BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAF53177.1 cglu2 BAF53177.1 GIB00498CH01 "hypothetical protein"
         (136 letters)

Database: 95pdb09Oct16x 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2c45A [x.x.x] ASPARTATE 1-DECARBOXYLASE PRECURSOR                     134   2e-34
1pqeA [b.52.2] ASPARTATE 1-DECARBOXYLASE                              108   1e-26
1pyqB [b.52.2] ASPARTATE 1-DECARBOXYLASE                              105   8e-26
1pyqA [b.52.2] ASPARTATE 1-DECARBOXYLASE                              105   8e-26
1pt1B [b.52.2] ASPARTATE 1-DECARBOXYLASE                              105   8e-26
1pt1A [b.52.2] ASPARTATE 1-DECARBOXYLASE                              105   8e-26
1pt0B [b.52.2] ASPARTATE 1-DECARBOXYLASE                              105   1e-25
1pt0A [b.52.2] ASPARTATE 1-DECARBOXYLASE                              105   1e-25
1ppyB [b.52.2] ASPARTATE 1-DECARBOXYLASE PRECURSOR                    105   1e-25
1ppyA [b.52.2] ASPARTATE 1-DECARBOXYLASE PRECURSOR                    105   1e-25
1pqhB [b.52.2] ASPARTATE 1-DECARBOXYLASE                              103   2e-25
1pqhA [b.52.2] ASPARTATE 1-DECARBOXYLASE                              103   2e-25
1pqfB [b.52.2] ASPARTATE 1-DECARBOXYLASE                              102   5e-25
1pqfA [b.52.2] ASPARTATE 1-DECARBOXYLASE                              102   5e-25
1vc3B [x.x.x] L-ASPARTATE-ALPHA-DECARBOXYLASE HEAVY CHAIN              97   3e-23
1uheA [b.52.2] ASPARTATE 1-DECARBOXYLASE ALPHA CHAIN                   86   8e-20
1uhdA [b.52.2] ASPARTATE 1-DECARBOXYLASE ALPHA CHAIN                   86   8e-20
1aw8B [b.52.2] L-ASPARTATE-ALPHA-DECARBOXYLASE                         82   1e-18
1pyuD [b.52.2] ASPARTATE 1-DECARBOXYLASE ALFA CHAIN                    80   3e-18
1pyuB [b.52.2] ASPARTATE 1-DECARBOXYLASE ALFA CHAIN                    80   3e-18
1aw8E [b.52.2] L-ASPARTATE-ALPHA-DECARBOXYLASE                         80   3e-18
1vc3A [x.x.x] L-ASPARTATE-ALPHA-DECARBOXYLASE LIGHT CHAIN              37   4e-05
2eeoA [x.x.x] ASPARTATE 1-DECARBOXYLASE                                34   2e-04
1pyuC [b.52.2] ASPARTATE 1-DECARBOXYLASE BETA CHAIN                    32   8e-04
1pyuA [b.52.2] ASPARTATE 1-DECARBOXYLASE BETA CHAIN                    32   8e-04

>2c45A [x.x.x] ASPARTATE 1-DECARBOXYLASE PRECURSOR
          Length = 113

 Score =  134 bits (336), Expect = 2e-34
 Identities = 70/113 (61%), Positives = 83/113 (73%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           MLRT+L SKIHRATVT ADL YVGSVTI           EGE+V IVDI NGARL TY I
Sbjct: 1   MLRTMLKSKIHRATVTCADLHYVGSVTIXXXXXXXXXXXEGEQVTIVDIDNGARLVTYAI 60

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNR 113
            G+ G+G I INGAAAHL++PGDLVI+++Y    DA A+ Y+P+IV VDA N+
Sbjct: 61  TGERGSGVIGINGAAAHLVHPGDLVILIAYATMDDARARTYQPRIVFVDAYNK 113


>1pqeA [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 117

 Score =  108 bits (269), Expect = 1e-26
 Identities = 50/114 (43%), Positives = 73/114 (64%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           M+RT+L  K+HR  VT ADL Y G+  ID D + AAG++E E + I ++TNG R  TY I
Sbjct: 1   MIRTMLQGKLHRVKVTHADLHYEGACAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI 60

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
             + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 61  AAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 114


>1pyqB [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 116

 Score =  105 bits (262), Expect = 8e-26
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 1/115 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDY-VGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYV 59
           M+RT+L  K+HR  VT ADL Y  GS  ID D + AAG++E E + I ++TNG R  TY 
Sbjct: 1   MIRTMLQGKLHRVKVTHADLHYEAGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYA 60

Query: 60  IVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
           I  + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 61  IAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 115


>1pyqA [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 120

 Score =  105 bits (262), Expect = 8e-26
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 1/115 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDY-VGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYV 59
           M+RT+L  K+HR  VT ADL Y  GS  ID D + AAG++E E + I ++TNG R  TY 
Sbjct: 5   MIRTMLQGKLHRVKVTHADLHYEAGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYA 64

Query: 60  IVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
           I  + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 65  IAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 119


>1pt1B [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 115

 Score =  105 bits (262), Expect = 8e-26
 Identities = 50/114 (43%), Positives = 72/114 (63%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           M+RT+L  K+ R  VT ADL Y GS  ID D + AAG++E E + I ++TNG R  TY I
Sbjct: 1   MIRTMLQGKLARVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI 60

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
             + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 61  AAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 114


>1pt1A [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 117

 Score =  105 bits (262), Expect = 8e-26
 Identities = 50/114 (43%), Positives = 72/114 (63%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           M+RT+L  K+ R  VT ADL Y GS  ID D + AAG++E E + I ++TNG R  TY I
Sbjct: 3   MIRTMLQGKLARVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI 62

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
             + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 63  AAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 116


>1pt0B [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 116

 Score =  105 bits (261), Expect = 1e-25
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 1/115 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSV-TIDADLVHAAGLIEGEKVAIVDITNGARLETYV 59
           M+RT+L  K+HR  VT ADL Y GS   ID D + AAG++E E + I ++TNG R  TY 
Sbjct: 1   MIRTMLQGKLHRVKVTHADLHYEGSACAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYA 60

Query: 60  IVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
           I  + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 61  IAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 115


>1pt0A [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 117

 Score =  105 bits (261), Expect = 1e-25
 Identities = 51/115 (44%), Positives = 73/115 (63%), Gaps = 1/115 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSV-TIDADLVHAAGLIEGEKVAIVDITNGARLETYV 59
           M+RT+L  K+HR  VT ADL Y GS   ID D + AAG++E E + I ++TNG R  TY 
Sbjct: 2   MIRTMLQGKLHRVKVTHADLHYEGSACAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYA 61

Query: 60  IVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
           I  + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 62  IAAERGSRIISVNGAAAHCASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 116


>1ppyB [b.52.2] ASPARTATE 1-DECARBOXYLASE PRECURSOR
          Length = 114

 Score =  105 bits (261), Expect = 1e-25
 Identities = 51/114 (44%), Positives = 73/114 (64%), Gaps = 1/114 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           M+RT+L  K+HR  VT ADL Y GS  ID D + AAG++E E + I ++TNG R  TY I
Sbjct: 1   MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI 60

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
             + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 61  AAERGSRIISVNGAAAH-ASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 113


>1ppyA [b.52.2] ASPARTATE 1-DECARBOXYLASE PRECURSOR
          Length = 117

 Score =  105 bits (261), Expect = 1e-25
 Identities = 51/114 (44%), Positives = 73/114 (64%), Gaps = 1/114 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           M+RT+L  K+HR  VT ADL Y GS  ID D + AAG++E E + I ++TNG R  TY I
Sbjct: 1   MIRTMLQGKLHRVKVTHADLHYEGSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI 60

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
             + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 61  AAERGSRIISVNGAAAH-ASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 113


>1pqhB [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 114

 Score =  103 bits (258), Expect = 2e-25
 Identities = 50/114 (43%), Positives = 73/114 (64%), Gaps = 1/114 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           M+RT+L  K+HR  VT ADL Y G+  ID D + AAG++E E + I ++TNG R  TY I
Sbjct: 1   MIRTMLQGKLHRVKVTHADLHYEGTCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI 60

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
             + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 61  AAERGSRIISVNGAAAH-ASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 113


>1pqhA [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 118

 Score =  103 bits (258), Expect = 2e-25
 Identities = 50/114 (43%), Positives = 73/114 (64%), Gaps = 1/114 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           M+RT+L  K+HR  VT ADL Y G+  ID D + AAG++E E + I ++TNG R  TY I
Sbjct: 4   MIRTMLQGKLHRVKVTHADLHYEGTCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI 63

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
             + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 64  AAERGSRIISVNGAAAH-ASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 116


>1pqfB [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 115

 Score =  102 bits (255), Expect = 5e-25
 Identities = 50/114 (43%), Positives = 72/114 (63%), Gaps = 1/114 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           M+RT+L  K+HR  VT ADL Y  S  ID D + AAG++E E + I ++TNG R  TY I
Sbjct: 1   MIRTMLQGKLHRVKVTHADLHYESSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI 60

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
             + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 61  AAERGSRIISVNGAAAH-ASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 113


>1pqfA [b.52.2] ASPARTATE 1-DECARBOXYLASE
          Length = 126

 Score =  102 bits (255), Expect = 5e-25
 Identities = 50/114 (43%), Positives = 72/114 (63%), Gaps = 1/114 (0%)

Query: 1   MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVI 60
           M+RT+L  K+HR  VT ADL Y  S  ID D + AAG++E E + I ++TNG R  TY I
Sbjct: 5   MIRTMLQGKLHRVKVTHADLHYESSCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAI 64

Query: 61  VGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
             + G+  I +NGAAAH  + GD+VII S++   D EA+ + P + + + DN +
Sbjct: 65  AAERGSRIISVNGAAAH-ASVGDIVIIASFVTMPDEEARTWRPNVAYFEGDNEM 117


>1vc3B [x.x.x] L-ASPARTATE-ALPHA-DECARBOXYLASE HEAVY CHAIN
          Length = 95

 Score = 97.1 bits (240), Expect = 3e-23
 Identities = 49/90 (54%), Positives = 66/90 (73%)

Query: 26  VTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLV 85
           VT+D DL+ AAG++  E+V I DITNGARL TY + G+ G+G I INGAAAHL+ PGDLV
Sbjct: 1   VTVDQDLLDAAGILPFEQVDIYDITNGARLTTYALPGERGSGVIGINGAAAHLVKPGDLV 60

Query: 86  IIMSYLQATDAEAKAYEPKIVHVDADNRIV 115
           I+++Y    + EA+  +P +V VD  NRI+
Sbjct: 61  ILVAYGVFDEEEARNLKPTVVLVDERNRIL 90


>1uheA [b.52.2] ASPARTATE 1-DECARBOXYLASE ALPHA CHAIN
          Length = 97

 Score = 85.5 bits (210), Expect = 8e-20
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 1/93 (1%)

Query: 26  VTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLV 85
           +TID DL   A L EG KV IVD+ NG R  TYVI+G    G IC+NGAAA  +  GD+V
Sbjct: 1   ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKK-RGEICVNGAAARKVAIGDVV 59

Query: 86  IIMSYLQATDAEAKAYEPKIVHVDADNRIVALG 118
           II++Y    + E  A++P IV VD  N I+  G
Sbjct: 60  IILAYASMNEDEINAHKPSIVLVDEKNEILEKG 92


>1uhdA [b.52.2] ASPARTATE 1-DECARBOXYLASE ALPHA CHAIN
          Length = 95

 Score = 85.5 bits (210), Expect = 8e-20
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 1/93 (1%)

Query: 26  VTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLV 85
           +TID DL   A L EG KV IVD+ NG R  TYVI+G    G IC+NGAAA  +  GD+V
Sbjct: 1   ITIDEDLAKLAKLREGMKVEIVDVNNGERFSTYVILGKK-RGEICVNGAAARKVAIGDVV 59

Query: 86  IIMSYLQATDAEAKAYEPKIVHVDADNRIVALG 118
           II++Y    + E  A++P IV VD  N I+  G
Sbjct: 60  IILAYASMNEDEINAHKPSIVLVDEKNEILEKG 92


>1aw8B [b.52.2] L-ASPARTATE-ALPHA-DECARBOXYLASE
          Length = 91

 Score = 81.6 bits (200), Expect = 1e-18
 Identities = 37/90 (41%), Positives = 56/90 (62%)

Query: 25  SVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDL 84
           S  ID D + AAG++E E + I ++TNG R  TY I  + G+  I +NGAAAH  + GD+
Sbjct: 1   SCAIDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDI 60

Query: 85  VIIMSYLQATDAEAKAYEPKIVHVDADNRI 114
           VII S++   D EA+ + P + + + DN +
Sbjct: 61  VIIASFVTMPDEEARTWRPNVAYFEGDNEM 90


>1pyuD [b.52.2] ASPARTATE 1-DECARBOXYLASE ALFA CHAIN
          Length = 91

 Score = 80.5 bits (197), Expect = 3e-18
 Identities = 36/87 (41%), Positives = 55/87 (63%)

Query: 28  IDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLVII 87
           ID D + AAG++E E + I ++TNG R  TY I  + G+  I +NGAAAH  + GD+VII
Sbjct: 4   IDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVII 63

Query: 88  MSYLQATDAEAKAYEPKIVHVDADNRI 114
            S++   D EA+ + P + + + DN +
Sbjct: 64  ASFVTMPDEEARTWRPNVAYFEGDNEM 90


>1pyuB [b.52.2] ASPARTATE 1-DECARBOXYLASE ALFA CHAIN
          Length = 92

 Score = 80.5 bits (197), Expect = 3e-18
 Identities = 36/87 (41%), Positives = 55/87 (63%)

Query: 28  IDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLVII 87
           ID D + AAG++E E + I ++TNG R  TY I  + G+  I +NGAAAH  + GD+VII
Sbjct: 4   IDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVII 63

Query: 88  MSYLQATDAEAKAYEPKIVHVDADNRI 114
            S++   D EA+ + P + + + DN +
Sbjct: 64  ASFVTMPDEEARTWRPNVAYFEGDNEM 90


>1aw8E [b.52.2] L-ASPARTATE-ALPHA-DECARBOXYLASE
          Length = 90

 Score = 80.5 bits (197), Expect = 3e-18
 Identities = 36/87 (41%), Positives = 55/87 (63%)

Query: 28  IDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLVII 87
           ID D + AAG++E E + I ++TNG R  TY I  + G+  I +NGAAAH  + GD+VII
Sbjct: 3   IDQDFLDAAGILENEAIDIWNVTNGKRFSTYAIAAERGSRIISVNGAAAHCASVGDIVII 62

Query: 88  MSYLQATDAEAKAYEPKIVHVDADNRI 114
            S++   D EA+ + P + + + DN +
Sbjct: 63  ASFVTMPDEEARTWRPNVAYFEGDNEM 89


>1vc3A [x.x.x] L-ASPARTATE-ALPHA-DECARBOXYLASE LIGHT CHAIN
          Length = 24

 Score = 36.6 bits (83), Expect = 4e-05
 Identities = 17/24 (70%), Positives = 19/24 (79%)

Query: 1  MLRTILGSKIHRATVTQADLDYVG 24
          M R +  +KIHRATVTQADL YVG
Sbjct: 1  MKRVMFHAKIHRATVTQADLHYVG 24


>2eeoA [x.x.x] ASPARTATE 1-DECARBOXYLASE
          Length = 23

 Score = 34.3 bits (77), Expect = 2e-04
 Identities = 16/23 (69%), Positives = 18/23 (78%)

Query: 1  MLRTILGSKIHRATVTQADLDYV 23
          M R +  +KIHRATVTQADL YV
Sbjct: 1  MKRVMFHAKIHRATVTQADLHYV 23


>1pyuC [b.52.2] ASPARTATE 1-DECARBOXYLASE BETA CHAIN
          Length = 24

 Score = 32.3 bits (72), Expect = 8e-04
 Identities = 14/24 (58%), Positives = 17/24 (70%)

Query: 1  MLRTILGSKIHRATVTQADLDYVG 24
          M+RT+L  K+HR  VT ADL Y G
Sbjct: 1  MIRTMLQGKLHRVKVTHADLHYEG 24


>1pyuA [b.52.2] ASPARTATE 1-DECARBOXYLASE BETA CHAIN
          Length = 28

 Score = 32.3 bits (72), Expect = 8e-04
 Identities = 14/24 (58%), Positives = 17/24 (70%)

Query: 1  MLRTILGSKIHRATVTQADLDYVG 24
          M+RT+L  K+HR  VT ADL Y G
Sbjct: 5  MIRTMLQGKLHRVKVTHADLHYEG 28


  Database: 95pdb09Oct16x
    Posted date:  Nov 2, 2009  3:15 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.325    0.137    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 849,221,787
Number of extensions: 34159131
Number of successful extensions: 80871
Number of sequences better than 1.0e-03: 1211
Number of HSP's gapped: 79788
Number of HSP's successfully gapped: 1480
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)