RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= CAA93431.1 cele0 ZK596.2 WS208 "serine\/threonine kinase"
         (305 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2c47A [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM                          84   6e-19
3ei1A [x.x.x] DNA DAMAGE-BINDING PROTEIN 1                             80   6e-18
3dbsA [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE           77   9e-17
2c47C [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM                          70   1e-14
3dk6A [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1              69   1e-14
2e2bA [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1              64   6e-13
2cgxA [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1                     62   2e-12
3e87A [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE                 61   4e-12
2ckpB [x.x.x] CHOLINE KINASE ALPHA                                     61   5e-12
3dxnA [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3          60   6e-12
3bceA [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4                  59   2e-11
3dkfA [x.x.x] MET PROTO-ONCOGENE                                       57   6e-11
2bmcF [x.x.x] SERINE THREONINE-PROTEIN KINASE 6                        56   1e-10
1apmE [d.144.1] CAMP-DEPENDENT PROTEIN KINASE                          55   3e-10
3c9wA [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1                       54   5e-10
3comB [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4                        54   7e-10
1cdkA [d.144.1] CAMP-DEPENDENT PROTEIN KINASE                          54   8e-10
2c3jA [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1                     53   1e-09
2e2bB [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1              52   2e-09
3da6A [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10                      52   2e-09
3e93A [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14                      52   2e-09
3ckwA [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24                       52   2e-09
2advA [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE            52   3e-09
2bmcA [x.x.x] SERINE THREONINE-PROTEIN KINASE 6                        51   4e-09
2eb3A [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR                         51   4e-09
3bhhB [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE         51   6e-09
3cg2A [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14                      50   7e-09
3cqwA [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE                50   7e-09
3c5iA [x.x.x] CHOLINE KINASE                                           50   1e-08
2b5mA [x.x.x] DAMAGE-SPECIFIC DNA BINDING PROTEIN 1                    50   1e-08
2bkkA [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE                     49   2e-08
3dndA [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT          48   4e-08
3byvA [x.x.x] RHOPTRY KINASE                                           48   5e-08
3csfA [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE           47   5e-08
1cmkE [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT        47   6e-08
3dkgA [x.x.x] MET PROTO-ONCOGENE                                       47   7e-08
2bfxB [x.x.x] LOC398457 PROTEIN                                        46   1e-07
2brmA [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1                     45   2e-07
3e8cE [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT          44   5e-07
3dy7A [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE        44   6e-07
3dgkA [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1                        44   6e-07
3cquA [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE                44   7e-07
2bmcB [x.x.x] SERINE THREONINE-PROTEIN KINASE 6                        44   7e-07
3e59C [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA                     44   7e-07
2bvaA [x.x.x] P21-ACTIVATED KINASE 4                                   44   7e-07
1e90A [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL ...    44   8e-07
3cqzH [x.x.x] DNA-DIRECTED RNA POLYMERASES I, II, AND III              43   1e-06
2ac5A [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2         42   2e-06
2amuA [x.x.x] PUTATIVE SUPEROXIDE REDUCTASE                            42   2e-06
3dfcB [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1                        42   2e-06
3dajA [x.x.x] SERINE/THREONINE KINASE 6                                42   2e-06
3c5yB [x.x.x] RIBOSE/GALACTOSE ISOMERASE                               42   2e-06
3blrA [x.x.x] CELL DIVISION PROTEIN KINASE 9                           42   2e-06
3dk6B [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1              41   4e-06
3c5yE [x.x.x] RIBOSE/GALACTOSE ISOMERASE                               41   5e-06
3bhhC [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE         41   5e-06
3e3pA [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE               41   6e-06
3e5aA [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6                        41   6e-06
2dwbA [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6                        40   1e-05
2chwA [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE           40   1e-05
3dfaA [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE CGD3_920                39   1e-05
1e7vA [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL ...    39   1e-05
3c5yA [x.x.x] RIBOSE/GALACTOSE ISOMERASE                               39   2e-05
3cq9B [x.x.x] UNCHARACTERIZED PROTEIN LP_1622                          39   2e-05
3daeA [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE            39   2e-05
3dlsE [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN           37   6e-05
3c4yB [x.x.x] RHODOPSIN KINASE                                         37   7e-05
3c5yL [x.x.x] RIBOSE/GALACTOSE ISOMERASE                               37   7e-05
1csnA [d.144.1 (1eh4A)] CASEIN KINASE-1                                37   7e-05
2bkkC [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE                     37   9e-05
3dlsC [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN           36   1e-04
3csvA [x.x.x] AMINOGLYCOSIDE PHOSPHOTRANSFERASE                        36   1e-04
3bhhD [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE         36   1e-04
3daeB [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE            36   1e-04
2a1sB [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN                       36   1e-04
3cs9D [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1              36   2e-04
3dplC [x.x.x] CULLIN-5                                                 36   2e-04
3dlsB [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN           36   2e-04
3dlsD [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN           36   2e-04
1bygA [d.144.1] PROTEIN (C-TERMINAL SRC KINASE)                        36   2e-04
3dk7B [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1              36   2e-04
1e7uA [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL ...    35   3e-04
2c3iB [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE           35   3e-04
3cq9D [x.x.x] UNCHARACTERIZED PROTEIN LP_1622                          35   3e-04
2bvaB [x.x.x] P21-ACTIVATED KINASE 4                                   35   3e-04
3dlsA [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN           35   3e-04
2cunA [x.x.x] PHOSPHOGLYCERATE KINASE                                  35   4e-04
2chxA [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE           34   5e-04
2bajA [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14                      34   5e-04
2ckeA [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2                        34   6e-04
3dneA [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT          34   7e-04
2bakA [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14                      34   7e-04
3ck8A [x.x.x] SUSD                                                     34   7e-04
3bboU [x.x.x] RIBOSOMAL PROTEIN L22                                    34   7e-04
3bdeA [x.x.x] MLL5499 PROTEIN                                          34   8e-04

>2c47A [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
          Length = 288

 Score = 83.7 bits (205), Expect = 6e-19
 Identities = 68/286 (23%), Positives = 123/286 (43%), Gaps = 13/286 (4%)

Query: 25  LGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGRHFLELA 84
              G    + L           A+K+E        L +E     ++   + V + +    
Sbjct: 3   FRVGKKIELRLGKNLYT-NEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVY---- 57

Query: 85  DRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIGFLHR 144
                P K+N MV+ L+G SL+DL        F++ T + +A Q +  +E +H    ++R
Sbjct: 58  --YFGPGKYNAMVLELLGPSLEDLFDLCD-RTFTLKTVLMIAIQLITRMEYVHTKSLIYR 114

Query: 145 DIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNP-RARAGFRGTVKYAPLACH 203
           D+KP N+ +GR        ++++DFG+A+++   +     P R      GT +Y  +  H
Sbjct: 115 DVKPENFLVGRPGTKRQHAIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTH 174

Query: 204 IQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKT---TRLRCLFGGCP 260
           + +EQ R+DD+E+  +M +    G LPW+ L        ++K   T   T +  L    P
Sbjct: 175 LGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFP 234

Query: 261 REFTEVFPILDKGKFFDAPEYTTIYELLEKAMVNTKSNE-FPYDWE 305
            E       + +  FF+ P+Y  + +L       +     + YDW 
Sbjct: 235 EEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDWA 280


>3ei1A [x.x.x] DNA DAMAGE-BINDING PROTEIN 1
          Length = 1105

 Score = 80.5 bits (196), Expect = 6e-18
 Identities = 19/214 (8%), Positives = 42/214 (19%), Gaps = 15/214 (7%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           K T +     G F +   ++          + V            EV +  ++   ++  
Sbjct: 11  KPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRP--VKEVGMYGKIAVMELFR 68

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
                      L  K+N  ++            T                  +  ++   
Sbjct: 69  PKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPEC 128

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
            +  L             +         +  F +  +                F    + 
Sbjct: 129 RMIGLRLYDGLFKVIPLDR-----DNKELKAFNIRLEELHVIDV--------KFLYGCQA 175

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
             +    Q  Q R            E   G    
Sbjct: 176 PTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQ 209


>3dbsA [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
          Length = 841

 Score = 76.5 bits (186), Expect = 9e-17
 Identities = 19/222 (8%), Positives = 45/222 (20%), Gaps = 15/222 (6%)

Query: 19  WTILKKLGEGAFGAVYLVSQK---EKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKI 75
                            +  K   +  +    L++    + +   +     LL       
Sbjct: 576 LEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIST 635

Query: 76  VGRHFL-----ELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSL 130
             +  +     +      + Q           + L    K           A        
Sbjct: 636 GDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKE-KSPTEEKFQAAVERFVYS 694

Query: 131 EAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAG 190
            A   +        D    N  I          ++ +DFG  R               +G
Sbjct: 695 CAGYCVATFVLGIGDRHNDNIMITET-----GNLFHIDFGHERVPFVLTPDFLFVMGTSG 749

Query: 191 FRGTVKYAPLACHIQREQC-RKDDIESWLYMVVEMTCGRLPW 231
            + +  +        +     +      + +   M    +P 
Sbjct: 750 KKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQ 791


>2c47C [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
          Length = 282

 Score = 69.7 bits (169), Expect = 1e-14
 Identities = 41/285 (14%), Positives = 84/285 (29%), Gaps = 16/285 (5%)

Query: 26  GEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG-RHFLELA 84
             G    + L           A+K+E        L +E     ++   + V   ++    
Sbjct: 2   RVGKKIELRLGKNLYT-NEYVAIKLEPIKSRAPQLHLEYRFYKQLSATEGVPQVYYFGPG 60

Query: 85  DRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIGFLHR 144
               +  +     +  +                ++     +     +++           
Sbjct: 61  KYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLITRMEYVHTKSLIYRDVKPENFL 120

Query: 145 DIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPLACHI 204
             +PG              +                     R      GT +Y  +  H+
Sbjct: 121 VGRPGQ---------HAIHIIDFGLAKEYIDPETKKH-IPYREHKSLTGTARYMSINTHL 170

Query: 205 QREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKT---TRLRCLFGGCPR 261
            +EQ R+DD+E+  +M +    G LPW+ L        ++K   T   T +  L    P 
Sbjct: 171 GKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRATPIEVLCENFPE 230

Query: 262 EFTEVFPILDKGKFFDAPEYTTIYELLEKAMVNTKSN-EFPYDWE 305
           E       + +  FF+ P+Y  + +L       +    ++ YDW 
Sbjct: 231 EMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRSGFVFDYEYDWA 275


>3dk6A [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
          Length = 262

 Score = 69.2 bits (168), Expect = 1e-14
 Identities = 45/223 (20%), Positives = 81/223 (36%), Gaps = 21/223 (9%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           +  I  K   G FG VY     +K  +  A+K     +       E AV+ E+K   +V 
Sbjct: 7   RTDITMKHKLGQFGEVYEG-VWKKYSLTVAVKTLEVEE----FLKEAAVMKEIKHPNLV- 60

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
               +L         F  +   +   +L D  +     + S    + +A Q   A+E L 
Sbjct: 61  ----QLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLE 116

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
              F+HRD+   N  +      E   V + DFG++R    +        A AG +  +K+
Sbjct: 117 KKNFIHRDLAARNCLV-----GENHLVKVADFGLSRLMTGDT------TAHAGAKFPIKW 165

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDV 240
                    +   K D+ ++  ++ E+    +      +   V
Sbjct: 166 TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDPSQV 208


>2e2bA [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
          Length = 270

 Score = 63.8 bits (154), Expect = 6e-13
 Identities = 42/224 (18%), Positives = 78/224 (34%), Gaps = 23/224 (10%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
              T+  KLG G +G VY    K+      A+K   E +       E AV+ E+K   +V
Sbjct: 16  TDITMKHKLGGGQYGEVYEGVWKKYSLT-VAVKTLMEVEEF---LKEAAVMKEIKHPNLV 71

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
            +              F  +   +   +L D  +     + +    + +A Q   A+E L
Sbjct: 72  -QLLGVCTRE----PPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYL 126

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
               F+HRD+   N  +G         V + DFG++R                  +  +K
Sbjct: 127 EKKNFIHRDLAARNCLVGEN-----HLVKVADFGLSRLTYTAHAG---------AKFPIK 172

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDV 240
           +         +   K D+ ++  ++ E+    +      +   V
Sbjct: 173 WTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQV 216


>2cgxA [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
          Length = 265

 Score = 62.4 bits (150), Expect = 2e-12
 Identities = 44/215 (20%), Positives = 67/215 (31%), Gaps = 16/215 (7%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
             W +++ LGEGA+G V L   +   +   A+K+         +K E+ +   +  + +V
Sbjct: 2   EDWDLVQTLGEGAYGEVQLAVNRVTEEA-VAVKIVDMKRCPENIKKEICINKMLNHENVV 60

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
             +                 +    G  L D  +  P        A     Q +  V  L
Sbjct: 61  KFYGHRREG-----NIQYLFLEYCSGGELFDRIE--PDIGMPEPDAQRFFHQLMAGVVYL 113

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H IG  HRDIKP N          L +   L               R             
Sbjct: 114 HGIGITHRDIKPEN--------LLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPY 165

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
            AP     +       D+ S   ++  M  G LPW
Sbjct: 166 VAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW 200


>3e87A [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
          Length = 321

 Score = 61.3 bits (147), Expect = 4e-12
 Identities = 50/222 (22%), Positives = 84/222 (37%), Gaps = 15/222 (6%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
             +  LK LG+G FG V LV +K   +  YA+K+  +     + K EVA  +   +    
Sbjct: 5   NDFDYLKLLGKGTFGKVILVREKATGRY-YAMKILRKEV--IIAKDEVAHTVTESRVLQN 61

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
            RH    A +           +       +     +    F+   A     + + A+E L
Sbjct: 62  TRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYL 121

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H+   ++RDIK  N       + +   + + DFG+ ++         +  A   F GT +
Sbjct: 122 HSRDVVYRDIKLENL-----MLDKDGHIKITDFGLCKEG-------ISDGATMKFCGTPE 169

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
           Y         +  R  D      ++ EM CGRLP+ N     
Sbjct: 170 YLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHER 211


>2ckpB [x.x.x] CHOLINE KINASE ALPHA
          Length = 274

 Score = 60.8 bits (146), Expect = 5e-12
 Identities = 24/241 (9%), Positives = 60/241 (24%), Gaps = 33/241 (13%)

Query: 20  TILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGRH 79
              K+   GA+  +               +       L L+ +E  +   + ++ +  + 
Sbjct: 2   LWCKEFLPGAWRGLREDEFHISVIRNMLFQCSLPKVLLRLMVLESVMFAILAERSLGPKL 61

Query: 80  FLELAD------RGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAV 133
           +             +       + +  +   + +   T    K            ++E +
Sbjct: 62  YGIFPQGRLEQFIPSRRLDTEELSLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKL 121

Query: 134 E----------------DLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAR 177
                                + F H D + GN  +        +K+ ++DF  +    R
Sbjct: 122 SYNLPLELENLRSLLESTPSPVVFCHNDCQEGNILLLE------QKLMLIDFEYSSYNYR 175

Query: 178 EDGTLRNPRARAGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTES 237
                              Y+       R   RK   +      +        + NL+  
Sbjct: 176 G-----FDIGNHFCEWMYDYSYEKYPFFRANIRKYPTKKQQLHFISSYLPAFQFENLSTE 230

Query: 238 D 238
           +
Sbjct: 231 E 231


>3dxnA [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3
          Length = 258

 Score = 60.5 bits (145), Expect = 6e-12
 Identities = 31/211 (14%), Positives = 60/211 (28%), Gaps = 18/211 (8%)

Query: 21  ILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGRHF 80
             +    G++G V L   K+K   E A+K+  +S           +      +++   + 
Sbjct: 5   YQRVKKLGSYGEVLLC--KDKTGAERAIKIIKKSSVTTTSNSGALLDEVAVLKQLDHPNI 62

Query: 81  LELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIG 140
           ++L +     + +  ++    G  L D        KFS   A  + +Q L     LH   
Sbjct: 63  MKLYEFFEDKRNYYLVMEVYRGGELFDEIIL--RQKFSEVDAAVIMKQVLSGTTYLHKHN 120

Query: 141 FLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPL 200
            +HRD+KP N  +  K         +           E                +    L
Sbjct: 121 IVHRDLKPENLLLESKSDA-----LIKIVDFGLSAHFERLG---------TAYYIAPEVL 166

Query: 201 ACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                 +            ++          
Sbjct: 167 RKKYDEKCDVWSCGVILYILLCGYPPFGGQT 197


>3bceA [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
          Length = 285

 Score = 59.2 bits (142), Expect = 2e-11
 Identities = 37/213 (17%), Positives = 66/213 (30%), Gaps = 14/213 (6%)

Query: 19  WTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGR 78
              +K LG GAFG VY      +      + V A        K  V  + E      +  
Sbjct: 16  LKRVKVLGSGAFGTVYKGIWVPE-GETVKIPV-AIKILNETPKANVEFMDEALIMASMDH 73

Query: 79  HFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHN 138
             L +   G        +V  L+             +       ++   Q  + +  L  
Sbjct: 74  PHL-VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEE 132

Query: 139 IGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYA 198
              +HRD+   N       +     V + DFG+AR    ++            +  +K+ 
Sbjct: 133 RRLVHRDLAARN-----VLVKSPNHVKITDFGLARLLEGDEKEYN------AGKMPIKWM 181

Query: 199 PLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
            L C   R+   + D+ S+   + E+       
Sbjct: 182 ALECIHYRKFTHQSDVWSYGVTIWELMTFGGKP 214


>3dkfA [x.x.x] MET PROTO-ONCOGENE
          Length = 294

 Score = 57.1 bits (136), Expect = 6e-11
 Identities = 35/222 (15%), Positives = 76/222 (34%), Gaps = 25/222 (11%)

Query: 19  WTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGR 78
               + +G G FG VY  + K+      +L    +   +     E  ++ +     ++  
Sbjct: 29  VHFNEVIGRGHFGCVYHGTLKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSL 88

Query: 79  HFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHN 138
             + L       +    +V+  +             +  ++   I    Q  + ++ L +
Sbjct: 89  LGICL-----RSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKFLAS 143

Query: 139 IGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYA 198
             F+HRD+   N  +  K       V + DFG+AR                 ++  VK+ 
Sbjct: 144 KKFVHRDLAARNCMLDEKFT-----VKVADFGLARDM---------------YKLPVKWM 183

Query: 199 PLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDV 240
            L     ++   K D+ S+  ++ E+     P      + D+
Sbjct: 184 ALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNTFDI 225


>2bmcF [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
          Length = 257

 Score = 56.4 bits (135), Expect = 1e-10
 Identities = 39/216 (18%), Positives = 66/216 (30%), Gaps = 15/216 (6%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
            + I + LG+G FG VYL  +K + K   ALKV  ++            L    + +   
Sbjct: 7   DFEIGRPLGKGKFGNVYLAREK-QSKFILALKVLFKAQLEK--AGVEHQLRREVEIQSHL 63

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
           RH   L   G         ++          R+    +KF      +   +   A+   H
Sbjct: 64  RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCH 123

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           +   +HRDIKP N  +G        ++ + DFG +            P      R   + 
Sbjct: 124 SKRVIHRDIKPENLLLGSA-----GELKIADFGWSVT------LDYLPPEMIEGRMHDEK 172

Query: 198 -APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWR 232
               +  +   +              E         
Sbjct: 173 VDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVE 208


>1apmE [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
          Length = 338

 Score = 55.0 bits (131), Expect = 3e-10
 Identities = 36/220 (16%), Positives = 71/220 (32%), Gaps = 18/220 (8%)

Query: 19  WTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGR 78
           +  +K LG G+FG V LV  KE         ++ +     +   ++   L  K+      
Sbjct: 33  FDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKV---VKLKQIEHTLNEKRILQAVN 89

Query: 79  HFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHN 138
               +    +     N  ++       +         +F+   A   A Q +   E LH+
Sbjct: 90  FPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFAEPHARFYAAQIVLTFEYLHS 149

Query: 139 IGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYA 198
           +  ++RD+KP N  I ++              +      +    R         GT +Y 
Sbjct: 150 LDLIYRDLKPENLLIDQQ----------GYIQVTDFGFAKRVKGRTW-----LCGTPEYL 194

Query: 199 PLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
                + +   +  D  +   ++ EM  G  P+       
Sbjct: 195 APEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQ 234


>3c9wA [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
          Length = 336

 Score = 54.1 bits (128), Expect = 5e-10
 Identities = 24/135 (17%), Positives = 40/135 (29%), Gaps = 2/135 (1%)

Query: 16  CGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKI 75
             ++T L  +GEGA+G V               K+                 +++  +  
Sbjct: 15  GPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTY--CQRTLREIKILLRFR 72

Query: 76  VGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVED 135
                           +    V  +      DL K       S         Q L  ++ 
Sbjct: 73  HENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKY 132

Query: 136 LHNIGFLHRDIKPGN 150
           +H+   LHRD+KP N
Sbjct: 133 IHSANVLHRDLKPSN 147


>3comB [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
          Length = 279

 Score = 53.6 bits (127), Expect = 7e-10
 Identities = 36/221 (16%), Positives = 72/221 (32%), Gaps = 20/221 (9%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           +   +  + E   G+VY    K +     A+K       L  +  E++++ +     +V 
Sbjct: 10  QPEEVFDVLEKLGGSVYKAIHK-ETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVK 68

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
            +               ++VM   G               +     ++ + +L+ +E LH
Sbjct: 69  YYG------SYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLH 122

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
            +  +HRDIK GN             + +   G A+             A+    GT  +
Sbjct: 123 FMRKIHRDIKAGN-------------ILLNTEGHAKLADFGVAGQLTDMAKRNVIGTPFW 169

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
                  +       DI S     +EM  G+ P+ ++    
Sbjct: 170 MAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMR 210


>1cdkA [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
          Length = 342

 Score = 53.5 bits (127), Expect = 8e-10
 Identities = 46/221 (20%), Positives = 81/221 (36%), Gaps = 18/221 (8%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           ++  +K LG G+FG V LV + ++    +A+K+  +   + L K     L E +  + V 
Sbjct: 35  QFERIKTLGTGSFGRVMLV-KHKETGNHFAMKILDKQKVVKL-KQIEHTLNEKRILQAVN 92

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
             FL   +         YMVM  V                        A+  L   E LH
Sbjct: 93  FPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVL-TFEYLH 151

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           ++  ++RD+KP N       + +   + + DFG A++             R    GT +Y
Sbjct: 152 SLDLIYRDLKPEN-----LLIDQQGYIQVTDFGFAKRVKG----------RTWLCGTPEY 196

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
                 + +   +  D  +   ++ EM  G  P+       
Sbjct: 197 LAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQ 237


>2c3jA [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
          Length = 257

 Score = 53.1 bits (126), Expect = 1e-09
 Identities = 40/210 (19%), Positives = 66/210 (31%), Gaps = 18/210 (8%)

Query: 22  LKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGRHFL 81
              +     G V L   +   +   A+K+         +K E+ +   +  + +V  +  
Sbjct: 4   WDLVQTLGEGEVQLAVNRVT-EEAVAVKIVDMKRE--NIKKEICINKMLNHENVVKFYGH 60

Query: 82  ELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIGF 141
                          +    G  L D  +           A     Q +  V  LH IG 
Sbjct: 61  RR-----EGNIQYLFLEYCSGGELFDRIEP--DIGMPEPDAQRFFHQLMAGVVYLHGIGI 113

Query: 142 LHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPLA 201
            HRDIKP N  +  ++  ++      DFG+A  F   +   R              AP  
Sbjct: 114 THRDIKPENLLLDERDNLKI-----SDFGLATVFRYNN---RERLLNKMCGTLPYVAPEL 165

Query: 202 CHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
              +       D+ S   ++  M  G LPW
Sbjct: 166 LKRREFHAEPVDVWSCGIVLTAMLAGELPW 195


>2e2bB [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
          Length = 262

 Score = 52.4 bits (124), Expect = 2e-09
 Identities = 20/135 (14%), Positives = 38/135 (28%), Gaps = 3/135 (2%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
                  +  +          Q  +  V   +  +               L E    K +
Sbjct: 7   NYDKWEMERTDITMKHKLGGGQYGE--VYEGVWKKYSLTVAVKTLEVEEFLKEAAVMKEI 64

Query: 77  GRHFL-ELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVED 135
               L +L         F  +   +   +L D  +     + +    + +A Q   A+E 
Sbjct: 65  KHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEY 124

Query: 136 LHNIGFLHRDIKPGN 150
           L    F+HRD+   N
Sbjct: 125 LEKKNFIHRDLAARN 139


>3da6A [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
          Length = 328

 Score = 52.3 bits (123), Expect = 2e-09
 Identities = 26/215 (12%), Positives = 58/215 (26%), Gaps = 3/215 (1%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
            ++  LK +G G        +      V          +     +    ++L        
Sbjct: 17  KRYQNLKPIGSGGIVCAAYDAVL-DRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKN 75

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
               L +       ++F  + + +        +      +        +  Q L  ++ L
Sbjct: 76  IISLLNVFTPQKTLEEFQDVYLVMELMDANLCQV--IQMELDHERMSYLLYQMLCGIKHL 133

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H+ G +HRD+KP N  +      ++    +    + R +   +  L           +V 
Sbjct: 134 HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTVVTRYYRAPEVILGMGYKENVDIWSVG 193

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                    +      D       V+E      P 
Sbjct: 194 CIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPE 228


>3e93A [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
          Length = 346

 Score = 52.1 bits (123), Expect = 2e-09
 Identities = 25/136 (18%), Positives = 45/136 (33%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           ++  L  +G GA+G+V      +        K+      +   K     L  +K  K   
Sbjct: 20  RYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHEN 79

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
              L          +    V  +      DL       K +      +  Q L  ++ +H
Sbjct: 80  VIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIH 139

Query: 138 NIGFLHRDIKPGNYTI 153
           +   +HRD+KP N  +
Sbjct: 140 SADIIHRDLKPSNLAV 155


>3ckwA [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
          Length = 255

 Score = 52.0 bits (123), Expect = 2e-09
 Identities = 40/283 (14%), Positives = 83/283 (29%), Gaps = 43/283 (15%)

Query: 23  KKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGRHFLE 82
                   G V+      + +   A+K+  + + +  ++ E+ VL +     +   +   
Sbjct: 4   LFTKLEKIGEVFKGIDN-RTQKVVAIKI-IDLEEIEDIQQEITVLSQCDSPYVTKYYGSY 61

Query: 83  LADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIGFL 142
           L           +++M  +G                     ++ R+ L+ ++ LH+   +
Sbjct: 62  L------KDTKLWIIMEYLGGGSALDLL--EPGPLDETQIATILREILKGLDYLHSEKKI 113

Query: 143 HRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPLAC 202
           HRDIK  N  +      +L   ++                          GT  +     
Sbjct: 114 HRDIKAANVLLSEHGEVKLADFFV--------------------------GTPFWMAPEV 147

Query: 203 HIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLFGGCPRE 262
             Q     K DI S     +E+  G  P    +E   + V     K              
Sbjct: 148 IKQSAYDSKADIWSLGITAIELARGEPPH---SELHPMKVLFLIPKNNPPTL----EGNY 200

Query: 263 FTEVFPILDKGKFFDAPEYTTIYELLEKAMVNTKSNEFPYDWE 305
              +   ++     +     T  ELL+   +   + +  Y  E
Sbjct: 201 SKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTE 243


>2advA [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE
          Length = 161

 Score = 51.6 bits (122), Expect = 3e-09
 Identities = 13/182 (7%), Positives = 32/182 (17%), Gaps = 33/182 (18%)

Query: 63  EVAVLLEVKKQKIVGRH-----FLELADRGNLPQKFNYMVMTLV-GKSLQDLRKTAPFNK 116
           +  +     +   +         +   D  +      +        +S  D         
Sbjct: 2   QAPIAAYKPRSNEILWDGYGVPHIYGVDAPSA-----FYGYGWAQARSHGDNIL--RLYG 54

Query: 117 FSMGTAISVARQSLEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFA 176
            + G          E          +    +               +  +  F       
Sbjct: 55  EARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPD-----FRANLDAFAAGINA- 108

Query: 177 REDGTLRNPRARAGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTE 236
                         +             Q       D+ +  + ++       P R L E
Sbjct: 109 --------------YAQQNPDDISPDVRQVLPVSGADVVAHAHRLMNFLYVASPGRTLGE 154

Query: 237 SD 238
            D
Sbjct: 155 GD 156


>2bmcA [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
          Length = 256

 Score = 51.3 bits (121), Expect = 4e-09
 Identities = 43/223 (19%), Positives = 73/223 (32%), Gaps = 14/223 (6%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
            + I + LG+G FG VYL  +K+  K   ALKV      L    +E  +  EV+ Q  + 
Sbjct: 6   DFEIGRPLGKGKFGNVYLAREKQS-KFILALKV-LFKAQLEKAGVEHQLRREVEIQSHLR 63

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
              +             Y+++          R+    +KF      +   +   A+   H
Sbjct: 64  HPNILRLYGYFHDATRVYLILEYAPLGT-VYRELQKLSKFDEQRTATYITELANALSYCH 122

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           +   +HRDIKP N       +    ++ + DFG +         +         R   + 
Sbjct: 123 SKRVIHRDIKPENL-----LLGSAGELKIADFGWSVTLDYLPPEMIE------GRMHDEK 171

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDV 240
             L                +     + T  R+     T  D V
Sbjct: 172 VDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFV 214


>2eb3A [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
          Length = 294

 Score = 51.3 bits (121), Expect = 4e-09
 Identities = 27/223 (12%), Positives = 61/223 (27%), Gaps = 24/223 (10%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
                 K+   AFG VY          +  + V  +             +L+        
Sbjct: 15  TEFKKIKVLGSAFGTVYKGLWIP-EGEKVKIPVAIKELREATSPKANKEILDEAYVMASV 73

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
            +       G        ++  L+             +       ++   Q  + +  L 
Sbjct: 74  DNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLE 133

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           +   +HRD+   N  +   +  ++      DFG A+                     +K+
Sbjct: 134 DRRLVHRDLAARNVLVKTPQHVKIT-----DFGRAKL------------------VPIKW 170

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDV 240
             L   + R    + D+ S+   V E+        +   + ++
Sbjct: 171 MALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEI 213


>3bhhB [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
          Length = 289

 Score = 50.6 bits (119), Expect = 6e-09
 Identities = 39/215 (18%), Positives = 73/215 (33%), Gaps = 15/215 (6%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
            ++ + + +G+        +    +   +     +  +     L+ E  +   +K   IV
Sbjct: 3   DEYQLYEDIGKSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIV 62

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
            R    +++ G       Y+V  LV          A    +S   A    +Q LEAV   
Sbjct: 63  -RLHDSISEEGFH-----YLVFDLVTGGELFEDIVARE-YYSEADASHCIQQILEAVLHC 115

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H +G +HRD+KP N       +    K   +                + +A  GF GT  
Sbjct: 116 HQMGVVHRDLKPEN-----LLLASKCKGAAVKLADFGLAIEVQ---GDQQAWFGFAGTPG 167

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
           Y       +    +  DI +   ++  +  G  P+
Sbjct: 168 YLSPEVLRKEAYGKPVDIWACGVILYILLVGYPPF 202


>3cg2A [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
          Length = 327

 Score = 50.3 bits (118), Expect = 7e-09
 Identities = 32/255 (12%), Positives = 65/255 (25%), Gaps = 6/255 (2%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
                +       G+V      +        K+      +   K     L  +K  K   
Sbjct: 15  WEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHEN 74

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
              L          +    V  +      DL       K +      +  Q L  ++ +H
Sbjct: 75  VIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIH 134

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           +   +HRD+KP N       ++E  ++ +LDFG+A +                       
Sbjct: 135 SADIIHRDLKPSNL-----AVNEDCELKILDFGLA-RTRWYRAPEIMLNQTVDIWSVGCI 188

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLFG 257
                  +      D I+    ++  +            S+    + +            
Sbjct: 189 MAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFAN 248

Query: 258 GCPREFTEVFPILDK 272
                      +L+K
Sbjct: 249 VFIGANPLAVDLLEK 263


>3cqwA [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
          Length = 318

 Score = 50.3 bits (118), Expect = 7e-09
 Identities = 42/238 (17%), Positives = 75/238 (31%), Gaps = 14/238 (5%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
            ++  LK LG+G FG V LV +++     YA+K+  +   +   ++   +      Q   
Sbjct: 5   NEFEYLKLLGKGTFGKVILV-KEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSR 63

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
                 L        +  +++    G  L      +    FS   A     + + A++ L
Sbjct: 64  HPFLTALKYSFQTHDRLCFVMEYANGGELFF--HLSRERVFSEDRARFYGAEIVSALDYL 121

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H+   +          +  K+ H     + L                   A   F GT +
Sbjct: 122 HSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEG-----------IKDGATMKFCGTPE 170

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRC 254
           Y         +  R  D      ++ EM CGRLP+ N        +   E        
Sbjct: 171 YLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTL 228


>3c5iA [x.x.x] CHOLINE KINASE
          Length = 343

 Score = 49.9 bits (117), Expect = 1e-08
 Identities = 11/125 (8%), Positives = 27/125 (21%), Gaps = 11/125 (8%)

Query: 114 FNKFSMGTAISVARQSLEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMAR 173
                    I   +   ++    + I F H D++  N                 ++    
Sbjct: 172 KYIKESDKFIKFMKVYSKSDNLANTIVFCHNDLQENNIINTNCLRLID-----FEYSGFN 226

Query: 174 KFAREDGTLRNPRARAGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRN 233
             A +                          + ++ +    E+    +       LP   
Sbjct: 227 FLATDIAN------FFIETSIDYSVSSYPFFEIDKKKYISYENRKLFITAYLSNYLPTPK 280

Query: 234 LTESD 238
           L +  
Sbjct: 281 LIDEI 285


>2b5mA [x.x.x] DAMAGE-SPECIFIC DNA BINDING PROTEIN 1
          Length = 1119

 Score = 49.8 bits (116), Expect = 1e-08
 Identities = 12/231 (5%), Positives = 44/231 (19%), Gaps = 21/231 (9%)

Query: 28  GAFGAVYL---VSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGRHFLELA 84
               A  L   +++  + ++               +  ++AV+   + +    +  L + 
Sbjct: 22  HFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGES-KDLLFIL 80

Query: 85  DRGNLPQKFNYMVMTLV-GKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIGFLH 143
                       ++         D+   A                 +  ++    +  L 
Sbjct: 81  TAKYN-----ACILEYKQSGESIDIITRAH-GNVQDRIGRPSETGIIGIIDPECRMIGLR 134

Query: 144 RDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPLACH 203
                       ++  EL       F +  +                         +   
Sbjct: 135 LYDGLFKVIPLDRDNKEL-----KAFNIRLEELHVIDV-----KFLYGCQAPTICFVYQD 184

Query: 204 IQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRC 254
            Q    +  ++        +    +                        + 
Sbjct: 185 PQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQE 235


>2bkkA [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
          Length = 247

 Score = 49.0 bits (115), Expect = 2e-08
 Identities = 18/240 (7%), Positives = 57/240 (23%), Gaps = 39/240 (16%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
            K+  +K     +   VY +  + +      +           ++ E  ++L ++ +  V
Sbjct: 14  EKYRSVKDTEGMSPAKVYKLVGENENLY-LKMTDSRYKGTTYDVEREKDMMLWLEGKLPV 72

Query: 77  --------------------------------GRHFLELADRGNLPQKFNYMVMTLVGKS 104
                                                 +       + F+ + ++    +
Sbjct: 73  PKVLHFERHDGWSNLLMSEADGVLCSEEYEDEQSPEKIIELYAECIRLFHSIDISDCPYT 132

Query: 105 LQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKV 164
                + A  +              L+  +    + F H D+   N  +      + +  
Sbjct: 133 NSLDSRLAELDYLLNNKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFV-----KDGKVS 187

Query: 165 YMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEM 224
             +D G     A +   +             +                +   +  ++ E+
Sbjct: 188 GFIDLGR-SGRADKWYDIAFCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDEL 246


>3dndA [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
          Length = 334

 Score = 48.0 bits (112), Expect = 4e-08
 Identities = 42/214 (19%), Positives = 85/214 (39%), Gaps = 18/214 (8%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           ++  +K LG G+FG V L  +  +    YA+K+  +   + L ++E  +  +   Q +  
Sbjct: 28  QFERIKTLGTGSFGRVML-VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNF 86

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
              ++L            ++  + G  +          +FS   A   A Q +   E LH
Sbjct: 87  PFLVKLEFSFKDNSNLYMVMEYVPGGEMFS--HLRRIGRFSEPHARFYAAQIVLTFEYLH 144

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           ++  ++RD+KP N       + +   + + DFG A++           + R    GT +Y
Sbjct: 145 SLDLIYRDLKPENLL-----IDQQGYIQVTDFGFAKRV----------KGRTWLCGTPEY 189

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                 + +   +  D  +   ++ EM  G  P+
Sbjct: 190 LAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPF 223


>3byvA [x.x.x] RHOPTRY KINASE
          Length = 345

 Score = 47.6 bits (111), Expect = 5e-08
 Identities = 24/237 (10%), Positives = 59/237 (24%), Gaps = 28/237 (11%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
                  LG+    A    + +     E  +    E     + +M+  VL     + I  
Sbjct: 56  TLVRGTVLGQEDPYAYLEATDETGESFEVHVPYFTEPPSNAIKQMKEEVLRLRLLRGIKN 115

Query: 78  -------------------RHFLELADRGNLPQKFNYMVMTLVGKSLQDL---RKTAPFN 115
                                  ++     +  +F                    ++   
Sbjct: 116 QKQAKVHLRFIFPFDLVKDPQKKKMIRVMWVLSRFFLYPRMQSNLQTFGEVLLSHSSTHK 175

Query: 116 KFSMGTAISVARQSLEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKF 175
                  + +  Q +  +  LH+ G +H  ++P +       + +   V++  F    + 
Sbjct: 176 SLVHHARLQLTLQVIRLLASLHHYGLVHTYLRPVD-----IVLDQRGGVFLTGFEHLVRD 230

Query: 176 -AREDGTLRNPRARAGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
            AR   ++                      +       D  +   ++  + C  LP 
Sbjct: 231 GARVVSSVSRGFEPPELEARRATISYHRDRRTLMTFSFDAWALGLVIYWIWCADLPI 287


>3csfA [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
          Length = 839

 Score = 47.4 bits (111), Expect = 5e-08
 Identities = 15/217 (6%), Positives = 40/217 (18%), Gaps = 6/217 (2%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           K      L     G ++        +    L++    + +   +     LL         
Sbjct: 579 KCADPTALSNETIGIIFKHGDD-LRQDMLILQILRIMESIWETESLDLCLLPYGCISTGD 637

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
           +  +    +                    ++       K         A +        +
Sbjct: 638 KIGMIEIVKDATTIAKIQQSTVGNTGFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGY 697

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDG---TLRNPRARAGFRGT 194
            +      I   +                +DFG   +          L            
Sbjct: 698 CVATFVLGIGDRHNDNIMITETGNLF--HIDFGHLGERVPFVLTPDFLFVMGTSGKKTSP 755

Query: 195 VKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                    ++     +      + +   M    +P 
Sbjct: 756 HFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQ 792


>1cmkE [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
          Length = 348

 Score = 47.3 bits (111), Expect = 6e-08
 Identities = 40/221 (18%), Positives = 65/221 (29%), Gaps = 18/221 (8%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           ++  +K LG G+FG V LV  KE     +A+K+  +   +  LK     L E +  + V 
Sbjct: 42  QFERIKTLGTGSFGRVMLVKHKETGNH-FAMKILDKQK-VVKLKQIEHTLNEKRILQAVN 99

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
             FL   +         YMVM  V              +     +   AR     +    
Sbjct: 100 FPFLVKLEYSFKDNSNLYMVMEYVPGGEMFS-----HLRRIGRFSEPHARFYAAQIVLTF 154

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
                   I         K  + L             FA+               GT +Y
Sbjct: 155 EYLHSLDLIYRDL-----KPENLLIDQQGYIQVTDFGFAKRVKGRT------WLCGTPEY 203

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
                 + +   +  D  +   ++ EM  G  P+       
Sbjct: 204 LAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQ 244


>3dkgA [x.x.x] MET PROTO-ONCOGENE
          Length = 281

 Score = 47.2 bits (110), Expect = 7e-08
 Identities = 25/211 (11%), Positives = 56/211 (26%), Gaps = 10/211 (4%)

Query: 22  LKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVK-KQKIVGRHF 80
              +       VY  +  +K        +   +D           L E    +     + 
Sbjct: 26  SLIVHFNEVICVYHGTLLDKKIHCAVKSLNRITDI----GEVSQFLTEGIIMKDFSHPNV 81

Query: 81  LELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIG 140
           L L       +    +V+  +             +  ++   I    Q  + ++ L +  
Sbjct: 82  LSLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKFLASKK 141

Query: 141 FLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYAPL 200
           F+HRD+   N  +  K       V + DFG+AR   +          +   +  V    +
Sbjct: 142 FVHRDLAARNCMLDEKFT-----VKVADFGLARLPVKWMALESLQTQKFTTKSDVWSFGV 196

Query: 201 ACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                  +      +   + +          
Sbjct: 197 LLWELMTRGAPPYPDVNTFDITVYLLQGRRL 227


>2bfxB [x.x.x] LOC398457 PROTEIN
          Length = 275

 Score = 46.0 bits (107), Expect = 1e-07
 Identities = 36/214 (16%), Positives = 66/214 (30%), Gaps = 17/214 (7%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
                        G VYL  +K+      ALKV  +S                 +  +  
Sbjct: 12  TIDDFDIGRPLGKGNVYLAREKQNKF-IMALKVLFKSQLEKEGVEHQLRREIEIQSHLRH 70

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
            + L + +  +  ++   M+       L    +     +F    + +   +  +A+   H
Sbjct: 71  PNILRMYNYFHDRKRIYLMLEFAPRGELYKELQ--KHGRFDEQRSATFMEELADALHYCH 128

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
               +HRDIKP N               ++ +    K A    ++  P  R    GT+ Y
Sbjct: 129 ERKVIHRDIKPEN--------------LLMGYKGELKIADFGWSVHAPSLRRRMCGTLDY 174

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
            P      +    K D+     +  E   G  P+
Sbjct: 175 LPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPF 208


>2brmA [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
          Length = 263

 Score = 45.3 bits (106), Expect = 2e-07
 Identities = 26/228 (11%), Positives = 53/228 (23%), Gaps = 19/228 (8%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
            W +++ LGEGA+G V L   +   +   A+K+         +K E+ +   +  + +V 
Sbjct: 2   DWDLVQTLGEGAYGEVQLAVNR-VTEEAVAVKIVDMCP--ENIKKEICINKMLNHENVVK 58

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
            +                    L  +   D+      +       +      L  +   H
Sbjct: 59  FYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPE-PDAQRFFHQLMAGVVYLHGIGITH 117

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
                   +                             A         R      GT+ Y
Sbjct: 118 RDIKPENLLLDER---------------DNLKISDFGLATVFRYNNRERLLNKMCGTLPY 162

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKK 245
                  +RE   +        +V+          +            
Sbjct: 163 VAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDW 210


>3e8cE [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
          Length = 336

 Score = 44.1 bits (102), Expect = 5e-07
 Identities = 41/222 (18%), Positives = 83/222 (37%), Gaps = 18/222 (8%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
            ++  +K LG G+FG V LV +  +    YA+K+  +   + L ++E  +  +   Q + 
Sbjct: 29  DQFERIKTLGTGSFGRVMLV-KHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVN 87

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
               ++L            ++  + G  +    +     +FS   A   A Q +   E L
Sbjct: 88  FPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLR--RIGRFSEPHARFYAAQIVLTFEYL 145

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H++  ++RD+KP N       + +   + + DFG A++          P           
Sbjct: 146 HSLDLIYRDLKPENLL-----IDQQGYIQVTDFGFAKRVKGRTWLCGTPE---------- 190

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
           Y      + +   +  D  +   ++ EM  G  P+       
Sbjct: 191 YLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQ 232


>3dy7A [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
          Length = 260

 Score = 44.0 bits (102), Expect = 6e-07
 Identities = 32/215 (14%), Positives = 57/215 (26%), Gaps = 24/215 (11%)

Query: 19  WTILKKLGEGAFGAVYLVSQKEKPKV--EYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
           +  + +LG G  G V+ VS K    V     + +E +      +  E+ VL E     IV
Sbjct: 7   FEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIV 66

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
           G +       G         +           +      +        V+   ++ +  L
Sbjct: 67  GFY-------GAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYL 119

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
                +       +  +           + +   +                     GT  
Sbjct: 120 REKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSM---------------ANGTRS 164

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
           Y             + DI S    +VEM  GR P 
Sbjct: 165 YMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPI 199


>3dgkA [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
          Length = 278

 Score = 43.9 bits (101), Expect = 6e-07
 Identities = 34/272 (12%), Positives = 76/272 (27%), Gaps = 12/272 (4%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
            +   ++LG G F  V    +K       A  ++          +    +          
Sbjct: 11  YYDTGEELGSGKFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEI 70

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
           +H   +        K + +++  +    +     A     +   A    +Q L  V  LH
Sbjct: 71  QHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLH 130

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           ++   H D+KP N  +  + + + R   +      +                   GT ++
Sbjct: 131 SLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKID--------FGNEFKNIFGTPEF 182

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLFG 257
                        + D+ S   +   +  G  P+   T+ + +                 
Sbjct: 183 VAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYFSN 242

Query: 258 GCPREFTEVFPILDKGKFFDAPEYTTIYELLE 289
                   +  +L      D  +  TI + L+
Sbjct: 243 TSALAKDFIRRLL----VKDPKKRMTIQDSLQ 270


>3cquA [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
          Length = 318

 Score = 43.8 bits (101), Expect = 7e-07
 Identities = 42/222 (18%), Positives = 72/222 (32%), Gaps = 14/222 (6%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
            ++  LK LG+G FG V LV +K      YA+K+  +   +   ++   +      Q   
Sbjct: 5   NEFEYLKLLGKGTFGKVILVKEK-ATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSR 63

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
                 L        +  +++    G  L      +    FS   A     + + A++ L
Sbjct: 64  HPFLTALKYSFQTHDRLCFVMEYANGGEL--FFHLSRERVFSEDRARFYGAEIVSALDYL 121

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H+   +          +  K+ H     + L                   A   F GT +
Sbjct: 122 HSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEG-----------IKDGATMKFCGTPE 170

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
           Y         +  R  D      ++ EM CGRLP+ N     
Sbjct: 171 YLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEK 212


>2bmcB [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
          Length = 258

 Score = 43.8 bits (102), Expect = 7e-07
 Identities = 40/236 (16%), Positives = 70/236 (29%), Gaps = 13/236 (5%)

Query: 19  WTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGR 78
           + I + LG+G FG VYL  +K + K   ALKV  ++  L    +E  +  EV+ Q  +  
Sbjct: 9   FEIGRPLGKGKFGNVYLAREK-QSKFILALKVLFKAQ-LEKAGVEHQLRREVEIQSHLRH 66

Query: 79  HFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHN 138
             + L   G         ++          R+    +KF      +   +   A+   H+
Sbjct: 67  PNI-LRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS 125

Query: 139 IGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYA 198
              +HRDIKP N  +G        K+    + +   +         P    G     K  
Sbjct: 126 KRVIHRDIKPENLLLGSAGEL---KIADFGWSVTLDYL-------PPEMIEGRMHDEKVD 175

Query: 199 PLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRC 254
             +  +   +              E                    +          
Sbjct: 176 LWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHN 231


>3e59C [x.x.x] PYOVERDINE BIOSYNTHESIS PROTEIN PVCA
          Length = 303

 Score = 43.8 bits (101), Expect = 7e-07
 Identities = 7/155 (4%), Positives = 26/155 (16%), Gaps = 4/155 (2%)

Query: 126 ARQSLEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNP 185
             + +E V+      F+                       +       +           
Sbjct: 21  EIRRIEQVQLPRIAAFIEAGEPIEFVLPAFPAKSPNPGKVLDSRPDMAERLSLSFLNHLC 80

Query: 186 RARAGFRGTVK----YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVG 241
           +    F          +         +     I ++   +  M            + +  
Sbjct: 81  QRIQLFYAPGAKITVCSDGRVFGDLVRIGDAHISAYQDALRLMIEEIGATHIGVFNLEDV 140

Query: 242 VFKKECKTTRLRCLFGGCPREFTEVFPILDKGKFF 276
              +  +    +            +  I +     
Sbjct: 141 RAFEAQRDNHEQLRQLLIGGYAEPLESIRETLLAS 175


>2bvaA [x.x.x] P21-ACTIVATED KINASE 4
          Length = 272

 Score = 43.7 bits (101), Expect = 7e-07
 Identities = 33/232 (14%), Positives = 63/232 (27%), Gaps = 29/232 (12%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
                         G V + + +   K+    K              +   + + +    
Sbjct: 15  PGDPRSYLDNFIKIGIVCIATVRSSGKLVAVKK-----------MDLLFNEVVIMRDYQH 63

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
                         + +  M     G     +       + +     +V    L+A+  L
Sbjct: 64  ENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTH----TRMNEEQIAAVCLAVLQALSVL 119

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H  G +HRDIK  +       +    +V + DFG   +                  GT  
Sbjct: 120 HAQGVIHRDIKSDSI-----LLTHDGRVKLSDFGFCAQVEVPR---------RKLVGTPY 165

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECK 248
           +       +     + DI S   MV+EM  G  P+ N      + + +    
Sbjct: 166 WMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLP 217


>1e90A [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
           3-KINASE CATALYTIC SUBUNIT
          Length = 844

 Score = 43.6 bits (101), Expect = 8e-07
 Identities = 15/151 (9%), Positives = 31/151 (20%), Gaps = 11/151 (7%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKV---EYALKV------EAESDPLGLLKMEVAVLL 68
                             +  K    +      L++        E++ L L  +    + 
Sbjct: 573 WLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIS 632

Query: 69  EVKKQKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQ 128
              K  ++     +      + Q           + L    K     +     A+     
Sbjct: 633 TGDKIGMI-EIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKEKCPIEEKFQAAVERFVY 691

Query: 129 SLEAVEDLHNIGFLHRDIKPGNYTIGRKEMH 159
           S  A   +        D    N  I      
Sbjct: 692 SC-AGYCVATFVLGIGDRHNDNIMISETGNL 721


>3cqzH [x.x.x] DNA-DIRECTED RNA POLYMERASES I, II, AND III
          Length = 116

 Score = 43.1 bits (100), Expect = 1e-06
 Identities = 11/111 (9%), Positives = 25/111 (22%), Gaps = 14/111 (12%)

Query: 136 LHNIGFLHRDIKPGNYTIGR------------KEMHELRKVYMLDFGMARKFAREDGTL- 182
           L +  F   ++ PG Y                K   ++                   T  
Sbjct: 4   LFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASTRS 63

Query: 183 -RNPRARAGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWR 232
            R P+A            +     + +       S+  +++ +        
Sbjct: 64  WRPPQAGDRSLADDYDYVMYGTAYKFEEVSKVYYSFGGLLMRLEENAYLLI 114


>2ac5A [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
          Length = 276

 Score = 42.4 bits (97), Expect = 2e-06
 Identities = 26/143 (18%), Positives = 42/143 (29%), Gaps = 5/143 (3%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
                   LGEGA   V         +      +E +   +           EV+     
Sbjct: 13  VYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFR-----EVEMLYQC 67

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
             H   L       ++  + ++    +    L        F+   A  V +    A++ L
Sbjct: 68  QGHRNVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFL 127

Query: 137 HNIGFLHRDIKPGNYTIGRKEMH 159
           HN G  HRD+KP N         
Sbjct: 128 HNKGIAHRDLKPENILCEHPNQV 150


>2amuA [x.x.x] PUTATIVE SUPEROXIDE REDUCTASE
          Length = 132

 Score = 42.4 bits (99), Expect = 2e-06
 Identities = 13/136 (9%), Positives = 40/136 (29%), Gaps = 19/136 (13%)

Query: 21  ILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG--R 78
           +   +    F     V   E P+                +++ V V  E+          
Sbjct: 4   LSDFIKTEDFKKEKHVPVIEAPEK---------VKKDEKVQIVVTVGKEIPHPNTTEHHI 54

Query: 79  HFLELADRGNLPQKFNYMVMTLVGKSLQDL-RKTAPFNKFSMGTAISVAR----QSLEAV 133
            ++++  + +    + Y V      +  +  +       ++  T  +V +     ++ A+
Sbjct: 55  RWIKVFFQPD-GDPYVYEVGRYEFNAHGESVQGPNIGAVYTEPTVTTVVKLNRSGTIIAL 113

Query: 134 EDLHN--IGFLHRDIK 147
              +   +    + I 
Sbjct: 114 SYCNIHGLWESSQKIT 129


>3dfcB [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
          Length = 280

 Score = 42.3 bits (97), Expect = 2e-06
 Identities = 34/272 (12%), Positives = 77/272 (28%), Gaps = 12/272 (4%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
            +   ++LG G F  V    +K       A  ++          +    +          
Sbjct: 11  YYDTGEELGSGKFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEI 70

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
           +H   +        K + +++  +    +     A     +   A    +Q L  V  LH
Sbjct: 71  QHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLH 130

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           ++   H D+KP N  +  + + + R   +      +     +             GT ++
Sbjct: 131 SLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNE--------FKNIFGTPEF 182

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLFG 257
                        + D+ S   +   +  G  P+   T+ + +                 
Sbjct: 183 VAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEDEYFSN 242

Query: 258 GCPREFTEVFPILDKGKFFDAPEYTTIYELLE 289
                   +  +L      D  +  TI + L+
Sbjct: 243 TSALAKDFIRRLL----VKDPKKRMTIQDSLQ 270


>3dajA [x.x.x] SERINE/THREONINE KINASE 6
          Length = 245

 Score = 42.2 bits (97), Expect = 2e-06
 Identities = 29/222 (13%), Positives = 59/222 (26%), Gaps = 13/222 (5%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
             + I + LG+G FG VYL  +++   +     +         ++ ++       + +  
Sbjct: 5   EDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKAGVEHQLR---REVEIQSH 61

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
            RH   L   G         ++          R+    ++F      +   +   A+   
Sbjct: 62  LRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSRFDEQRTATYITELANALSYC 121

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H+   +HRDIKP N  +G     ++                 D  +              
Sbjct: 122 HSKRVIHRDIKPENLLLGSNGELKIADFGWSTLDYLPPEMIHDEKVDLWS---------- 171

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
              L           +                     +TE  
Sbjct: 172 LGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGA 213


>3c5yB [x.x.x] RIBOSE/GALACTOSE ISOMERASE
          Length = 202

 Score = 42.1 bits (97), Expect = 2e-06
 Identities = 10/148 (6%), Positives = 29/148 (19%), Gaps = 11/148 (7%)

Query: 132 AVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGF 191
                     +H  +      +G K           ++G   +       +    A    
Sbjct: 8   ENSQAAKNAVVHEALTTVAEPLGHKVF---------NYGYTAEDKASLTYVNGLLAGILL 58

Query: 192 RGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTR 251
                 A              +       +V        +  + + + +  + K      
Sbjct: 59  N--SGAADFVVTGGTGGSLAANAPGVFCGLVIDPTDAFLFGQINDGNAISPYSKGFGWAA 116

Query: 252 LRCLFGGCPREFTEVFPILDKGKFFDAP 279
              L     + F     +    +  +  
Sbjct: 117 ELNLQDVYRKLFDGERGLGYPRERAEIR 144


>3blrA [x.x.x] CELL DIVISION PROTEIN KINASE 9
          Length = 300

 Score = 41.9 bits (97), Expect = 2e-06
 Identities = 34/221 (15%), Positives = 62/221 (28%), Gaps = 17/221 (7%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           K+  L K+G+G FG V+    ++  +   ALK     +        +  L E+K  +++ 
Sbjct: 12  KYEKLAKIGQGTFGEVFKARHRKTGQK-VALKKVLMENE--KEGFPITALREIKILQLLK 68

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
              +           +          +         F          V +  L  +  +H
Sbjct: 69  HENVVNLIEICRTSIYLVFDFCEHDLAGLLSNVLVKFTLS---EIKRVMQMLLNGLYYIH 125

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
               LHRD+K  N       +     V  L      +         N             
Sbjct: 126 RNKILHRDMKAAN------VLITRDGVLKLADFGLARAFSLAPNRYNRVV-----TLWYR 174

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
            P     +R+     D+     ++ EM       +  TE  
Sbjct: 175 PPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQH 215


>3dk6B [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
          Length = 259

 Score = 41.1 bits (94), Expect = 4e-06
 Identities = 26/142 (18%), Positives = 49/142 (34%), Gaps = 10/142 (7%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           KW + +         VY    K+         V  ++  +     E AV+ E+K   +V 
Sbjct: 1   KWEMERTDITMKHKEVYEGVWKKYSLT-----VAVKTLEVEEFLKEAAVMKEIKHPNLV- 54

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
           +                +M    +   L++  +     + S    + +A Q   A+E L 
Sbjct: 55  QLLGVCTREPPFYIITEFMTYGNLLDYLRECNR----QEVSAVVLLYMATQISSAMEYLE 110

Query: 138 NIGFLHRDIKPGNYTIGRKEMH 159
              F+HRD+   N  +G   + 
Sbjct: 111 KKNFIHRDLAARNCLVGENHLV 132


>3c5yE [x.x.x] RIBOSE/GALACTOSE ISOMERASE
          Length = 205

 Score = 41.0 bits (94), Expect = 5e-06
 Identities = 9/115 (7%), Positives = 25/115 (21%), Gaps = 13/115 (11%)

Query: 126 ARQSLEAVE--DLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLR 183
             +    +E         +H  +      +G K         + ++G   +   +     
Sbjct: 2   QGKIALIIENSQAAKNAVVHEALTTVAEPLGHK---------VFNYGYTAED--KASLTY 50

Query: 184 NPRARAGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
                AG       A              +       +V        +  + + +
Sbjct: 51  VNGLLAGILLNSGAADFVVTGGTGGSLAANAPGVFCGLVIDPTDAFLFGQINDGN 105


>3bhhC [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
          Length = 285

 Score = 40.9 bits (94), Expect = 5e-06
 Identities = 42/213 (19%), Positives = 76/213 (35%), Gaps = 20/213 (9%)

Query: 23  KKLGEGAFGAVYLVSQKEKPKVEYALKV----EAESDPLGLLKMEVAVLLEVKKQKIVGR 78
            +        V    +      EYA K+    +  +     L+ E  +   +K   IV R
Sbjct: 3   DEYQLYEDIVVRRCVKL-CTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIV-R 60

Query: 79  HFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHN 138
               +++ G     F+ +    + + +           +S   A    +Q LEAV   H 
Sbjct: 61  LHDSISEEGFHYLVFDLVTGGELFEDIV------AREYYSEADASHCIQQILEAVLHCHQ 114

Query: 139 IGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYA 198
           +G +HRD+KP N  +      +   V + DFG+A +   +           GF GT  Y 
Sbjct: 115 MGVVHRDLKPEN--LLLASKCKGAAVKLADFGLAIEVQGDQQA------WFGFAGTPGYL 166

Query: 199 PLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                 +    +  DI +   ++  +  G  P+
Sbjct: 167 SPEVLRKEAYGKPVDIWACGVILYILLVGYPPF 199


>3e3pA [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
          Length = 337

 Score = 40.7 bits (94), Expect = 6e-06
 Identities = 32/220 (14%), Positives = 55/220 (25%), Gaps = 18/220 (8%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKV---EAESDPLGLLKMEVAVLLEVKKQK 74
                K++       V L  +K       A+K    +       L  M+   +L      
Sbjct: 4   DERSRKEMDRFQVE-VQLGKEKSTGMS-VAIKKVIQDPRFRNRELQIMQDLAVLHHPNIV 61

Query: 75  IVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTA---PFNKFSMGTAISVARQSLE 131
            +  +F  L +R       N ++  +     +  R            +            
Sbjct: 62  QLQSYFYTLGERDRRDIYLNVVMEYVPDTLHRCCRNYYRRQVAPPPILIKVFLFQLIRSI 121

Query: 132 AVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGF 191
               L ++   HRDIKP N  +   +         L    + K                 
Sbjct: 122 GCLHLPSVNVCHRDIKPHNVLVNEADGTLK-----LCDFGSAKKLSPSEPNVAY-----I 171

Query: 192 RGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                 AP      +      DI S   +  EM  G   +
Sbjct: 172 CSRYYRAPELIFGNQHYTTAVDIWSVGCIFAEMMLGEPIF 211


>3e5aA [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
          Length = 264

 Score = 40.7 bits (93), Expect = 6e-06
 Identities = 28/135 (20%), Positives = 50/135 (37%), Gaps = 3/135 (2%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
             + I + LG+G FG VYL  +K+   +     +      L    +E  +  EV+ Q  +
Sbjct: 7   EDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQ--LEKAGVEHQLRREVEIQSHL 64

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
               +             Y+++          R+    +KF      +   +   A+   
Sbjct: 65  RHPNILRLYGYFHDATRVYLILEYAPLGT-VYRELQKLSKFDEQRTATYITELANALSYC 123

Query: 137 HNIGFLHRDIKPGNY 151
           H+   +HRDIKP N 
Sbjct: 124 HSKRVIHRDIKPENL 138


>2dwbA [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
          Length = 259

 Score = 39.8 bits (91), Expect = 1e-05
 Identities = 37/216 (17%), Positives = 66/216 (30%), Gaps = 20/216 (9%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
            + I + LG+G FG VYL  +K+   +     +           +E  +  EV+ Q  + 
Sbjct: 7   DFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQL--EKAGVEHQLRREVEIQSHLR 64

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
              +             Y+++          R+    +KF      +   +   A+   H
Sbjct: 65  HPNILRLYGYFHDATRVYLILEYAPLGT-VYRELQKLSKFDEQRTATYITELANALSYCH 123

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           +   +HRDIKP N  +G           + DFG +                         
Sbjct: 124 SKRVIHRDIKPENLLLGSAGEL-----KIADFGWSVHAPSSRTLCGTLDYLPPEIE---- 174

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRN 233
                        K D+ S   +  E   G+ P+  
Sbjct: 175 --------GRHDEKVDLWSLGVLCYEFLVGKPPFEA 202


>2chwA [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
          Length = 840

 Score = 39.8 bits (90), Expect = 1e-05
 Identities = 19/223 (8%), Positives = 40/223 (17%), Gaps = 15/223 (6%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKV---EYALKVEAESDPLGLLKMEVAVLLEVKKQK 74
                             +  K    +      L++    + +   +     LL      
Sbjct: 573 WLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIS 632

Query: 75  IVG-----RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQS 129
                       +      + Q           + L    K           A       
Sbjct: 633 TGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKE-KSPTEEKFQAAVERFVY 691

Query: 130 LEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAR-EDGTLRNPRAR 188
             A   +        D    N       + E   ++ +DFG  R         L      
Sbjct: 692 SCAGYCVATFVLGIGDRHNDNIM-----ITETGNLFHIDFGHERVPFVLTPDFLFVMGTS 746

Query: 189 AGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                          ++     +      + +   M    +P 
Sbjct: 747 GKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQ 789


>3dfaA [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE CGD3_920
          Length = 265

 Score = 39.4 bits (90), Expect = 1e-05
 Identities = 31/134 (23%), Positives = 56/134 (41%), Gaps = 5/134 (3%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
            ++ I+  LG+G+FG V     +   + EYA+KV  ++      K    +L EV+  K +
Sbjct: 8   ERYNIVCMLGKGSFGEVLKCKDR-ITQQEYAVKVINKASAKN--KDTSTILREVELLKKL 64

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
               +             Y+V  L   + +   +     +FS   A  + +Q    +  +
Sbjct: 65  DHPNIMKLFEILEDSSSFYIVGELY--TGELFDEIIKRKRFSEHDAARIIKQVFSGITYM 122

Query: 137 HNIGFLHRDIKPGN 150
           H    +HRD+KP N
Sbjct: 123 HKHNIVHRDLKPEN 136


>1e7vA [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
           3-KINASE CATALYTIC SUBUNIT
          Length = 850

 Score = 39.3 bits (90), Expect = 1e-05
 Identities = 22/226 (9%), Positives = 46/226 (20%), Gaps = 20/226 (8%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKV---EYALKV------EAESDPLGLLKMEVAVLL 68
                             +  K    +      L++        E++ L L  +    + 
Sbjct: 578 WLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIS 637

Query: 69  EVKKQKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQ 128
              K  ++     +      + Q           + L    K           A      
Sbjct: 638 TGDKIGMI-EIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKE-KCPIEEKFQAAVERFV 695

Query: 129 SLEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRAR 188
              A   +        D    N  I          ++ +DFG   K         +    
Sbjct: 696 YSCAGYCVATFVLGIGDRHNDNIMISETGN-----LFHIDFGHINKERVPFVLTPDFLFV 750

Query: 189 AGFRGTVKYAPL----ACHIQREQCRKDDIESWLYMVVEMTCGRLP 230
            G  G              ++     +      + +   M    +P
Sbjct: 751 MGTSGKKTSLHFQKFQDVCVKAYLALRHHTNLLIILFSMMLMTGMP 796


>3c5yA [x.x.x] RIBOSE/GALACTOSE ISOMERASE
          Length = 201

 Score = 39.1 bits (89), Expect = 2e-05
 Identities = 6/102 (5%), Positives = 18/102 (17%), Gaps = 11/102 (10%)

Query: 130 LEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARA 189
           +           +H  +           + E     + ++G   +       +    A  
Sbjct: 6   IIENSQAAKNAVVHEALTT---------VAEPLGHKVFNYGYTAEDKASLTYVNGLLAGI 56

Query: 190 GFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                   A              +       +V        +
Sbjct: 57  LLN--SGAADFVVTGGTGGSLAANAPGVFCGLVIDPTDAFLF 96


>3cq9B [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
          Length = 214

 Score = 39.0 bits (89), Expect = 2e-05
 Identities = 14/167 (8%), Positives = 30/167 (17%), Gaps = 8/167 (4%)

Query: 16  CGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKI 75
                +           V    Q        A+K   E      + +  A    +     
Sbjct: 51  IDAAELQTVKDALVGAIVVKPDQDHTDTQ-LAIKSIFEQLQPDEVHLYGATGGRLDHLLA 109

Query: 76  VGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVED 135
                  +  +              V   L    +            + +   +L   + 
Sbjct: 110 NWLVLDPVFRQWAPQI-KLIDKQNSVRFFLPGDYQITKEADKRYLAFVPLPHLTLPDEKY 168

Query: 136 L-HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGT 181
                   +      N   G                +A   +R+D  
Sbjct: 169 QLDAAYNAYPISWASNEFSGNTG-----HFSFDAGVLAVIQSRDDSA 210


>3daeA [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
          Length = 248

 Score = 38.6 bits (88), Expect = 2e-05
 Identities = 31/147 (21%), Positives = 59/147 (40%), Gaps = 8/147 (5%)

Query: 13  GSECGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKK 72
           G+  G + I+K LGEG+FG V L       +      +  +    G ++ E++ L  ++ 
Sbjct: 2   GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAQGRIEREISYLRLLRH 61

Query: 73  QKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEA 132
             I+  +         + +  + ++M +     +        +K S   A    +Q + A
Sbjct: 62  PHIIKLYD--------VIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISA 113

Query: 133 VEDLHNIGFLHRDIKPGNYTIGRKEMH 159
           VE  H    +HRD+KP N  +      
Sbjct: 114 VEYCHRHKIVHRDLKPENLLLDEHLNV 140


>3dlsE [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
          Length = 282

 Score = 37.3 bits (84), Expect = 6e-05
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 18 KWTILKKLGEGAFGAVYLVSQKEKPK---VEYALKVEAESDPLGL--LKMEVAVLLEVKK 72
          K++ +  LG GAFG V+    KEK K   V++  K +   +   L  + +E+A+L  V+ 
Sbjct: 17 KYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVWIEDPKLGKVTLEIAILSRVEH 76

Query: 73 QKIVGRHF 80
            I+    
Sbjct: 77 ANIIKVLD 84


>3c4yB [x.x.x] RHODOPSIN KINASE
          Length = 466

 Score = 37.1 bits (84), Expect = 7e-05
 Identities = 44/242 (18%), Positives = 74/242 (30%), Gaps = 16/242 (6%)

Query: 16  CGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKI 75
             +   + +     F  V+    K      YA K +     L   K     ++E K    
Sbjct: 139 WLEAQPMGEDWFLDFRVVFACQMK-ATGKLYACK-KLNKKRLKKRKGYQGAMVEKKILAK 196

Query: 76  VGRHFLELADRGNLPQKFNYMVMT--LVGKSLQDLRKTAPFNKFSM-GTAISVARQSLEA 132
           V   F+         +    +VMT    G     +      N       AI    Q +  
Sbjct: 197 VHSRFIVSLAYAFETKTDLCLVMTIMNGGDIRYHIYNVDEDNPGFQEPRAIFYTAQIVSG 256

Query: 133 VEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFR 192
           +E LH    ++RD+KP N  +      +   V + D G+A +               G+ 
Sbjct: 257 LEHLHQRNIIYRDLKPENVLL-----DDDGNVRISDLGLAVELKAGQTK------TKGYA 305

Query: 193 GTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRL 252
           GT  +      +  E     D  +    + EM   R P+R   E  +    K+      +
Sbjct: 306 GTPGFMAPELLLGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRVLEQAV 365

Query: 253 RC 254
             
Sbjct: 366 TY 367


>3c5yL [x.x.x] RIBOSE/GALACTOSE ISOMERASE
          Length = 203

 Score = 37.1 bits (84), Expect = 7e-05
 Identities = 5/98 (5%), Positives = 15/98 (15%), Gaps = 11/98 (11%)

Query: 135 DLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGT 194
                  +H  +             E     + ++G   +       +    A       
Sbjct: 11  QAAKNAVVHEALTTVA---------EPLGHKVFNYGYTAEDKASLTYVNGLLAGILLNSG 61

Query: 195 VKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWR 232
                             +       +V        + 
Sbjct: 62  AAD--FVVTGGTGGSLAANAPGVFCGLVIDPTDAFLFG 97


>1csnA [d.144.1 (1eh4A)] CASEIN KINASE-1
          Length = 293

 Score = 37.0 bits (83), Expect = 7e-05
 Identities = 42/292 (14%), Positives = 85/292 (29%), Gaps = 10/292 (3%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
            + + +++GEG+FG ++  +     +          SD   L        L      I  
Sbjct: 6   HYKVGRRIGEGSFGVIFEGTNLLNNQQVAIKFEPRRSDAPQLRDEYRTYKLLAGCTGIPN 65

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQ---DLRKTAPFNKFSMGTAISVARQSLEAVE 134
            ++             N +V+ L+G SL+   DL       K     A  +  +     E
Sbjct: 66  VYY------FGQEGLHNVLVIDLLGPSLEDLLDLCGRKFSVKTVAMAAKQMLARVQSIHE 119

Query: 135 DLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGT 194
                  +  D         +         + +         ++    R  +  +G    
Sbjct: 120 KSLVYRDIKPDNFLIGRPNSKNANMIYVVDFGMVKFYRDPVTKQHIPYREKKNLSGTARY 179

Query: 195 VKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRC 254
           +         Q  +   + +       +  +      +  T         ++ ++T LR 
Sbjct: 180 MSINTHLGREQSRRDDLEALGHVFMYFLRGSLPWQGLKAATNKQKYERIGEKKQSTPLRE 239

Query: 255 LFGGCPREFTEVFPILDKGKFFDAPEYTTIYELLEKAMVNTKSNEF-PYDWE 305
           L  G P EF +         F   P+Y  +  L  K +    + E   +DW 
Sbjct: 240 LCAGFPEEFYKYMHYARNLAFDATPDYDYLQGLFSKVLERLNTTEDENFDWN 291


>2bkkC [x.x.x] AMINOGLYCOSIDE 3'-PHOSPHOTRANSFERASE
          Length = 262

 Score = 36.7 bits (83), Expect = 9e-05
 Identities = 15/203 (7%), Positives = 44/203 (21%), Gaps = 49/203 (24%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVL--------- 67
            K+  +K     +   VY +  + +           +     + + +  +L         
Sbjct: 13  EKYRSVKDTEGMSPAKVYKLVGENENLYLKMTDSRYKGTTYDVEREKDMMLWLEGKLPVP 72

Query: 68  ---------------------------------------LEVKKQKIVGRHFLELADRGN 88
                                                  L  +  ++     +      N
Sbjct: 73  KVLHFERHDGWSNLLMSEADGVLCSEEYEDEQSPEKIIELYAECIRLFHSIDISDCPYTN 132

Query: 89  LPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIGFLHRDIKP 148
                   +  L+   L D+     + + +           L+  +    + F H D+  
Sbjct: 133 SLDSRLAELDYLLNNDLADVDSE-NWEEDTPFKDPRELYDFLKTEKPEEELVFSHGDLGD 191

Query: 149 GNYTIGRKEMHELRKVYMLDFGM 171
            N  +   ++     +       
Sbjct: 192 SNIFVKDGKVSGFIDLGRSGRAD 214


>3dlsC [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
          Length = 281

 Score = 36.4 bits (82), Expect = 1e-04
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 17 GKWTILKKLGEGAFGAVYLVSQKEKPK---VEYALKVEA-ESDPLGLLKMEVAVL 67
           K++ +  LG GAFG V+    KEK K   V++  K +  E   LG + +E+A+L
Sbjct: 16 QKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVIEDPKLGKVTLEIAIL 70


>3csvA [x.x.x] AMINOGLYCOSIDE PHOSPHOTRANSFERASE
          Length = 316

 Score = 36.3 bits (82), Expect = 1e-04
 Identities = 3/37 (8%), Positives = 7/37 (18%), Gaps = 1/37 (2%)

Query: 14 SECGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKV 50
           E   +       +      Y   +      +  L  
Sbjct: 4  DEIRDFLATHGYADWNRTPRYQRLRSPTGA-KAVLDW 39


>3bhhD [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
          Length = 286

 Score = 36.3 bits (82), Expect = 1e-04
 Identities = 41/218 (18%), Positives = 74/218 (33%), Gaps = 20/218 (9%)

Query: 23  KKLGEGAFGAVYLVSQKEKPKVEYALKV----EAESDPLGLLKMEVAVLLEVKKQKIVGR 78
            +        V    +      EYA K+    +  +     L+ E  +   +K   IV R
Sbjct: 3   DEYQLYEDIVVRRCVKL-CTGHEYAAKIINTKKLSARDHQKLEREARICRLLKHSNIV-R 60

Query: 79  HFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHN 138
               +++ G     F+ +                    +S   A    +Q LEAV   H 
Sbjct: 61  LHDSISEEGFHYLVFDLVTGGE------LFEDIVAREYYSEADASHCIQQILEAVLHCHQ 114

Query: 139 IGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYA 198
           +G +HRD+KP N  +      +   V + DFG+A +   +            F GT  Y 
Sbjct: 115 MGVVHRDLKPEN--LLLASKCKGAAVKLADFGLAIEVQGDQQAWFG------FAGTPGYL 166

Query: 199 PLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTE 236
                 +    +  DI +   ++  +  G  P+ +  +
Sbjct: 167 SPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQ 204


>3daeB [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
          Length = 246

 Score = 36.3 bits (82), Expect = 1e-04
 Identities = 30/143 (20%), Positives = 57/143 (39%), Gaps = 8/143 (5%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
           G + I+K LGEG+FG V L       +      +  +    G ++ E++ L  ++   I+
Sbjct: 4   GNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAQGRIEREISYLRLLRHPHII 63

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
             +         + +  + ++M +     +        +K S   A    +Q + AVE  
Sbjct: 64  KLYD--------VIKSKDEIIMVIEYAGNELFDYIVQRDKMSEQEARRFFQQIISAVEYC 115

Query: 137 HNIGFLHRDIKPGNYTIGRKEMH 159
           H    +HRD+KP N  +      
Sbjct: 116 HRHKIVHRDLKPENLLLDEHLNV 138


>2a1sB [x.x.x] POLY(A)-SPECIFIC RIBONUCLEASE PARN
          Length = 390

 Score = 36.0 bits (81), Expect = 1e-04
 Identities = 19/226 (8%), Positives = 48/226 (21%), Gaps = 36/226 (15%)

Query: 16  CGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKI 75
                +L + G   F   Y  S+       +            +            K   
Sbjct: 53  HSMDFLLFQFGLCTFKYDYTDSKYITKSFNF-----------YVFPKPFNRSSPDVKFVC 101

Query: 76  VGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVED 135
                  LA +G    K     +  + +  ++ R+              + +   +  + 
Sbjct: 102 QSSSIDFLASQGFDFNKVFRNGIPYLNQ--EEERQLREQYDIPEDQKKFIDQVVEKIEDL 159

Query: 136 LHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTV 195
           L +    + D++P      +          +              T          +   
Sbjct: 160 LQSEENKNLDLEPCTGFQRKL-----IYQTLSWKYPKGIHVETLET--------EKKERY 206

Query: 196 KYAPLACHIQR----------EQCRKDDIESWLYMVVEMTCGRLPW 231
                    +R          EQ   +D   +  ++  +       
Sbjct: 207 IVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLV 252


>3cs9D [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
          Length = 263

 Score = 36.0 bits (81), Expect = 2e-04
 Identities = 37/222 (16%), Positives = 70/222 (31%), Gaps = 17/222 (7%)

Query: 20  TILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV-GR 78
                  +   G        E      A+K   E             L E    K +   
Sbjct: 6   ERTDITMKHKLGGGQYGEVYEGVWT-VAVKTLKEDT-----MEVEEFLKEAAVMKEIKHP 59

Query: 79  HFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHN 138
           + ++L         F  +   +   +L D  +     + +    + +A Q   A+E L  
Sbjct: 60  NLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEK 119

Query: 139 IGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYA 198
             F+HRD+   N       + E   V + DFG++R       T     A AG +  +K+ 
Sbjct: 120 KNFIHRDLAARNC-----LVGENHLVKVADFGLSRLM-----TGDTYTAHAGAKFPIKWT 169

Query: 199 PLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDV 240
                   +   K D+ ++  ++ E+    +      +   V
Sbjct: 170 APESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQV 211


>3dplC [x.x.x] CULLIN-5
          Length = 378

 Score = 35.8 bits (81), Expect = 2e-04
 Identities = 11/135 (8%), Positives = 36/135 (26%), Gaps = 18/135 (13%)

Query: 16  CGKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKI 75
                         F  +     +++ K+   +                   L++  +++
Sbjct: 256 KDFTEGTLFSVNQEFSLIKNAKVQKRGKI-NLIGR-----------------LQLTTERM 297

Query: 76  VGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVED 135
                  +     L  +   + +  + K + + +      +      +   +   E +E 
Sbjct: 298 REEENEGIVQLRILRTQEAIIQIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEW 357

Query: 136 LHNIGFLHRDIKPGN 150
           L    ++ RD    N
Sbjct: 358 LIEHKYIRRDESDIN 372


>3dlsB [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
          Length = 280

 Score = 35.7 bits (80), Expect = 2e-04
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 17 GKWTILKKLGEGAFGAVYLVSQKEKPK---VEYALKVEAESDPLGLLKMEVAVL 67
           K++ +  LG GAFG V+    KEK K   V++  K   E   LG + +E+A+L
Sbjct: 16 QKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEWIEDPKLGKVTLEIAIL 69


>3dlsD [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
          Length = 284

 Score = 35.6 bits (80), Expect = 2e-04
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 18 KWTILKKLGEGAFGAVYLVSQKEKPK 43
          K++ +  LG GAFG V+    KEK K
Sbjct: 17 KYSTMSPLGSGAFGFVWTAVDKEKNK 42


>1bygA [d.144.1] PROTEIN (C-TERMINAL SRC KINASE)
          Length = 246

 Score = 35.6 bits (80), Expect = 2e-04
 Identities = 9/50 (18%), Positives = 17/50 (34%), Gaps = 5/50 (10%)

Query: 18 KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVL 67
          +  +L+ +G+G FG V L   +                       E +V+
Sbjct: 8  ELKLLQTIGKGEFGDVMLGDYRGNKVA-VKCIKNDAQA----FLAEASVM 52


>3dk7B [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
          Length = 268

 Score = 35.5 bits (80), Expect = 2e-04
 Identities = 40/249 (16%), Positives = 72/249 (28%), Gaps = 26/249 (10%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKV-EAESDPLGLLKMEVAVLLEVKKQKIV 76
             T+  KLG G +G VY     E    +Y+L V       +     E AV+ E+K   +V
Sbjct: 9   DITMKHKLGGGQYGEVY-----EGVWKKYSLTVAVKTLMEVEEFLKEAAVMKEIKHPNLV 63

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
            +                +M       +L D  +     + S    + +A Q   A+E L
Sbjct: 64  -QLLGVCTREPPFYIIIEFMTY----GNLLDYLRECNRQEVSAVVLLYMATQISSAMEYL 118

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
               F+HRD+   N               + +  + +        L      A       
Sbjct: 119 EKKNFIHRDLAARN-------------CLVGENHLVKVADFGLSRLMTGDTTAHAGAKFP 165

Query: 197 YAPLACHIQREQC--RKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRC 254
               A           K D+ ++  ++ E+    +      +   V    ++        
Sbjct: 166 IKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDPSQVYELLEKDYRMERPE 225

Query: 255 LFGGCPREF 263
                  E 
Sbjct: 226 GCPEKVYEL 234


>1e7uA [d.15.1 - b.7.1 - a.118.1 - d.144.1] PHOSPHATIDYLINOSITOL
           3-KINASE CATALYTIC SUBUNIT
          Length = 872

 Score = 35.2 bits (79), Expect = 3e-04
 Identities = 19/218 (8%), Positives = 39/218 (17%), Gaps = 25/218 (11%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKV---EYALKV-EAESDPLGLLKMEVAVLLEVKKQ 73
                             +  K    +      L++            +++ +L      
Sbjct: 600 WLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIS 659

Query: 74  KIVGRHFLELADR----GNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQS 129
                  +E+         + Q           + L    K     +     A+     S
Sbjct: 660 TGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLSHWLKEKCPIEEKFQAAVERFVYS 719

Query: 130 LEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARA 189
             A   +        D    N  I          ++ +DFG   K         +     
Sbjct: 720 C-AGYCVATFVLGIGDRHNDNIMISETGN-----LFHIDFGHINKERVPFVLTPDFLFVM 773

Query: 190 GFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCG 227
           G  G                     +            
Sbjct: 774 GTSGKKTS-----------LHFQKFQDVCVKAYLALRH 800


>2c3iB [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
          Length = 266

 Score = 35.2 bits (78), Expect = 3e-04
 Identities = 7/29 (24%), Positives = 12/29 (41%)

Query: 18 KWTILKKLGEGAFGAVYLVSQKEKPKVEY 46
          ++ +   LG G FG+VY   +        
Sbjct: 1  QYQVGPLLGSGGFGSVYSGIRVSDNLPVA 29


>3cq9D [x.x.x] UNCHARACTERIZED PROTEIN LP_1622
          Length = 199

 Score = 35.0 bits (79), Expect = 3e-04
 Identities = 15/156 (9%), Positives = 37/156 (23%), Gaps = 7/156 (4%)

Query: 25  LGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGRHFLELA 84
           + +   GA+ +   ++    + A+K   E      + +  A    +            + 
Sbjct: 50  VKDALVGAIVVKPDQDHTDTQLAIKSIFEQLQPDEVHLYGATGGRLDHLLANWLVLDPVF 109

Query: 85  DRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL-HNIGFLH 143
            +     K        V   L    +            + +   +L   +         +
Sbjct: 110 RQWAPQIKL-IDKQNSVRFFLPGDYQITKEADKRYLAFVPLPHLTLPDEKYQLDAAYNAY 168

Query: 144 RDIKPGNYTIGRKEMHELRKVYMLDFGMARKFARED 179
                 N   G                +A   +R+D
Sbjct: 169 PISWASNEFSGNT-----GHFSFDAGVLAVIQSRDD 199


>2bvaB [x.x.x] P21-ACTIVATED KINASE 4
          Length = 274

 Score = 34.9 bits (78), Expect = 3e-04
 Identities = 28/238 (11%), Positives = 61/238 (25%), Gaps = 14/238 (5%)

Query: 19  WTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVGR 78
            + L    +   G V + + +   K+  A+K         LL  EV ++ + + + +V  
Sbjct: 18  RSYLDNFIKIGEGIVCIATVRSSGKL-VAVKKMDL-----LLFNEVVIMRDYQHENVVEM 71

Query: 79  HFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHN 138
           +              + + + +       L       + +     +V    L+A+  LH 
Sbjct: 72  YN--------SYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHA 123

Query: 139 IGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKYA 198
            G +HRDIK  +  +      +L            +                        
Sbjct: 124 QGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVEVPRRKLVGTPYWMAPELISRLPYGPEV 183

Query: 199 PLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLF 256
            +           D    +           +         ++       K    R L 
Sbjct: 184 DIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLV 241


>3dlsA [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
          Length = 285

 Score = 34.9 bits (78), Expect = 3e-04
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 18 KWTILKKLGEGAFGAVYLVSQKEKPK 43
          K++ +  LG GAFG V+    KEK K
Sbjct: 17 KYSTMSPLGSGAFGFVWTAVDKEKNK 42


>2cunA [x.x.x] PHOSPHOGLYCERATE KINASE
          Length = 405

 Score = 34.6 bits (78), Expect = 4e-04
 Identities = 12/183 (6%), Positives = 34/183 (18%), Gaps = 10/183 (5%)

Query: 62  MEVAVLLEVKKQKIVGRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGT 121
           ME  +   ++         + +     +      +   L  +    +             
Sbjct: 174 MEKEIEALMRAYYSKDSPKIYVLGGAKVEDSLKVVENVLRRERADLVLTGGLVANVFTLA 233

Query: 122 AISVARQSLEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGT 181
                 +                D       I   +         +DF +  K  R +  
Sbjct: 234 KGFDLGRKN-VEFMKK---KGLLDYVKHAEEIL--DEFYPYIRTPVDFAVDYKGERVE-- 285

Query: 182 LRNPRARAGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVG 241
                         +Y  +    +  +  ++ +     +V     G              
Sbjct: 286 --IDLLSENRGLLHQYQIMDIGKRTAEKYREILMKARIIVANGPMGVFEREEFAIGTVEV 343

Query: 242 VFK 244
              
Sbjct: 344 FKA 346


>2chxA [x.x.x] PHOSPHATIDYLINOSITOL-4,5-BISPHOSPHATE 3-KINASE
          Length = 842

 Score = 34.4 bits (76), Expect = 5e-04
 Identities = 21/273 (7%), Positives = 54/273 (19%), Gaps = 20/273 (7%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
                             +  K    +   + +      +  +    ++ L +     + 
Sbjct: 575 WLEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIS 634

Query: 78  RH--------FLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQS 129
                       +      + Q           + L    K           A       
Sbjct: 635 TGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKE-KSPTEEKFQAAVERFVY 693

Query: 130 LEAVEDLHNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFARE-DGTLRNPRAR 188
             A   +        D    N       + E   ++ +DFG  R         L      
Sbjct: 694 SCAGYCVATFVLGIGDRHNDNIM-----ITETGNLFHIDFGHERVPFVLTPDFLFVMGTS 748

Query: 189 AGFRGTVKYAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECK 248
                          ++     +      + +   M    +P   LT  +D+   +    
Sbjct: 749 GKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQ--LTSKEDIEYIRDAL- 805

Query: 249 TTRLRCLFGGCPREFTEVFPILDKGKFFDAPEY 281
              +        + F +   +     +     +
Sbjct: 806 --TVGKNEEDAKKYFLDQIEVCRDKGWTVQFNW 836


>2bajA [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
          Length = 337

 Score = 34.2 bits (76), Expect = 5e-04
 Identities = 34/214 (15%), Positives = 66/214 (30%), Gaps = 27/214 (12%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           ++  L  +G GA+G+V      +        K          L      ++  K+     
Sbjct: 22  RYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKK----------LSRPFQSIIHAKRTYREL 71

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
           R    +     +     +     + +       T             +  Q L  ++ +H
Sbjct: 72  RLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNDHVQFLIYQILRGLKYIH 131

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           +   +HRD+KP N  +  ++      + +LDFG+AR                   G V  
Sbjct: 132 SADIIHRDLKPSNLAV-NEDCE----LKILDFGLARHT------------DDEMTGYVAT 174

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPW 231
                       +  DI S   ++ E+  GR  +
Sbjct: 175 RWYRAPEIMLNNQTVDIWSVGCIMAELLTGRTLF 208


>2ckeA [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
          Length = 301

 Score = 34.0 bits (75), Expect = 6e-04
 Identities = 33/255 (12%), Positives = 68/255 (26%), Gaps = 8/255 (3%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
            + I ++LG G F  V    +K       A  ++          +    +          
Sbjct: 12  FYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQV 71

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
            H   +        + + +++  +    +     A     S   A S  +Q L+ V  LH
Sbjct: 72  LHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLH 131

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
                H D+KP N  +  K +       +            +             GT ++
Sbjct: 132 TKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVE--------FKNIFGTPEF 183

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTRLRCLFG 257
                        + D+ S   +   +  G  P+   T+ + +                 
Sbjct: 184 VAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITSVSYDFDEEFFSH 243

Query: 258 GCPREFTEVFPILDK 272
                   +  +L K
Sbjct: 244 TSELAKDFIRKLLVK 258


>3dneA [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
          Length = 336

 Score = 33.9 bits (75), Expect = 7e-04
 Identities = 36/222 (16%), Positives = 71/222 (31%), Gaps = 18/222 (8%)

Query: 17  GKWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIV 76
            ++  +K LG G+FG V LV   E         ++       +   ++   L  K+    
Sbjct: 29  DQFERIKTLGTGSFGRVMLVKHMETGNHY---AMKILDKQKVVKLKQIEHTLNEKRILQA 85

Query: 77  GRHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDL 136
                 +    +     N  ++       +         +FS   A   A Q +   E L
Sbjct: 86  VNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYL 145

Query: 137 HNIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVK 196
           H++  ++RD+KP N  I ++   ++           R +                 GT +
Sbjct: 146 HSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTW---------------LCGTPE 190

Query: 197 YAPLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESD 238
           Y      + +   +  D  +   ++ EM  G  P+       
Sbjct: 191 YLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQ 232


>2bakA [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
          Length = 334

 Score = 33.8 bits (75), Expect = 7e-04
 Identities = 35/275 (12%), Positives = 75/275 (27%), Gaps = 7/275 (2%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLLKMEVAVLLEVKKQKIVG 77
           ++  L  +G GA+G+V      +        K+   S P   +        E++  K + 
Sbjct: 19  RYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL---SRPFQSIIHAKRTYRELRLLKHMK 75

Query: 78  RHFLELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLH 137
              +        P +       +   +           K +      +  Q L  ++ +H
Sbjct: 76  HENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKLTDDHVQFLIYQILRGLKYIH 135

Query: 138 NIGFLHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFAREDGTLRNPRARAGFRGTVKY 197
           +   +HRD+KP N  +      ++    +            +    N        G +  
Sbjct: 136 SADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMA 195

Query: 198 APLACHIQREQCRKDDIESWLYMVVEMTCGRLPWRNLTESDDVGVFKKECKTTR-LRCLF 256
                   R      D    L +++ +            S +      +  T        
Sbjct: 196 ---ELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFA 252

Query: 257 GGCPREFTEVFPILDKGKFFDAPEYTTIYELLEKA 291
                       +L+K    D+ +  T  + L  A
Sbjct: 253 NVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHA 287


>3ck8A [x.x.x] SUSD
          Length = 501

 Score = 33.7 bits (76), Expect = 7e-04
 Identities = 16/157 (10%), Positives = 42/157 (26%), Gaps = 19/157 (12%)

Query: 24  KLGEGAFGAVYLVSQKEKPKVEYALKV--EAESDPLGLLKMEVAVLLEVKKQKIVGRHFL 81
                    VY+    +  +  + L              + E+  L  +        ++ 
Sbjct: 63  SPSSQRTEWVYVRLGYDITQYNFFLDQTEGMTDAETLRQRAEIRFLRAL-------HYWY 115

Query: 82  ELADRGNLPQKFNYMVMTLVGKSLQDLRKTAPFNKFSMGTAISVARQSLEAVEDLHNIGF 141
            L   G  P K ++     V K   +L     + +  +    +   +             
Sbjct: 116 FLDLFGKAPFKEHFSNDLPVEKKGTELYT---YIQNELNEIEADMYEP-RQAPFGRADKA 171

Query: 142 LHRDIKPGNYTIGRKEMHELRKVYMLDFGMARKFARE 178
            +  ++   Y      ++        D+  A ++A +
Sbjct: 172 ANWLLRARLY------LNAGVYTGQTDYAKAEEYASK 202


>3bboU [x.x.x] RIBOSOMAL PROTEIN L22
          Length = 122

 Score = 33.7 bits (77), Expect = 7e-04
 Identities = 7/58 (12%), Positives = 16/58 (27%), Gaps = 4/58 (6%)

Query: 95  YMVMTLV-GKSLQDLRKTAPFNKFSMGTAISVARQSLEAVED-LHNIGFLHRDIKPGN 150
             V+  + G+S  +                 + +    A  +  HN  F   ++    
Sbjct: 18  RRVIDQIRGRSYAETLMILEL--MPYRACYPIFKLIYSAAANASHNKQFNKANLIISK 73


>3bdeA [x.x.x] MLL5499 PROTEIN
          Length = 98

 Score = 33.6 bits (76), Expect = 8e-04
 Identities = 7/87 (8%), Positives = 18/87 (20%), Gaps = 8/87 (9%)

Query: 18  KWTILKKLGEGAFGAVYLVSQKEKPKVEYALKVEAESDPLGLL---KMEVAVLLEVKKQK 74
               L++          L + +     E   ++  + D          + A         
Sbjct: 14  ASHSLEEKRFLVDAKKILSAIRGVTHFEQLRQISPKIDYHFGFSEFADQAAYTRYNDHPD 73

Query: 75  IVGRHFLELADRGNLPQKFNYMVMTLV 101
            V                  ++ +  V
Sbjct: 74  HVAFVRDRWVPEVEK-----FLEIDYV 95


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.134    0.409 

Gapped
Lambda     K      H
   0.267   0.0451    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 40,942,075
Number of extensions: 2625270
Number of successful extensions: 30732
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 14092
Number of HSP's successfully gapped: 989
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.3 bits)