSYFVDYINQNTVFFHNL 51   

                   ierldylveegyYddevlkkysreeilyleeyayskkdffltflGalkfy
                   +e+ldylve++yY++e l+ ys+e+i+++++ ay+kk++f++f+ a+kfy
  CAB13622.1    52 KEKLDYLVENQYYEEEFLSLYSFEDIKEVFKTAYAKKFRFPSFMSAFKFY 101  

                   ekYllktrdtkkylEtfedrvllvaltLaqgelelakdlldavllgrlqp
                   ++Y+lkt d+kk+lE++edr+ +val++a+g+ e+ak++++ +++++ qp
  CAB13622.1   102 NDYALKTNDKKKILERYEDRISIVALFFANGDTEKAKEYVNLMINQEYQP 151  

                   pTPtflgagkktRgekevlglfs..........igslyelikklveagllseellefysked
                      ke+++++ +++++++++ +++l+e++++lve  +++ee+l++ys ed
  CAB13622.1    30    KEAVHSYFvdyinqntvfFHNLKEKLDYLVENQYYEEEFLSLYSFED 76   

                   leeldsaidperDllftYlGlktLedrYllkdridgeilElPQemfmrvA
                   ++e  +  + ++ ++ +++ +  ++++Y lk++ +++ilE+ + +  +vA
  CAB13622.1    77 IKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKKILERYEDRISIVA 126  

                   mgLalnekkedrldlviefYdllsslkftlaTPtLfnagtplpQrlslveeliellklevspalqplalpvflrkYsrktedgg.lretwd
                       +++ +e+++  + + + +++ ++   f+  Y++kt+d++++ e ++
  CAB13622.1    73    SFEDIKEVFKTAYAKKFRFPSFMSAFKFYNDYALKTNDKKkILERYE 119  

                   evveRvarglalleerllgalsseleelleeeleellellrnlkalPsGr
                   +    va   a+ +                e ++e ++l+ n+++ Ps  
  CAB13622.1   120 DRISIVALFFANGDT---------------EKAKEYVNLMINQEYQPSTP 154  

                   ilwlaGtdlikknasslfnCfvtgvrdsidgileivgevvdkgeggisda
                   +  +aG     k++  l+ Cf++ v ds+++i+++++             
  CAB13622.1   155 TFLNAGR----KRRGELVSCFLLEVNDSLNDISRAIDI------------ 188  

                   fslaalllkrGgGvGylveprlinqlplvvneldvlvvldegsksyeerk
                       + l k GgGv                                    
  CAB13622.1   189 ---SMQLSKLGGGVSL---------------------------------- 201  

                   elgllskyelydegdiitivvgdsregWvkaladlldlsfddglldlvkv
                                                                     
  CAB13622.1     - -------------------------------------------------- -    

                   lvldfsdiRPaGaklkgfggtasGPvsllellldvaeilnkaagrkltsv
                      ++s++R++G+ +k++   + G v++++ll                  
  CAB13622.1   202 ---NLSKLRAKGEAIKDVENATKGVVGVMKLL------------------ 230  

                   evldlldalavtvvsgGvRRsAqmall...hpdieefieaKddlwkldgr
                         d + ++  + G R + + a+l++ h di +f++ K+   + d r
  CAB13622.1   231 ------DNAFRYADQMGQRQGSGAAYLnifHRDINDFLDTKKISADEDVR 274  

                   lgnfniSvlvddefm...................................
                   + +  i v++ d+f++ + +++++++ + +++++++ +++++++++++++
  CAB13622.1   275 VKTLSIGVVIPDKFVelaredkaayvfyphtiykeygqhmdemdmnemyd 324  

                   .................lwekivlsaydsgEPGilfadeanernnaldge
                   + +++  +++++++  +l+ek+++   +sg P i+f d +n+ +      
  CAB13622.1   325 kfvdnprvkkekinprkLLEKLAMLRSESGYPYIMFQDNVNKVHA----- 369  

                   elgyreeivgtNPCgEipLppyg.................aCnLgeinll
                    +++  +++ +N C E  L +  +  ++++++++++  +++CnLg++n+l
  CAB13622.1   370 -NNHISKVKFSNLCSEV-LQASQvssytdydeedeigldiSCNLGSLNIL 417  

                   afvfdledlfeavalavrfldnvtflt..lplevsrelalrdrriGvGft
                     v+++  ++++v+la+  l +v   t++   +  r+   + + iG+G +
  CAB13622.1   418 N-VMEHKSIEKTVKLATDSLTHVSETTdiRNAPAVRRANKAMKSIGLGAM 466  

                   GladflvlafGlevlrwwedagrpetgeglglkygseeaakfleslreiv
                   +l+++l+                       g++y+s+ea++f++ ++ +v
  CAB13622.1   467 NLHGYLAQ---------------------NGIAYESPEARDFANTFFMMV 495  

                   reaayeysvela......................................
                        + s+e+a+++ ++ ++++  ++++ ++ ++++ ++   +++++++
  CAB13622.1   496 NFYSIQRSAEIAkekgetfdqyegstyatgeyfdkyvstdfspkyekian 545  

                   .......................girnshlttiaPtGTisllagvseGie
                     + +++ ++++ ++ ++ ++++g+  s  ++iaPtG+is +   +  + 
  CAB13622.1   546 lfegmhipttedwkklkafvaehGMYHSYRLCIAPTGSISYVQSSTASVM 595  

                   PpfalyyirrirfskndplalalldygYrvipdqsgkdewlveipvevse
                   P+  +   r +  sk  + ++ l+  ++ +++  ++              
  CAB13622.1   596 PIMERIEERTYGNSKTYYPMPGLASNNWFFYKEAYD-------------- 631  

                   alpdifvsanelsalaqldfqaavqklwvdhaiSkTinvpedeivelvea
                              +++   +d+ a +q+  +d++iS+T  + + ++  + ++
  CAB13622.1   632 -----------MDMFKVVDMIATIQQ-HIDQGISFTLFLKDTMTTRDLNR 669  

                   lyeaawdyglkgllssCfllsvedslegildalkeaallskrggGvGlnlsnlRalgsli
                      l+sCfll+v+dsl++i +a++  ++lsk ggGv+lnls+lRa+g+ i
  CAB13622.1   167    LVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKGEAI 213  

                   kgtggvssGvvpflkllddaaravnqggvRrgavavyldiwHpdilefld
                   k+++++++Gvv+++klld+a+r+++q+g+R+g++a+yl+i+H di +fld
  CAB13622.1   214 KDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLD 263  

                   lkknegdeerrlrnlnlavlvpdlFmerveededwtlfspadvpglylad
                   +kk ++de++r+++l+++v++pd F e+++ed+  ++f p++++++y+++
  CAB13622.1   264 TKKISADEDVRVKTLSIGVVIPDKFVELAREDKAAYVFYPHTIYKEYGQH 313  

                   lygeefeelyerleadglivkktvkareLwrlilesaletGePyllfkdt
                   +++ ++ e+y+++++++++ k++++ r+L++++++++ e+G+Py++f d+
  CAB13622.1   314 MDEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLRSESGYPYIMFQDN 363  

                   vnranpl..lgtikasNlCtEivlptspslllldllldelgevavCnLas
                   vn+ + ++++ ++k sNlC+E+++ +  s +++++  de+g +++CnL+s
  CAB13622.1   364 VNKVHANnhISKVKFSNLCSEVLQASQVSSYTDYDEEDEIGLDISCNLGS 413  

                   inLakffdfeelrelvrlavraldnvidlnlydpvpearrgnlrlRsiGl
                   +n+ ++++++ ++++v+la+  l+ v + +++++ p++rr+n++++siGl
  CAB13622.1   414 LNILNVMEHKSIEKTVKLATDSLTHVSETTDIRNAPAVRRANKAMKSIGL 463  

                   GvmGladlLaklgipYdseealdladrifeliyyaalraSvelAkergep
                   G+m+l+++La++gi+Y+s+ea+d+a+ +f+++++++++ S+e+Ake+ge+
  CAB13622.1   464 GAMNLHGYLAQNGIAYESPEARDFANTFFMMVNFYSIQRSAEIAKEKGET 513  

                   fplfegskyakgllffdlldkllllllekvkelllllglllllkedweel
                   f+ +egs+ya+g++f ++++ ++ +++ek+ +l++  g+++++ edw++l
  CAB13622.1   514 FDQYEGSTYATGEYFDKYVSTDFSPKYEKIANLFE--GMHIPTTEDWKKL 561  

                   redikkyGlrNslllaiAPTgsisliagvtegiePifsnvylrkvlsgef
                   ++ ++++G+++s++l+iAPTgsis++ ++t++++Pi+ +++ r++++ ++
  CAB13622.1   562 KAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKT 611  

                   lvvnpyllpdellavfktafeidqedlidmaaarqpfvDqaiSltlflpe
                   ++++p l   +++ ++k a+++d+++++dm+a +q+++Dq+iS+tlfl++
  CAB13622.1   612 YYPMPGL-ASNNWFFYKEAYDMDMFKVVDMIATIQQHIDQGISFTLFLKD 660  

                   dataedllklllyawklglKglyylrtrsklssCfllsvedslegildalkeaallskrggGvGlnlsrlRalgsli
                      l+sCfll+v+dsl++i +a++  ++lsk ggGv+lnls+lRa+g+ i
  CAB13622.1   167    LVSCFLLEVNDSLNDISRAIDISMQLSKLGGGVSLNLSKLRAKGEAI 213  

                   kgtggvssGvvpflkllddavravnqggvRrgavavylevwHpdilefld
                   k+++++++Gvv+++klld+a+r+++q g+R+g+ a+yl+++H di +fld
  CAB13622.1   214 KDVENATKGVVGVMKLLDNAFRYADQMGQRQGSGAAYLNIFHRDINDFLD 263  

                   lkknngdeerrlrnlnlavlvpdlFmerveededwtLfspadvpglydla
                   +kk ++de++r+++l+++v++pd F e+++ed+  ++f p+++++ y+ +
  CAB13622.1   264 TKKISADEDVRVKTLSIGVVIPDKFVELAREDKAAYVFYPHTIYKEYGQH 313  

                   llygeefeelylrleadglivkktvkareLwkkilesaletGePyilfkd
                   + +++++ e+y ++++++++ k++++ r+L++k+++++ e+G+Pyi+f d
  CAB13622.1   314 M-DEMDMNEMYDKFVDNPRVKKEKINPRKLLEKLAMLRSESGYPYIMFQD 362  

                   avnranplknlggtikasNlCtEillptyplllvl....dllgevavCnL
                   +vn+ + ++++  ++k sNlC+E+l+ +  + + +++++d++g +++CnL
  CAB13622.1   363 NVNKVHANNHI-SKVKFSNLCSEVLQASQVSSYTDydeeDEIGLDISCNL 411  

                   asinlakffdfeelrelvrlavraldnvidlnlyp.lpearrgnlrlRsi
                   +s+n+ ++++++ ++++v+la+  l+ v + +++ + p++rr+n++++si
  CAB13622.1   412 GSLNILNVMEHKSIEKTVKLATDSLTHVSETTDIRnAPAVRRANKAMKSI 461  

                   GlGvmGladaLaklgipYdseealdladrifeliyyaalraSvelAkerg
                   GlG+m+l+++La++gi+Y+s+ea+d+a+ +f+++++++++ S+e+Ake+g
  CAB13622.1   462 GLGAMNLHGYLAQNGIAYESPEARDFANTFFMMVNFYSIQRSAEIAKEKG 511  

                   .pfplfegskyakgllffdlld..........kvllslvllllkldweeL
                   ++f+ +egs ya+g++f +++ ++   +++++  l++ +++++++dw++L
  CAB13622.1   512 eTFDQYEGSTYATGEYFDKYVStdfspkyekiANLFEGMHIPTTEDWKKL 561  

                   redikkyGlrNslllaiaPTgsisliagvtegiePifsnvylrkvlsgef
                   ++ ++++G+++s+ l+iaPTgsis++ ++t++++Pi+ +++ r+++ +++
  CAB13622.1   562 KAFVAEHGMYHSYRLCIAPTGSISYVQSSTASVMPIMERIEERTYGNSKT 611  

                   lvvnpyl.lellavfktafeildqedlidmaaarqpfvDqaiSltlflpe
                   ++++p l+ + + ++k a+++ d+++++dm+a +q+++Dq+iS+tlfl++
  CAB13622.1   612 YYPMPGLaSNNWFFYKEAYDM-DMFKVVDMIATIQQHIDQGISFTLFLKD 660  

                   daledgkltaedlldlllyawklglKtlyyyrtrs.kaseclscsv