BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAF54728.1 cglu2 BAF54728.1 GIB00498CH01 "hypothetical protein"
         (149 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DUT_CORGB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   263   6e-73
DUT_CORGL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   260   5e-72
DUT_COREF RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   221   4e-60
DUT_CORJK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   199   2e-53
DUT_CORDI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   184   3e-49
DUT_RHOE4 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   177   7e-47
DUT_NOCFA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   172   2e-45
DUT_MYCSK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   167   5e-44
DUT_MYCSJ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   167   5e-44
DUT_MYCS2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   167   5e-44
DUT_MYCVP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   165   2e-43
DUT_MYCGI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   162   1e-42
DUT_MYCPA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   156   1e-40
DUT_MYCA1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   156   1e-40
DUT_MYCMM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   156   1e-40
DUT_MYCUA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   155   2e-40
DUT_MYCTU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   155   2e-40
DUT_MYCTA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   155   2e-40
DUT_MYCBT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   155   2e-40
DUT_MYCBP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   155   2e-40
DUT_MYCBO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   155   2e-40
DUT_THEFY RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   154   5e-40
DUT_MYCLE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   154   6e-40
DUT_MYCLB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   154   6e-40
DUT_STRGG RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   140   7e-36
DUT_BIFLI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   140   9e-36
DUT_BIFLO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   138   4e-35
DUT_BIFLD RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   138   4e-35
DUT_STRCO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   135   2e-34
DUT_PROAC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   134   4e-34
DUT_STRAW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   130   7e-33
DUT_LEIXX RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   122   2e-30
DUT_TROWT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   120   8e-30
DUT_TROW8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   120   8e-30
DUT_ANASK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   120   8e-30
DUT_ANADE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   120   8e-30
DUT_ANAD2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   120   8e-30
DUT_CLOK5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   120   1e-29
DUT_EHRCJ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   119   2e-29
DUT_NEOSM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   118   3e-29
DUT_GEOBB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   118   3e-29
DUT_DICTD RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   118   4e-29
DUT_WOLPP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   117   8e-29
DUT_SPHWW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   117   8e-29
DUT_PELLD RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   117   8e-29
DUT_CLOTE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   115   2e-28
DUT_GEOSM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   115   3e-28
DUT_AQUAE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   115   3e-28
DUT_GEOSF RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   113   9e-28
DUT_GLUOX RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   112   2e-27
DUT_ACAM1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   112   3e-27
DUT_THETN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   111   4e-27
DUT_DICT6 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   111   4e-27
DUT_PELCD RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   111   5e-27
DUT_WOLTR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   110   6e-27
DUT_WOLPM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   110   6e-27
DUT_WOLWR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   110   8e-27
DUT_RHOPS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   110   8e-27
DUT_SYNAS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   110   1e-26
DUT_ANAMM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   110   1e-26
DUT_ANAMF RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   110   1e-26
DUT_OLICO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   109   1e-26
DUT_NITWN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   109   1e-26
DUT_ANADF RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   109   1e-26
DUT_SYNWW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   109   2e-26
DUT_PROA2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   109   2e-26
DUT_RHIL3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   108   2e-26
DUT_ZYMMO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   108   3e-26
DUT_RHOP2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   108   3e-26
DUT_ACICJ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   108   3e-26
DUT_HYDS0 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   108   4e-26
DUT_THEPX RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   5e-26
DUT_THEP3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   5e-26
DUT_RICBR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   5e-26
DUT_RICB8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   5e-26
DUT_RICAH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   5e-26
DUT_RICTY RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   7e-26
DUT_RICPR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   7e-26
DUT_TRIEI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   9e-26
DUT_RICFE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   9e-26
DUT_RHIEC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   107   9e-26
DUT_PORGI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   106   1e-25
DUT_PORG3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   106   1e-25
DUT_CLONN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   106   1e-25
DUT_CLODI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   106   1e-25
DUT_CLOD6 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   106   1e-25
DUT_RICM5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   106   1e-25
DUT_AGRRK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   106   1e-25
DUT_RICCK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   105   2e-25
DUT_RHOCS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   105   2e-25
DUT_CLOAB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   105   2e-25
DUT_CHLP8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   105   2e-25
DUT_RHIE6 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   105   3e-25
DUT_PROVI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   105   3e-25
DUT_HELHP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   105   3e-25
DUT_FLAJ1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   105   3e-25
DUT_RHILW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   105   3e-25
DUT_DESPS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   104   4e-25
DUT_PARL1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   104   6e-25
DUT_DEBHA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   104   6e-25
DUT_CAUCR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   104   6e-25
DUT_CAUCN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   104   6e-25
DUT_RICRS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   103   7e-25
DUT_RICRO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   103   7e-25
DUT_RICCN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   103   7e-25
DUT_RICAE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   103   7e-25
DUT_GLOVI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   103   7e-25
DUT_BACV8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   103   1e-24
DUT_CHLTE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   103   1e-24
DUT_CHLCH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   103   1e-24
DUT_NAUPA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   102   2e-24
DUT_CYAP7 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   102   2e-24
DUT_ALKMQ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   102   2e-24
DUT_RHOSK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   102   2e-24
DUT_FINM2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   102   2e-24
DUT_CHLL2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   102   2e-24
DUT_RICPU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_GEOSL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_CYTH3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_CHLPB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_BRUSU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_BRUSI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_BRUME RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_BRUMB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_BRUC2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_BRUAB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_BRUA2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_BRUA1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   4e-24
DUT_RHOS4 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   5e-24
DUT_GEOMG RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   5e-24
DUT_BRAJA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   101   5e-24
DUT_RHILO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   100   6e-24
DUT_CHLPD RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   100   6e-24
DUT_SOLUE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   100   8e-24
DUT_ORITI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   100   8e-24
DUT_BEII9 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   100   8e-24
DUT_MARMM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   100   1e-23
DUT_PELPB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   100   1e-23
DUT_AGRT5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...   100   1e-23
DUT_SYNP2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    99   2e-23
DUT_ORITB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    99   2e-23
DUT_BRASO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    99   2e-23
DUT_AZOC5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    99   3e-23
DUT_RHOPB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    97   7e-23
DUT_NITHX RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    97   7e-23
DUT_BACTN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    97   9e-23
DUT_SCHPO RecName: Full=Probable deoxyuridine 5'-triphosphate nu...    96   2e-22
DUT_CYAA5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    96   2e-22
DUT_SINMW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    96   3e-22
DUT_RHOPT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    96   3e-22
DUT_RHOPA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    96   3e-22
DUT_FUSNN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    96   3e-22
DUT_BDEBA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    96   3e-22
DUT_WOLSU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    95   3e-22
DUT_HUMAN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    95   3e-22
DUT_TREPS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    95   4e-22
DUT_TREPA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    95   4e-22
DUT_HALHL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    94   8e-22
DUT_BACFR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    94   8e-22
DUT_BACFN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    94   8e-22
DUT_RHIME RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    94   1e-21
DUT_BARHE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    93   2e-21
DUT_RAT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidohyd...    92   2e-21
DUT_HELMI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    92   3e-21
DUT_HELAH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    92   3e-21
DUT_CHLTR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    92   3e-21
DUT_CHLTB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    92   3e-21
DUT_CHLTA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    92   3e-21
DUT_CHLT2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    92   3e-21
DUT_CANAL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    92   4e-21
DUT_SILPO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    91   5e-21
DUT_CHLMU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    91   5e-21
DUT_HELPJ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    91   8e-21
DUT_CHLPN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    90   1e-20
DUT_BARBK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    90   1e-20
DUT_ROSDO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    90   1e-20
DUT_DESHY RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    90   1e-20
DUT_DESHD RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    90   1e-20
DUT_TREDE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    89   2e-20
DUT_HELPH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    89   2e-20
DUT_HELP2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    89   2e-20
DUT_HELPY RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    89   3e-20
DUT_HELPS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    89   3e-20
DUT_ADEG8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    88   4e-20
DUT_ACTPJ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    88   5e-20
DUT_ACTP7 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    88   5e-20
DUT_ACTP2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    88   5e-20
DUT_IDILO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    87   7e-20
DUT_SOLLC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    87   9e-20
DUT_METSB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    87   9e-20
DUT_LEPBL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    87   1e-19
DUT_LEPBJ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    87   1e-19
DUT_BARQU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    87   1e-19
DUT_PROMH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    86   2e-19
DUT_LEPIN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    86   2e-19
DUT_LEPIC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    86   2e-19
DUT_PBCV1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    86   3e-19
DUT_ADEG1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    85   4e-19
DUT_PARUW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    85   5e-19
DUT_CHLT3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    85   5e-19
DUT_ACIBY RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    85   5e-19
DUT_ACIBT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    85   5e-19
DUT_ACIBS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    85   5e-19
DUT_ACIBC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    85   5e-19
DUT_ACIB5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    85   5e-19
DUT_ACIB3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    85   5e-19
DUT_ASHGO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    84   6e-19
DUT_NEUCR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    84   8e-19
DUT_COXBN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    84   8e-19
DUT_PSYIN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    84   1e-18
DUT_YARLI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   1e-18
DUT_PSEAE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   1e-18
DUT_PSEA8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   1e-18
DUT_HAES2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   1e-18
DUT_HAES1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   1e-18
DUT_SHEON RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   2e-18
DUT_PSEAB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   2e-18
DUT_NITOC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   2e-18
DUT_COXBU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   2e-18
DUT_COXBR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   2e-18
DUT_ACTSZ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    83   2e-18
DUT_PSEE4 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   2e-18
DUT_PSEA7 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   2e-18
DUT_KLULA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   2e-18
DUT_HAEDU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   2e-18
DUT_CHLFF RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   2e-18
DUT_YEAST RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   3e-18
DUT_PSEMY RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   3e-18
DUT_HAEIN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   3e-18
DUT_HAEIG RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   3e-18
DUT_HAEIE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   3e-18
DUT_HAEI8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   3e-18
DUT_CANGA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   3e-18
DUT_SHESM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   4e-18
DUT_SHESA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   4e-18
DUT_PASMU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   4e-18
DUT_METCA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   4e-18
DUT_CHLCV RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    82   4e-18
DUT_SWPVK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    81   5e-18
DUT_SHESW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    81   5e-18
DUT_SHEPC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    81   5e-18
DUT_SHEB5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    81   7e-18
DUT_DICDI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    81   7e-18
DUT_BLOPB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    81   7e-18
DUT_SHEB9 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   9e-18
DUT_SHEB8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   9e-18
DUT_SHEB2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   9e-18
DUT_PSEPW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   9e-18
DUT_HAHCH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   9e-18
DUT_BRASB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   9e-18
DUT_ALCBS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   9e-18
DUT_SHESR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   1e-17
DUT_SHEHH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   1e-17
DUT_MANSM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   1e-17
DUT_VACCP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   1e-17
DUT_VACCC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   1e-17
DUT_VACCA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   1e-17
DUT_SHEPA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    80   1e-17
DUT_SHEWM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    79   2e-17
DUT_PSEPG RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    79   2e-17
DUT_CHLAB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    79   2e-17
DUT_THIDA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    79   3e-17
DUT_SERP5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    79   3e-17
DUT_PSEPK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    79   3e-17
DUT_NEIG2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    79   3e-17
DUT_ACIAD RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    79   3e-17
DUT_FOWPV RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    79   3e-17
DUT_THICR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_SHISS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_SHIDS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_SHIBS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_SHIB3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_SHEDO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_SHEAM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_PHOLL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ESCF3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECOUT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECOSM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECOSE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECOLU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECOLC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECOL6 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECOL5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECOK1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECOHS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECO8A RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECO81 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECO7I RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECO5E RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECO57 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECO55 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECO45 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECO27 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_ECO24 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   4e-17
DUT_SHIFL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_SHIF8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_SALAR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_PSEU5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_PSEP1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_PSEFS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_NEIMA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_HAEPS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_ECOLI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_ECODH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_ECOBW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    78   6e-17
DUT_NEIM0 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   7e-17
DUT_NEIG1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   7e-17
DUT_YERPS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_YERPG RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_YERPE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_YERP3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_VARV RecName: Full=Deoxyuridine 5'-triphosphate nucleotidohy...    77   1e-16
DUT_SHEFN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALTY RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALTI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALSV RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALPK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALPC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALPB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALPA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALNS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALHS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALG2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALEP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALDC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALCH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SALA4 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_CWPXG RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_ANTLO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_XYLFM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_VACCW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_SHELP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_RABPU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_PRB01 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_NEIMB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_CITK8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    77   1e-16
DUT_TOLAT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_SHEPW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_PSE14 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_PSESM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_PSEF5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_NITMU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_KLEP7 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_KLEP3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_ENT38 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_DINSH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_DICNV RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    76   2e-16
DUT_XYLFT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   3e-16
DUT_XYLF2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   3e-16
DUT_SHESH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   3e-16
DUT_PSYCK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   3e-16
DUT_ORFN2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   3e-16
DUT_BURTA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   3e-16
DUT_BURS3 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   3e-16
DUT_AZOVD RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   3e-16
DUT_PSEU2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   4e-16
DUT_PECCP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   4e-16
DUT_ERWCT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   4e-16
DUT_BURVG RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   4e-16
DUT_XANCP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   5e-16
DUT_XANCB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   5e-16
DUT_XANC8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   5e-16
DUT_AERHH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    75   5e-16
POL_FIVSD RecName: Full=Pol polyprotein;Contains:  RecName: Full...    74   6e-16
DUT_BURCJ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   6e-16
DUT_BURCH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   6e-16
DUT_BURCC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   6e-16
DUT_BURCA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   6e-16
POL_FIVPE RecName: Full=Pol polyprotein;Contains:  RecName: Full...    74   8e-16
DUT_WIGBR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   8e-16
DUT_JANMA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   8e-16
DUT_BURA4 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   8e-16
DUT_AERS4 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   8e-16
DUT_XANOR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   1e-15
DUT_XANOP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   1e-15
DUT_BURCM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    74   1e-15
DUT_RALPJ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   1e-15
DUT_PSYA2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   1e-15
DUT_DECAR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   1e-15
DUT_CAMPS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   1e-15
DUT_CAMPM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   1e-15
DUT_BURPP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   1e-15
DUT_BURP8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   1e-15
DUT_BPT5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidohy...    73   1e-15
DUT_XANOM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   2e-15
DUT_XANC5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   2e-15
DUT_XANAC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   2e-15
DUT_RHOFD RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   2e-15
DUT_BORPA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   2e-15
DUT_BORBR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    73   2e-15
DUT_SODGM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    72   2e-15
DUT_BURXL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    72   2e-15
DUT_AZOSB RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    72   3e-15
DUT_XYLFA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    72   4e-15
DUT_RALSO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    72   4e-15
DUT_NITEU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    72   4e-15
DUT_ERWT9 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    71   5e-15
438L_IIV6 RecName: Full=Probable deoxyuridine 5'-triphosphate nu...    71   5e-15
DUT_METFK RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    71   7e-15
DUT_BURM1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    70   9e-15
DUT_PSYWF RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    70   1e-14
DUT_NITEC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    70   2e-14
DUT_METPP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    69   3e-14
DUT_LEPCP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    69   3e-14
DUT_HAMD5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    69   3e-14
DUT_POLSQ RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    69   3e-14
DUT_HERAR RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    69   3e-14
DUT_CHRVO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    69   3e-14
DUT_BORA1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    69   3e-14
DUT_BAUCH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    69   3e-14
DUT_AZOSE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    68   4e-14
DUT_ENCCU RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   8e-14
DUT_YERE8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   1e-13
DUT_BURPS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   1e-13
DUT_BURP6 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   1e-13
DUT_BURP1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   1e-13
DUT_BURP0 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   1e-13
DUT_BURMS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   1e-13
DUT_BURMA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   1e-13
DUT_BURM9 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   1e-13
DUT_BURM7 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    67   1e-13
DUT_LEGPH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    66   2e-13
DUT_LEGPC RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    66   2e-13
DUT_LEGPA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    66   2e-13
DUT_BUCAT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    65   3e-13
DUT_BUCAI RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    65   3e-13
DUT_BUCA5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    65   3e-13
DUT_BORPE RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    65   5e-13
DUT_BLOFL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    64   8e-13
DUT_LEGPL RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    63   1e-12
DUT_ENTS8 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    63   2e-12
DUT_PSEPF RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    62   3e-12
DUT_POLNS RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    62   3e-12
POL_FIVT2 RecName: Full=Pol polyprotein;Contains:  RecName: Full...    62   4e-12
POL_EIAVY RecName: Full=Pol polyprotein;Contains:  RecName: Full...    60   2e-11
POL_EIAVC RecName: Full=Pol polyprotein;Contains:  RecName: Full...    60   2e-11
POL_EIAV9 RecName: Full=Pol polyprotein;Contains:  RecName: Full...    60   2e-11
DUT_LARHH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    58   5e-11
DUT_BUCBP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    58   5e-11
POL_CAEVC RecName: Full=Pol polyprotein;Contains:  RecName: Full...    57   8e-11
DUT_FRAP2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    57   8e-11
VPRT_SRV2 RecName: Full=Protease;         EC=3.4.23.-;                 57   1e-10
VPRT_MPMV RecName: Full=Protease;         EC=3.4.23.-;                 57   1e-10
DUT_YMTV RecName: Full=Deoxyuridine 5'-triphosphate nucleotidohy...    57   1e-10
VPRT_SRV1 RecName: Full=Protease;         EC=3.4.23.-;                 57   1e-10
POL_OMVVS RecName: Full=Pol polyprotein;Contains:  RecName: Full...    55   4e-10
DUT_LACLA RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    55   4e-10
DUT_ICHV1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    55   4e-10
VPRT_MMTVB RecName: Full=Protease;         EC=3.4.23.-;                52   3e-09
POL_VILVK RecName: Full=Pol polyprotein;Contains:  RecName: Full...    52   4e-09
POL_VILV2 RecName: Full=Pol polyprotein;Contains:  RecName: Full...    52   4e-09
POL_VILV1 RecName: Full=Pol polyprotein;Contains:  RecName: Full...    52   4e-09
POL_VILV RecName: Full=Pol polyprotein;Contains:  RecName: Full=...    52   4e-09
DUT_FRATW RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    49   2e-08
DUT_FRATT RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    49   2e-08
DUT_FRATN RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    49   2e-08
DUT_FRATM RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    49   2e-08
DUT_FRAT1 RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    49   2e-08
DUT_FRATO RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    49   3e-08
DUT_FRATH RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    49   3e-08
DUT_FRATF RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    49   3e-08
DUT_BUCAP RecName: Full=Deoxyuridine 5'-triphosphate nucleotidoh...    48   6e-08
VPRT_JSRV RecName: Full=Bifunctional protease/dUTPase;Includes: ...    47   1e-07
POK4_HUMAN RecName: Full=HERV-K_6q14.1 provirus ancestral Gag-Po...    44   7e-07
DUTP_ASFB7 RecName: Full=Deoxyuridine 5'-triphosphate nucleotido...    42   5e-06
DUTP_ASFK5 RecName: Full=Deoxyuridine 5'-triphosphate nucleotido...    41   6e-06
DUTP_ASFWA RecName: Full=Deoxyuridine 5'-triphosphate nucleotido...    41   8e-06
DUTP_ASFP4 RecName: Full=Deoxyuridine 5'-triphosphate nucleotido...    41   8e-06
DCD_METMJ RecName: Full=Probable deoxycytidine triphosphate deam...    40   1e-05
DCD_AQUAE RecName: Full=Deoxycytidine triphosphate deaminase;   ...    40   1e-05
DUTP_ASFM2 RecName: Full=Deoxyuridine 5'-triphosphate nucleotido...    40   1e-05
DCD_THEAC RecName: Full=Probable deoxycytidine triphosphate deam...    37   9e-05
DCD_METB6 RecName: Full=Probable deoxycytidine triphosphate deam...    37   9e-05
GAG_IPMA RecName: Full=Retrovirus-related Gag polyprotein;Contai...    37   1e-04
VPRT_SMRVH RecName: Full=Protease;         EC=3.4.23.-;                35   3e-04
DCD_AERPE RecName: Full=Probable deoxycytidine triphosphate deam...    34   7e-04
DCD_METTH RecName: Full=Probable deoxycytidine triphosphate deam...    34   0.001

>DUT_CORGB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score =  263 bits (673), Expect = 6e-73
 Identities = 149/149 (100%), Positives = 149/149 (100%)

Query: 1   MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV 60
           MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV
Sbjct: 1   MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV 60

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK
Sbjct: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTGKTA 149
                         TVRGDQGYGSTGKTA
Sbjct: 121 XXXXXXXXXXXXXXTVRGDQGYGSTGKTA 149


>DUT_CORGL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score =  260 bits (665), Expect = 5e-72
 Identities = 148/149 (99%), Positives = 148/149 (99%)

Query: 1   MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV 60
           MTDLA IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV
Sbjct: 1   MTDLAAIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV 60

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK
Sbjct: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTGKTA 149
                         TVRGDQGYGSTGKTA
Sbjct: 121 XXXXXXXXXXXXXXTVRGDQGYGSTGKTA 149


>DUT_COREF RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 181

 Score =  221 bits (562), Expect = 4e-60
 Identities = 120/141 (85%), Positives = 134/141 (95%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           I+++RLD  LP+P+RAHRGDAGVDLH+TTD VIAPGHRE+VGTG+AIALPLGTVGL+HPR
Sbjct: 37  IRLLRLDPGLPMPRRAHRGDAGVDLHSTTDVVIAPGHRELVGTGVAIALPLGTVGLIHPR 96

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLAAREGLSIVNAPGT+DADYRGEIKVCLINLDP  PI ITRGDRIAQL+IQ+      
Sbjct: 97  SGLAAREGLSIVNAPGTVDADYRGEIKVCLINLDPSTPITITRGDRIAQLIIQRXXXXXX 156

Query: 127 XXXXXXXXTVRGDQGYGSTGK 147
                   T RGDQG+GSTG+
Sbjct: 157 XXXXXXXXTTRGDQGHGSTGR 177


>DUT_CORJK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score =  199 bits (505), Expect = 2e-53
 Identities = 100/145 (68%), Positives = 116/145 (80%), Gaps = 3/145 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           AP++IVRLDKELPLP+RAH  DAG+DL+   D  IAPG RE+VGTGIAIALP+GTVGLVH
Sbjct: 10  APLRIVRLDKELPLPRRAHPTDAGIDLYTAQDVTIAPGCRELVGTGIAIALPVGTVGLVH 69

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK---X 121
           PRSGLA ++GLSIVNAPGTIDADYRGEIKVCLINLDPE+PI + RG+RIAQL++Q+    
Sbjct: 70  PRSGLALKKGLSIVNAPGTIDADYRGEIKVCLINLDPEEPIELARGERIAQLLVQEVSLC 129

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTG 146
                        TVRG+ GYGSTG
Sbjct: 130 DVEEVNSVEELGVTVRGESGYGSTG 154


>DUT_CORDI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  184 bits (468), Expect = 3e-49
 Identities = 93/140 (66%), Positives = 102/140 (72%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + I RLD ELPLP R HRGDAG DL +     I PGHR +VGTGIAIALP+GTVGL+HPR
Sbjct: 11  VAIQRLDPELPLPVRKHRGDAGADLFSAESVTIEPGHRILVGTGIAIALPIGTVGLIHPR 70

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SG A +EGLSIVN PGTIDADYRGEIKVCLINLDP  PI I RG+RIAQL++QK      
Sbjct: 71  SGRALKEGLSIVNTPGTIDADYRGEIKVCLINLDPTTPIRIERGERIAQLLVQKVELVDF 130

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   T RG  GYGSTG
Sbjct: 131 CEVETLSETERGVNGYGSTG 150


>DUT_RHOE4 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 164

 Score =  177 bits (448), Expect = 7e-47
 Identities = 86/120 (71%), Positives = 101/120 (84%)

Query: 1   MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV 60
           M+D   I + RLD +LP+P+RAH GDAGVDL +T+D  I PGHR +VGTGIAIALP+GTV
Sbjct: 1   MSDHLSIALKRLDPDLPVPQRAHPGDAGVDLCSTSDVTIEPGHRTLVGTGIAIALPVGTV 60

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           GL+HPRSGLAA+ GLSIVNAPGT+DA YRGE+KVCLINLDP   I I RGDRIAQLV+Q+
Sbjct: 61  GLIHPRSGLAAKSGLSIVNAPGTVDAGYRGELKVCLINLDPATAIDIRRGDRIAQLVVQR 120


>DUT_NOCFA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 165

 Score =  172 bits (436), Expect = 2e-45
 Identities = 82/120 (68%), Positives = 99/120 (82%)

Query: 1   MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV 60
           M+ L+PI + RLD  +P+P RAH GDAGVDL  T D V+APG R +VGTGIA+ALP+GTV
Sbjct: 1   MSALSPIPLRRLDPGIPVPTRAHPGDAGVDLCTTEDVVLAPGERVLVGTGIAVALPVGTV 60

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           GL+HPRSGLAA+ GLS+VN PGT+DA YRGEIKVCLIN DP  PI + RGDRIAQL++Q+
Sbjct: 61  GLIHPRSGLAAKTGLSVVNTPGTVDAGYRGEIKVCLINHDPRTPIELRRGDRIAQLLVQR 120


>DUT_MYCSK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  167 bits (423), Expect = 5e-44
 Identities = 81/114 (71%), Positives = 96/114 (84%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + ++RLD+ELP+P RAH GDAGVDL +  D  +APG RE+V TGIA+A+P G VGLVHPR
Sbjct: 5   LAVLRLDRELPMPARAHDGDAGVDLFSARDVELAPGQRELVPTGIAVAIPHGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLAAR GLSIVN+PGTIDA YRGEIKV LINLDP  PI+I RGDRIAQL++Q+
Sbjct: 65  SGLAARVGLSIVNSPGTIDAGYRGEIKVSLINLDPHAPIVIRRGDRIAQLLVQR 118


>DUT_MYCSJ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  167 bits (423), Expect = 5e-44
 Identities = 81/114 (71%), Positives = 96/114 (84%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + ++RLD+ELP+P RAH GDAGVDL +  D  +APG RE+V TGIA+A+P G VGLVHPR
Sbjct: 5   LAVLRLDRELPMPARAHDGDAGVDLFSARDVELAPGQRELVPTGIAVAIPHGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLAAR GLSIVN+PGTIDA YRGEIKV LINLDP  PI+I RGDRIAQL++Q+
Sbjct: 65  SGLAARVGLSIVNSPGTIDAGYRGEIKVSLINLDPHAPIVIRRGDRIAQLLVQR 118


>DUT_MYCS2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  167 bits (423), Expect = 5e-44
 Identities = 79/114 (69%), Positives = 98/114 (85%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + +VRLD+ELP+P RAH GDAGVDL++  +  +APG R +V TGIA+A+P G VGLVHPR
Sbjct: 5   LAVVRLDRELPMPTRAHDGDAGVDLYSAENVELAPGQRALVSTGIAVAIPHGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLAAR GLSIVN+PGTIDA YRGEIKV LINLDP+ P++I+RGDRIAQL++Q+
Sbjct: 65  SGLAARVGLSIVNSPGTIDAGYRGEIKVSLINLDPQTPVVISRGDRIAQLLVQR 118


>DUT_MYCVP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  165 bits (418), Expect = 2e-43
 Identities = 79/114 (69%), Positives = 95/114 (83%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + +VRLD++LPLP RAH GDAGVDL++  D  +APG R +V TGIA+A+P G VGL+HPR
Sbjct: 5   LAVVRLDRDLPLPSRAHDGDAGVDLYSAQDVELAPGQRALVPTGIAVAIPHGMVGLIHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLAAR GLSIVN+PGT+DA YRGEIKV LINLDP  PI I RGDRIAQL++Q+
Sbjct: 65  SGLAARVGLSIVNSPGTVDAGYRGEIKVSLINLDPAAPIAIRRGDRIAQLLVQR 118


>DUT_MYCGI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  162 bits (411), Expect = 1e-42
 Identities = 77/114 (67%), Positives = 92/114 (80%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + +VRLD +LPLP RAH GDAGVDL++  D  + PG R +V TG+A+A+P G VGL+HPR
Sbjct: 5   LAVVRLDPDLPLPSRAHDGDAGVDLYSAQDVELGPGERALVPTGVAVAIPHGMVGLIHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLAAR GLSIVN PGT+DA YRGEIKVCLINLD   PI I RGDRIAQL++Q+
Sbjct: 65  SGLAARVGLSIVNTPGTVDAGYRGEIKVCLINLDTSTPITIGRGDRIAQLLVQR 118


>DUT_MYCPA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  156 bits (395), Expect = 1e-40
 Identities = 76/108 (70%), Positives = 88/108 (81%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + IVRLD  LPLP RAH GDAGVDL++  D  + PG R +V TG+A+A+P G VGLVHPR
Sbjct: 5   LAIVRLDPGLPLPSRAHEGDAGVDLYSAEDVRLEPGRRALVRTGVAVAIPFGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLAAR GLSIVN+PGTIDA YRGEIKV LINLDP +PI++ RGDRIA
Sbjct: 65  SGLAARVGLSIVNSPGTIDAGYRGEIKVALINLDPAEPIVVHRGDRIA 112


>DUT_MYCA1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  156 bits (395), Expect = 1e-40
 Identities = 76/108 (70%), Positives = 88/108 (81%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + IVRLD  LPLP RAH GDAGVDL++  D  + PG R +V TG+A+A+P G VGLVHPR
Sbjct: 5   LAIVRLDPGLPLPSRAHEGDAGVDLYSAEDVRLEPGRRALVRTGVAVAIPFGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLAAR GLSIVN+PGTIDA YRGEIKV LINLDP +PI++ RGDRIA
Sbjct: 65  SGLAARVGLSIVNSPGTIDAGYRGEIKVALINLDPAEPIVVHRGDRIA 112


>DUT_MYCMM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  156 bits (394), Expect = 1e-40
 Identities = 74/108 (68%), Positives = 88/108 (81%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + +VRLD  LPLP RAH GDAGVDL++  D V+ PG R +V TG+A+A+P G VGLVHPR
Sbjct: 5   LAVVRLDPGLPLPSRAHDGDAGVDLYSAEDVVLPPGQRALVRTGVAVAIPFGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLA+R GLSIVN+PGTIDA YRGE+KV LINLDP  PI++ RGDRIA
Sbjct: 65  SGLASRVGLSIVNSPGTIDAGYRGELKVALINLDPATPIVVNRGDRIA 112


>DUT_MYCUA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  155 bits (393), Expect = 2e-40
 Identities = 74/108 (68%), Positives = 88/108 (81%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + +VRLD  LPLP RAH GDAGVDL++  D V+ PG R +V TG+A+A+P G VGLVHPR
Sbjct: 5   LAVVRLDPGLPLPSRAHDGDAGVDLYSAEDVVLPPGQRALVRTGVAVAIPFGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLA+R GLSIVN+PGTIDA YRGE+KV LINLDP  PI++ RGDRIA
Sbjct: 65  SGLASRVGLSIVNSPGTIDAGYRGELKVVLINLDPATPIVVNRGDRIA 112


>DUT_MYCTU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  155 bits (392), Expect = 2e-40
 Identities = 76/108 (70%), Positives = 87/108 (80%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + IVRLD  LPLP RAH GDAGVDL++  D  +APG R +V TG+A+A+P G VGLVHPR
Sbjct: 5   LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLA R GLSIVN+PGTIDA YRGEIKV LINLDP  PI++ RGDRIA
Sbjct: 65  SGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA 112


>DUT_MYCTA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  155 bits (392), Expect = 2e-40
 Identities = 76/108 (70%), Positives = 87/108 (80%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + IVRLD  LPLP RAH GDAGVDL++  D  +APG R +V TG+A+A+P G VGLVHPR
Sbjct: 5   LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLA R GLSIVN+PGTIDA YRGEIKV LINLDP  PI++ RGDRIA
Sbjct: 65  SGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA 112


>DUT_MYCBT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  155 bits (392), Expect = 2e-40
 Identities = 76/108 (70%), Positives = 87/108 (80%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + IVRLD  LPLP RAH GDAGVDL++  D  +APG R +V TG+A+A+P G VGLVHPR
Sbjct: 5   LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLA R GLSIVN+PGTIDA YRGEIKV LINLDP  PI++ RGDRIA
Sbjct: 65  SGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA 112


>DUT_MYCBP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  155 bits (392), Expect = 2e-40
 Identities = 76/108 (70%), Positives = 87/108 (80%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + IVRLD  LPLP RAH GDAGVDL++  D  +APG R +V TG+A+A+P G VGLVHPR
Sbjct: 5   LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLA R GLSIVN+PGTIDA YRGEIKV LINLDP  PI++ RGDRIA
Sbjct: 65  SGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA 112


>DUT_MYCBO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  155 bits (392), Expect = 2e-40
 Identities = 76/108 (70%), Positives = 87/108 (80%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + IVRLD  LPLP RAH GDAGVDL++  D  +APG R +V TG+A+A+P G VGLVHPR
Sbjct: 5   LAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGLVHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLA R GLSIVN+PGTIDA YRGEIKV LINLDP  PI++ RGDRIA
Sbjct: 65  SGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIA 112


>DUT_THEFY RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 179

 Score =  154 bits (389), Expect = 5e-40
 Identities = 78/126 (61%), Positives = 94/126 (74%), Gaps = 6/126 (4%)

Query: 1   MTDLAPI------KIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIA 54
           ++DL+P+      +I RLD +LPLP+ AH GDAG DL    D V+APG R  V TGIAIA
Sbjct: 19  VSDLSPVFGTVRVEIRRLDPDLPLPRYAHPGDAGADLVTAEDVVLAPGERATVRTGIAIA 78

Query: 55  LPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           LP G    +HPRSGLAAR GL++VNAPGT+DA YRGEIKV L+N DP  P+ +TRGDRIA
Sbjct: 79  LPDGYAAFIHPRSGLAARHGLTVVNAPGTVDAGYRGEIKVPLLNTDPATPVKLTRGDRIA 138

Query: 115 QLVIQK 120
           QLVIQ+
Sbjct: 139 QLVIQR 144


>DUT_MYCLE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  154 bits (388), Expect = 6e-40
 Identities = 72/108 (66%), Positives = 88/108 (81%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + +VRLD  LPLP RAH GDAGVDL++  D  +APG R +V TG+A+A+P G VGL+HPR
Sbjct: 5   LAVVRLDPGLPLPSRAHDGDAGVDLYSVEDVKLAPGQRALVRTGLAVAIPFGMVGLIHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLA R GLSIVN+PGT+DA YRGEIKV LINLDP +P+++ RGDRIA
Sbjct: 65  SGLAVRVGLSIVNSPGTVDAGYRGEIKVALINLDPVEPLVVHRGDRIA 112


>DUT_MYCLB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  154 bits (388), Expect = 6e-40
 Identities = 72/108 (66%), Positives = 88/108 (81%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + +VRLD  LPLP RAH GDAGVDL++  D  +APG R +V TG+A+A+P G VGL+HPR
Sbjct: 5   LAVVRLDPGLPLPSRAHDGDAGVDLYSVEDVKLAPGQRALVRTGLAVAIPFGMVGLIHPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           SGLA R GLSIVN+PGT+DA YRGEIKV LINLDP +P+++ RGDRIA
Sbjct: 65  SGLAVRVGLSIVNSPGTVDAGYRGEIKVALINLDPVEPLVVHRGDRIA 112


>DUT_STRGG RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 176

 Score =  140 bits (353), Expect = 7e-36
 Identities = 69/135 (51%), Positives = 90/135 (66%)

Query: 12  LDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAA 71
           LD ++P+P   H GDAG DL  T  A +APG R ++ TG++IALP G    VHPRSGLAA
Sbjct: 13  LDPDVPIPSYGHPGDAGADLVTTEAAELAPGERAVLPTGVSIALPDGYAAFVHPRSGLAA 72

Query: 72  REGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXX 131
           R G+++VNAPGT+DA YRGEIKV ++NLDP + +   R DRIAQLV+Q+           
Sbjct: 73  RCGVALVNAPGTVDAGYRGEIKVIVVNLDPRESVRFERFDRIAQLVVQQVEKVRFHEVAE 132

Query: 132 XXXTVRGDQGYGSTG 146
              + R + G+GSTG
Sbjct: 133 LPGSARAEGGFGSTG 147


>DUT_BIFLI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 158

 Score =  140 bits (352), Expect = 9e-36
 Identities = 74/141 (52%), Positives = 94/141 (66%), Gaps = 1/141 (0%)

Query: 7   IKIVRLDKELP-LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHP 65
           + +  LD E P L + AH GDAG DL  T D  + P  R +V TG+AIALP G V LVHP
Sbjct: 15  VLVKSLDPEHPALLRYAHAGDAGADLITTVDVTLKPFERALVPTGVAIALPAGYVALVHP 74

Query: 66  RSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXX 125
           RSGLAA++G++++NAPGT+DA YRGEIKV LINLDP+   +   GDRIAQLVIQ+     
Sbjct: 75  RSGLAAKQGVTVLNAPGTVDAGYRGEIKVPLINLDPKHTAVFHPGDRIAQLVIQRYVEAR 134

Query: 126 XXXXXXXXXTVRGDQGYGSTG 146
                    + R ++G+GSTG
Sbjct: 135 FIPAETLPGSDRAERGFGSTG 155


>DUT_BIFLO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 158

 Score =  138 bits (347), Expect = 4e-35
 Identities = 73/141 (51%), Positives = 92/141 (65%), Gaps = 1/141 (0%)

Query: 7   IKIVRLDKELPLPKR-AHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHP 65
           + +  LD E P     AH GDAG DL  T D  + P  R +V TG+AIALP G V LVHP
Sbjct: 15  VLVKSLDPEHPAQLHYAHAGDAGADLITTVDVTLKPFERALVPTGVAIALPAGYVALVHP 74

Query: 66  RSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXX 125
           RSGLAA++G++++NAPGT+DA YRGEIKV LINLDP+   +   GDRIAQLVIQ+     
Sbjct: 75  RSGLAAKQGVTVLNAPGTVDAGYRGEIKVPLINLDPKHTAVFHPGDRIAQLVIQRYVEAR 134

Query: 126 XXXXXXXXXTVRGDQGYGSTG 146
                    + R ++G+GSTG
Sbjct: 135 FIPAETLPGSDRAERGFGSTG 155


>DUT_BIFLD RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 158

 Score =  138 bits (347), Expect = 4e-35
 Identities = 73/141 (51%), Positives = 92/141 (65%), Gaps = 1/141 (0%)

Query: 7   IKIVRLDKELPLPKR-AHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHP 65
           + +  LD E P     AH GDAG DL  T D  + P  R +V TG+AIALP G V LVHP
Sbjct: 15  VLVKSLDPEHPAQLHYAHAGDAGADLITTVDVTLKPFERALVPTGVAIALPAGYVALVHP 74

Query: 66  RSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXX 125
           RSGLAA++G++++NAPGT+DA YRGEIKV LINLDP+   +   GDRIAQLVIQ+     
Sbjct: 75  RSGLAAKQGVTVLNAPGTVDAGYRGEIKVPLINLDPKHTAVFHPGDRIAQLVIQRYVEAR 134

Query: 126 XXXXXXXXXTVRGDQGYGSTG 146
                    + R ++G+GSTG
Sbjct: 135 FIPAETLPGSDRAERGFGSTG 155


>DUT_STRCO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 183

 Score =  135 bits (341), Expect = 2e-34
 Identities = 77/140 (55%), Positives = 98/140 (70%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + I R+D ++PLP  A  GDAG DL  T +  +APG R ++ TG+++ALP G    VHPR
Sbjct: 8   VLIRRVDPDVPLPAYAQPGDAGADLRTTVERELAPGERAVLPTGVSVALPEGYAAFVHPR 67

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLAAR G+++VNAPGTIDA YRGEIKV ++NLDP + +   R DRIAQL          
Sbjct: 68  SGLAARCGVALVNAPGTIDAGYRGEIKVIVVNLDPRESVRFERFDRIAQLXXXXXXXXXX 127

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   + R + G+GSTG
Sbjct: 128 XXXAELPGSARAEGGFGSTG 147


>DUT_PROAC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  134 bits (338), Expect = 4e-34
 Identities = 70/132 (53%), Positives = 85/132 (64%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           +P+ A  GDAG DL    D  +APG R +V TG+ +ALP G VG V+PRSGLAAR GLSI
Sbjct: 15  MPRYAMPGDAGADLTCRHDVDLAPGERAMVETGVRVALPDGYVGFVNPRSGLAARHGLSI 74

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVR 137
           VNAPGTID+ YRG+I V L+N DP +P+ +  G RIAQLV+                T R
Sbjct: 75  VNAPGTIDSGYRGQINVLLVNTDPREPVHLDAGSRIAQLVVVPVVEAIFEPVEDLDDTER 134

Query: 138 GDQGYGSTGKTA 149
           G  GYGSTG +A
Sbjct: 135 GQGGYGSTGVSA 146


>DUT_STRAW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 175

 Score =  130 bits (327), Expect = 7e-33
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 2/144 (1%)

Query: 5   APIKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGL 62
           AP+ ++  R+D ++PLP   H GDAG DL  T    + PG R ++ TG+++ALP G    
Sbjct: 4   APLNVLLRRVDPDVPLPAYEHPGDAGADLRTTESCELKPGERAVLPTGVSVALPEGYAAF 63

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           VHPRSGLAAR G+++VNAPGT+DA YRGEIKV ++NLDP + +   R DRIA        
Sbjct: 64  VHPRSGLAARCGVALVNAPGTVDAGYRGEIKVIVVNLDPRESVRFERFDRIAXXXXXXXX 123

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       + R + G+GSTG
Sbjct: 124 XXXXXXXAELPDSARAEGGFGSTG 147


>DUT_LEIXX RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  122 bits (306), Expect = 2e-30
 Identities = 70/148 (47%), Positives = 86/148 (58%), Gaps = 4/148 (2%)

Query: 1   MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTV 60
           MTD   I I+   K LP+   AH GDAG DL A     + PG R  V TG++IALP G  
Sbjct: 1   MTDTVDIPIIA--KRLPV--YAHPGDAGADLCAAEAVTLEPGERHTVPTGVSIALPEGYA 56

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             V PRSGLA + GL+IVNAPGT+DA YRGEI+V ++N D   P  I  GDRIAQL++  
Sbjct: 57  AFVVPRSGLAMKHGLTIVNAPGTVDAGYRGEIRVTVLNTDRSMPYDIAVGDRIAQLIVMP 116

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTGKT 148
                         + RG  G+GS+G T
Sbjct: 117 VTRAVFVPVDTLPDSHRGTAGFGSSGYT 144


>DUT_TROWT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 146

 Score =  120 bits (301), Expect = 8e-30
 Identities = 64/129 (49%), Positives = 82/129 (63%)

Query: 19  PKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIV 78
           P+RA  GDAG DL ++  AVI P  R++V TGIAIALP G  G + PRSGLA+  G+++V
Sbjct: 13  PQRAFDGDAGFDLQSSHTAVIQPRCRQVVKTGIAIALPDGYAGFIMPRSGLASENGITLV 72

Query: 79  NAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRG 138
           N+PG IDA YRGEI V LIN D  +   I++GDRIAQLVI                + RG
Sbjct: 73  NSPGVIDAGYRGEISVVLINTDLHQAFHISQGDRIAQLVIMPVCHASFIEVDTLPGSARG 132

Query: 139 DQGYGSTGK 147
              +GS+G+
Sbjct: 133 ISAFGSSGR 141


>DUT_TROW8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 146

 Score =  120 bits (301), Expect = 8e-30
 Identities = 64/129 (49%), Positives = 82/129 (63%)

Query: 19  PKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIV 78
           P+RA  GDAG DL ++  AVI P  R++V TGIAIALP G  G + PRSGLA+  G+++V
Sbjct: 13  PQRAFDGDAGFDLQSSHTAVIQPRCRQVVKTGIAIALPDGYAGFIMPRSGLASENGITLV 72

Query: 79  NAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRG 138
           N+PG IDA YRGEI V LIN D  +   I++GDRIAQLVI                + RG
Sbjct: 73  NSPGVIDAGYRGEISVVLINTDLHQAFHISQGDRIAQLVIMPVCHASFIEVDTLPGSARG 132

Query: 139 DQGYGSTGK 147
              +GS+G+
Sbjct: 133 ISAFGSSGR 141


>DUT_ANASK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  120 bits (301), Expect = 8e-30
 Identities = 66/132 (50%), Positives = 81/132 (61%), Gaps = 1/132 (0%)

Query: 16  LPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           L LP+    G AG+DL A     +APG R +V TG+A+ LP G  G V PRSGLAAR G+
Sbjct: 17  LDLPRYESAGAAGLDLRADEPFTLAPGERRVVPTGLALELPPGHEGQVRPRSGLAARHGV 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
            +VNAPGTIDADYRGE+ V L+N   + P+   RGDRIAQLVI                +
Sbjct: 77  GMVNAPGTIDADYRGEVGVILVN-HGQAPVAFARGDRIAQLVIAPVVRAELELVDALSDS 135

Query: 136 VRGDQGYGSTGK 147
            RG  G+GSTG+
Sbjct: 136 DRGAGGFGSTGQ 147


>DUT_ANADE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  120 bits (301), Expect = 8e-30
 Identities = 66/132 (50%), Positives = 81/132 (61%), Gaps = 1/132 (0%)

Query: 16  LPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           L LP+    G AG+DL A     +APG R +V TG+A+ LP G  G V PRSGLAAR G+
Sbjct: 17  LDLPRYESAGAAGLDLRADEPFTLAPGERRVVPTGLALELPPGHEGQVRPRSGLAARHGV 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
            +VNAPGTIDADYRGE+ V L+N   + P+   RGDRIAQLVI                +
Sbjct: 77  GMVNAPGTIDADYRGEVGVILVN-HGQAPVAFARGDRIAQLVIAPVVRAELELVDALTDS 135

Query: 136 VRGDQGYGSTGK 147
            RG  G+GSTG+
Sbjct: 136 DRGAGGFGSTGQ 147


>DUT_ANAD2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  120 bits (301), Expect = 8e-30
 Identities = 66/132 (50%), Positives = 81/132 (61%), Gaps = 1/132 (0%)

Query: 16  LPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           L LP+    G AG+DL A     +APG R +V TG+A+ LP G  G V PRSGLAAR G+
Sbjct: 17  LDLPRYESAGAAGLDLRADEPFTLAPGERRVVPTGLALELPPGHEGQVRPRSGLAARHGV 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
            +VNAPGTIDADYRGE+ V L+N   + P+   RGDRIAQLVI                +
Sbjct: 77  GMVNAPGTIDADYRGEVGVILVN-HGQAPVAFARGDRIAQLVIAPVVRAELELVDALSDS 135

Query: 136 VRGDQGYGSTGK 147
            RG  G+GSTG+
Sbjct: 136 DRGAGGFGSTGQ 147


>DUT_CLOK5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 143

 Score =  120 bits (300), Expect = 1e-29
 Identities = 64/138 (46%), Positives = 87/138 (63%), Gaps = 1/138 (0%)

Query: 9   IVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSG 68
           + R++KE  LP  AH GDAG+DL +  + +I P  R+++ TGI I LP  T G V PRSG
Sbjct: 5   VKRINKEAILPFYAHEGDAGLDLFSVEEVLIKPMERKLIATGIKIQLPPNTEGQVRPRSG 64

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXX 128
           LA   G++++N+PGTID  YRGEIKV +INL  E   +I +G +IAQ+VI+         
Sbjct: 65  LALAHGITLLNSPGTIDEGYRGEIKVLMINLGQE-GFLIKKGMKIAQMVIKPIEQVLIKE 123

Query: 129 XXXXXXTVRGDQGYGSTG 146
                 T RG+ G+GSTG
Sbjct: 124 VVELKDTERGEGGFGSTG 141


>DUT_EHRCJ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score =  119 bits (297), Expect = 2e-29
 Identities = 70/145 (48%), Positives = 91/145 (62%), Gaps = 6/145 (4%)

Query: 7   IKIVRLDKE-LPLPKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLV 63
           IK+++L+   LPLP  +    +G+DL++  T D ++APG R  + TGIAI++P G    V
Sbjct: 9   IKVIKLNSNNLPLPSYSTENSSGMDLYSAMTQDVILAPGCRACINTGIAISVPNGYEAQV 68

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK--X 121
            PRSGLA + G++++N PGTIDADYRGEIKV LINL  E    I  GDRIAQ+VI     
Sbjct: 69  RPRSGLALKFGITVLNTPGTIDADYRGEIKVILINLGHE-TYTIKYGDRIAQMVIAPVIH 127

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTG 146
                        T RGDQG+GSTG
Sbjct: 128 ASWNLVKDLDDDTTKRGDQGFGSTG 152


>DUT_NEOSM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score =  118 bits (296), Expect = 3e-29
 Identities = 65/148 (43%), Positives = 89/148 (60%), Gaps = 3/148 (2%)

Query: 1   MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLG 58
           M + A I ++   K+L +P+ A +G +G+DL A  +    + PG  E+V TGI I LP G
Sbjct: 1   MQEHAKILLLPHGKDLEIPRYASKGSSGLDLRAAIEGSMTLKPGMFELVPTGICIELPEG 60

Query: 59  TVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
               + PRSGLAA+ G++++N+PGT+D DYRGEIKVCL+NL  +    I RGDRIAQ+VI
Sbjct: 61  LEAQIRPRSGLAAKFGITVLNSPGTVDQDYRGEIKVCLVNLS-KNEFTINRGDRIAQMVI 119

Query: 119 QKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
            K              T R    +GSTG
Sbjct: 120 AKVEQILLVEAEEIGETERASGSFGSTG 147


>DUT_GEOBB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 146

 Score =  118 bits (296), Expect = 3e-29
 Identities = 70/144 (48%), Positives = 88/144 (61%), Gaps = 4/144 (2%)

Query: 6   PIKIVRLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALPLGTVGLV 63
           P++I RL +  PLP       AGVDL A+   D V+APG R +V TG+AI LP G    V
Sbjct: 5   PVRIKRL-RATPLPAYMTEHAAGVDLCASLSADFVLAPGERALVPTGLAIELPPGFEAQV 63

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSGLA R G+++VN+PGTIDADYRGEI V LINL  E P  ++ G+RIAQ+V  +   
Sbjct: 64  RPRSGLALRHGIALVNSPGTIDADYRGEIGVILINLGSE-PFTVSDGERIAQMVFARCER 122

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      T RG  G+G TG+
Sbjct: 123 AEFIEVDELGDTARGAGGFGHTGR 146


>DUT_DICTD RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  118 bits (295), Expect = 4e-29
 Identities = 69/144 (47%), Positives = 88/144 (61%), Gaps = 5/144 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAP----GHREIVGTGIAIALPLGTVGL 62
           + I R+DK+LPLP  A  G A +DL++  D  + P    G   ++ TGI IALP G + L
Sbjct: 4   VLIERIDKDLPLPNYATHGSAALDLYSRIDFELPPFGEIGGGLVIPTGIRIALPEGYLAL 63

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           V PRSGLAAREG+S++N PG ID+DYRGEI V LIN    KP +  RG RIAQL++ +  
Sbjct: 64  VLPRSGLAAREGISVLNTPGLIDSDYRGEIFVNLINFS-NKPFLGKRGMRIAQLLVLQYS 122

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG+ G GSTG
Sbjct: 123 RIIWEEVEQLPQTERGEGGLGSTG 146


>DUT_WOLPP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score =  117 bits (292), Expect = 8e-29
 Identities = 67/145 (46%), Positives = 90/145 (62%), Gaps = 5/145 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH 64
           IK +   K LPLP  A    AG+DL+A  D   ++ P  R ++ TGI IA+P G  G V 
Sbjct: 10  IKKLSHGKSLPLPCYATMQSAGMDLYAALDDSVILNPLERLLIPTGIVIAIPNGFEGQVR 69

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQ--KXX 122
           PRSGLAA+ G++++N+PGTID+DYRGE+KVCLINL   +P  I RGDRIAQ++I      
Sbjct: 70  PRSGLAAKHGITVLNSPGTIDSDYRGEVKVCLINLS-NQPYEIKRGDRIAQILITPVPEI 128

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTGK 147
                       T R + G+GS+G+
Sbjct: 129 IWNNIEEFYAKETARNEGGFGSSGR 153


>DUT_SPHWW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score =  117 bits (292), Expect = 8e-29
 Identities = 69/143 (48%), Positives = 84/143 (58%), Gaps = 3/143 (2%)

Query: 7   IKIVRLDKE--LPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           IK+ RLD    LPLP  A    AG+D+ +  D  +APG R  V TG AIA+P G    V 
Sbjct: 8   IKLKRLDHGAGLPLPAYATAHAAGLDVVSAEDVTLAPGARHAVATGFAIAIPEGYEVQVR 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA + G++ +N PGTIDADYRGE+KV L NL  E P  + RG+RIAQLV       
Sbjct: 68  PRSGLALKHGVTCLNTPGTIDADYRGEVKVILANLGSE-PFEVKRGERIAQLVPAAVQRA 126

Query: 125 XXXXXXXXXXTVRGDQGYGSTGK 147
                     T RG  G+GSTG+
Sbjct: 127 AFAEVSDLDETARGAGGFGSTGR 149


>DUT_PELLD RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  117 bits (292), Expect = 8e-29
 Identities = 65/142 (45%), Positives = 88/142 (61%), Gaps = 3/142 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVH 64
           +KIVRL+K+  LP  A R  AG+D+ A  +A  V+APG  E++ TG+AI LP G    + 
Sbjct: 4   VKIVRLNKQAFLPVYATRHAAGMDVSACLEAPVVVAPGSAELIATGLAIELPEGYEAQLR 63

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA R  +S+ N+P TIDADYRGE+KV L+N     P  ++ GDRIAQ+V+ +    
Sbjct: 64  PRSGLALRNLISLPNSPATIDADYRGEVKVILVN-HGRDPFKVSHGDRIAQMVVARVEQV 122

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RG+ G+G TG
Sbjct: 123 SFVEVDTLGDTERGEGGFGHTG 144


>DUT_CLOTE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score =  115 bits (289), Expect = 2e-28
 Identities = 62/141 (43%), Positives = 86/141 (60%), Gaps = 1/141 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +KI  L ++  LP+ AH  DAG+DL +T D +I PG   ++ TGI+I LP  T   + PR
Sbjct: 6   LKIKLLKEDAKLPQYAHDNDAGMDLFSTEDKIINPGKHALILTGISIELPENTEAQIRPR 65

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA + G++++N PGTIDA YRGEI + LIN   EK   + +G +IAQ+VI+       
Sbjct: 66  SGLALKNGVTVLNTPGTIDAGYRGEIGIILIN-HGEKNFQVEKGMKIAQMVIKPIVKVNI 124

Query: 127 XXXXXXXXTVRGDQGYGSTGK 147
                   + RG  G+GSTGK
Sbjct: 125 EEVKMLSESQRGKGGFGSTGK 145


>DUT_GEOSM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 146

 Score =  115 bits (287), Expect = 3e-28
 Identities = 68/144 (47%), Positives = 87/144 (60%), Gaps = 4/144 (2%)

Query: 6   PIKIVRLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALPLGTVGLV 63
           P++I RL +  PLP       AGVDL A+   D V++PG R +V TG+AI LP G    V
Sbjct: 5   PVRIKRL-RATPLPGYMTEHAAGVDLCASLSADFVLSPGERALVPTGLAIELPPGFEAQV 63

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSGLA R G+++VN+PGTIDADYRGEI V LINL    P  ++ G+RIAQ+V  +   
Sbjct: 64  RPRSGLALRHGIALVNSPGTIDADYRGEIGVILINLG-SAPFTVSDGERIAQMVFARCER 122

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      T RG  G+G TG+
Sbjct: 123 AEFIEVEELGDTARGAGGFGHTGR 146


>DUT_AQUAE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score =  115 bits (287), Expect = 3e-28
 Identities = 76/144 (52%), Positives = 100/144 (69%), Gaps = 5/144 (3%)

Query: 7   IKIVRLD--KELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALPLGTVGL 62
           +KI RL   ++LPLP  A    +G+DL A  +    I P  R ++ TG+ + +P G  G 
Sbjct: 6   LKIKRLPHAQDLPLPSYATPHSSGLDLRAAIEKPLKIKPFERVLIPTGLILEIPEGYEGQ 65

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           V PRSGLA ++GL+++NAPGTIDADYRGE+KV L+NL  E+ ++I RG+RIAQLVI    
Sbjct: 66  VRPRSGLAWKKGLTVLNAPGTIDADYRGEVKVILVNLGNEE-VVIERGERIAQLVIAPVQ 124

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG+ G+GSTG
Sbjct: 125 RXXXXXXXXXSQTQRGEGGFGSTG 148


>DUT_GEOSF RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score =  113 bits (283), Expect = 9e-28
 Identities = 67/143 (46%), Positives = 85/143 (59%), Gaps = 3/143 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVH 64
           IK +R +K  PLP+      AGVDL A  D   V+ PG R +V TGIAI LP G    + 
Sbjct: 8   IKRIRPEKGNPLPRYMTAHAAGVDLCADLDQELVLEPGERTLVPTGIAIELPEGYEAQIR 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA + G+S+VN+PGTIDADYRGEI V +IN   E P +I+  +RIAQ+V       
Sbjct: 68  PRSGLALKHGISLVNSPGTIDADYRGEIGVIVINHGNE-PFVISNNERIAQMVFAPFTRA 126

Query: 125 XXXXXXXXXXTVRGDQGYGSTGK 147
                     T RG+ G+G TG+
Sbjct: 127 VFQDVAELGETARGEGGFGHTGR 149


>DUT_GLUOX RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score =  112 bits (280), Expect = 2e-27
 Identities = 67/149 (44%), Positives = 86/149 (57%), Gaps = 5/149 (3%)

Query: 2   TDLAPIKIVRL--DKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPL 57
           TDL  ++I RL   + LPLP  A  G AG D  A  DA   IAPG R +V TG+ IALP 
Sbjct: 3   TDLIDVRITRLPHSEGLPLPAYATAGAAGFDFLAAVDAPMTIAPGERVLVPTGLCIALPP 62

Query: 58  GTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLV 117
                V PRSGLA + G+++ N+PGTID DYRGE+++ ++N   E P  + RG RIAQ V
Sbjct: 63  AYELQVRPRSGLALKHGITLPNSPGTIDEDYRGELRIIVMNAGTE-PFTVERGTRIAQGV 121

Query: 118 IQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           +                T RG+ G+GSTG
Sbjct: 122 LAPVSRLRWTEVETLDETARGEGGFGSTG 150


>DUT_ACAM1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 143

 Score =  112 bits (279), Expect = 3e-27
 Identities = 61/140 (43%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           IKI++L +   +P+ +H  DAG+DL A     I PG   ++ TGIAI LP GT   V PR
Sbjct: 3   IKIIKLTESAQVPRYSHADDAGLDLFAIEAQKILPGASALIPTGIAIELPQGTEAQVRPR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA +  ++++N+PGTIDA YRGEI V LIN   ++   +  G +IAQ+VI        
Sbjct: 63  SGLALKHSITVLNSPGTIDAGYRGEIGVILIN-HGQETFQVVEGMKIAQMVIAPIMRAEI 121

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   T RG+ G+GSTG
Sbjct: 122 EEVTELSATQRGEGGFGSTG 141


>DUT_THETN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  111 bits (278), Expect = 4e-27
 Identities = 63/144 (43%), Positives = 87/144 (60%), Gaps = 5/144 (3%)

Query: 7   IKIVRLD--KELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALPLGTVGL 62
           +KI R +  K+LPLP     G AG+DL+A    +  I PG  E++ TGI I LP      
Sbjct: 5   LKIKRTEDAKDLPLPAYMSEGAAGMDLYANVKGEVTINPGEVELIPTGIQIELPPNYEAQ 64

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA   G++++N PGT+D+DYRGEIK+ +INL  ++P+ I RG RIAQ+VI +  
Sbjct: 65  IRPRSGLALNYGITLLNTPGTVDSDYRGEIKLIVINLG-KQPVTIKRGQRIAQMVINQVV 123

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T R D+G+G TG
Sbjct: 124 RPKIIEVEELSETERMDRGFGHTG 147


>DUT_DICT6 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  111 bits (278), Expect = 4e-27
 Identities = 67/147 (45%), Positives = 86/147 (58%), Gaps = 5/147 (3%)

Query: 4   LAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAP----GHREIVGTGIAIALPLGT 59
           +  + I R+DK+LPLP  A  G A +DL++  D  + P    G   ++ TGI IALP G 
Sbjct: 1   MVKVLIERIDKDLPLPNYATSGSAALDLYSRIDFELPPFKEIGGGLVIPTGIKIALPEGY 60

Query: 60  VGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQ 119
           +  V PRSGLAA+EG+SI+N PG ID+DYRGEI V LIN    K     RG RIAQL++ 
Sbjct: 61  LAFVLPRSGLAAKEGISILNTPGLIDSDYRGEIFVNLINFS-NKTFYGKRGMRIAQLLVL 119

Query: 120 KXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           +              T RG+ G GSTG
Sbjct: 120 QYAHVMWEEVSQLPQTERGEGGLGSTG 146


>DUT_PELCD RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  111 bits (277), Expect = 5e-27
 Identities = 64/142 (45%), Positives = 85/142 (59%), Gaps = 3/142 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVH 64
           IK+ RL  +  LP       AG+DL+A  D   V+ PG R IV TGIA+A+P+G  G V 
Sbjct: 6   IKVKRLHSKAMLPAYMSPHAAGMDLYACPDGEVVVKPGCRTIVPTGIALAIPVGYEGQVR 65

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA   G+++VN PGTIDADYRGE+ + +IN   ++  +++ GDRIAQLVI      
Sbjct: 66  PRSGLALHHGVTLVNTPGTIDADYRGELGIIIIN-HGDEDFVVSPGDRIAQLVIAPVHRA 124

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T R + G+G TG
Sbjct: 125 VLETVEELDETDRNEGGFGHTG 146


>DUT_WOLTR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 156

 Score =  110 bits (276), Expect = 6e-27
 Identities = 65/145 (44%), Positives = 88/145 (60%), Gaps = 5/145 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           IK +   K+LPLP  A    AG+DL+A      V+ P  R ++ TGI I +P G  G + 
Sbjct: 13  IKKLSHGKDLPLPCYATMQSAGMDLYAALGNSIVLNPLERLLIPTGIVIVIPNGFEGQIR 72

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK--XX 122
           PRSGLAA+ G++++N+PGTID+DYRGE+KVCLINL   +P  I RGDRIAQ++I      
Sbjct: 73  PRSGLAAKYGITVLNSPGTIDSDYRGEVKVCLINLS-NQPYEIKRGDRIAQILIAPVFRV 131

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTGK 147
                       T R   G+GS+G+
Sbjct: 132 IWDDAERLCTEETERSAGGFGSSGR 156


>DUT_WOLPM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score =  110 bits (276), Expect = 6e-27
 Identities = 65/145 (44%), Positives = 90/145 (62%), Gaps = 5/145 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH 64
           IK +   ++L LP  A    AG+DL+A  +  AV+ P  R +V TGI IA+P G  G + 
Sbjct: 10  IKRLSHGEDLSLPCYATTQSAGMDLYAALNDSAVLNPLERLLVPTGIVIAIPNGFEGQIR 69

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQ--KXX 122
           PRSGLAA+ G++++N+PGTID+DYRGE+K+CLINL   +P  I RGDRIAQ++I      
Sbjct: 70  PRSGLAAKHGITVLNSPGTIDSDYRGEVKICLINLS-NQPYEIKRGDRIAQILISPVSQV 128

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTGK 147
                       T R   G+GS+G+
Sbjct: 129 IWDDREEFCAEETGRNAGGFGSSGR 153


>DUT_WOLWR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score =  110 bits (275), Expect = 8e-27
 Identities = 66/145 (45%), Positives = 90/145 (62%), Gaps = 5/145 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH 64
           IK +   ++L LP  A    AG+DL+A  +  AV+ P  R +V TGI IA+P G  G V 
Sbjct: 10  IKRLSHGEDLSLPCYATVQSAGMDLYAALNDSAVLNPLERLLVPTGIVIAIPNGFEGQVR 69

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQ--KXX 122
           PRSGLAA+ G++++N+PGTID+DYRGE+K+CLINL   +P  I RGDRIAQ++I      
Sbjct: 70  PRSGLAAKHGITVLNSPGTIDSDYRGEVKICLINLS-NQPYEIKRGDRIAQILISPVSQV 128

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTGK 147
                       T R   G+GS+G+
Sbjct: 129 IWDDREEFCAEETGRNAGGFGSSGR 153


>DUT_RHOPS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  110 bits (275), Expect = 8e-27
 Identities = 69/153 (45%), Positives = 89/153 (58%), Gaps = 7/153 (4%)

Query: 1   MTDLAPIKIVRLD--KELPLPKRAHRGDAGVDLHATTDA----VIAPGHREIVGTGIAIA 54
           M+D   ++I +L   + LPLP       AG+DL A   A    ++APG   +V TG+ IA
Sbjct: 1   MSDTIAVEIKQLPHAEGLPLPAYQSAHAAGLDLCAANSADAPLLLAPGSYVLVPTGLTIA 60

Query: 55  LPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           LP      V PRSGLAA+ G++++NAPGTIDADYRGEI V LIN   + P  I RG+RIA
Sbjct: 61  LPENYEAQVRPRSGLAAKHGVTVLNAPGTIDADYRGEIGVLLIN-HGDAPFTIRRGERIA 119

Query: 115 QLVIQKXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
           Q+VI                T RG  G+GSTG+
Sbjct: 120 QMVIAPVVRAELIGVETLSETARGVGGFGSTGR 152


>DUT_SYNAS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score =  110 bits (274), Expect = 1e-26
 Identities = 62/135 (45%), Positives = 80/135 (59%), Gaps = 3/135 (2%)

Query: 16  LPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAARE 73
           L LP+      AG+D+ A    + VI PG R ++ TGIAIALP G    + PRSGLA + 
Sbjct: 17  LSLPRYMSEHAAGMDICAAVADEVVILPGERALIPTGIAIALPEGFEAQIRPRSGLALKH 76

Query: 74  GLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXX 133
           G+++VNAPGTIDADYRGEI V LIN     P ++ RG R+AQ+VI               
Sbjct: 77  GVTLVNAPGTIDADYRGEIGVLLIN-HGNDPFVVARGSRVAQMVIAPVCRVAWSESGSLE 135

Query: 134 XTVRGDQGYGSTGKT 148
            T RGD G+G T ++
Sbjct: 136 TTTRGDGGFGHTDES 150


>DUT_ANAMM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  110 bits (274), Expect = 1e-26
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 5/144 (3%)

Query: 7   IKIVRLDKE--LPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGL 62
           +KI+RL     LPLP  A    AG+DL+A  D+  V+ PG R  V TG+A+ LP G    
Sbjct: 4   VKILRLASGYGLPLPSYATPKSAGLDLYAAVDSKLVVHPGGRCAVKTGVALELPDGYEAQ 63

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           +  RSGLAA  G+ ++NAPGTID+DYRGEI V L N   E   +I+RGDR+AQ+VI    
Sbjct: 64  IRSRSGLAANFGICVLNAPGTIDSDYRGEITVVLSNFGSE-DYVISRGDRVAQMVIAPVE 122

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG+ G+GSTG
Sbjct: 123 RVEWEEVNSITATSRGEGGFGSTG 146


>DUT_ANAMF RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  110 bits (274), Expect = 1e-26
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 5/144 (3%)

Query: 7   IKIVRLDKE--LPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGL 62
           +KI+RL     LPLP  A    AG+DL+A  D+  V+ PG R  V TG+A+ LP G    
Sbjct: 4   VKILRLASGYGLPLPSYATPKSAGLDLYAAVDSKLVVHPGGRCAVKTGVALELPDGYEAQ 63

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           +  RSGLAA  G+ ++NAPGTID+DYRGEI V L N   E   +I+RGDR+AQ+VI    
Sbjct: 64  IRSRSGLAANFGICVLNAPGTIDSDYRGEITVVLSNFGSE-DYVISRGDRVAQMVIAPVE 122

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG+ G+GSTG
Sbjct: 123 RVEWEEVNSITATSRGEGGFGSTG 146


>DUT_OLICO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  109 bits (273), Expect = 1e-26
 Identities = 69/153 (45%), Positives = 88/153 (57%), Gaps = 7/153 (4%)

Query: 1   MTDLAPIKIVRLD--KELPLPKRAHRGDAGVDLHATTDA----VIAPGHREIVGTGIAIA 54
           MT+   I + +L   + LPLP       AG+DL A         IAPG R +V TG+AIA
Sbjct: 1   MTEPLRIAVTQLPHGQGLPLPAYQTEHAAGLDLLAAVPEDKPLAIAPGERALVPTGLAIA 60

Query: 55  LPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           LP G    V PRSGLA + G++++NAPGTIDADYRGEI V LIN   E   +I RG+RIA
Sbjct: 61  LPAGYEAQVRPRSGLAVKHGVTVLNAPGTIDADYRGEIGVPLINHGRE-TFIIRRGERIA 119

Query: 115 QLVIQKXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
           Q+V+                + RG  G+GSTG+
Sbjct: 120 QMVVAPVVQIAFEPVAELPMSARGAGGFGSTGR 152


>DUT_NITWN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  109 bits (273), Expect = 1e-26
 Identities = 63/136 (46%), Positives = 80/136 (58%), Gaps = 5/136 (3%)

Query: 16  LPLPKRAHRGDAGVDLHAT----TDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAA 71
           LPLP       AG+DL A        V+A G R +V TG+ IALP G    V PRSGLAA
Sbjct: 18  LPLPSYQSTQAAGLDLIAAIGEQAPLVLAAGRRAMVPTGLVIALPDGYEAQVRPRSGLAA 77

Query: 72  REGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXX 131
           R G++++N+PGT+DADYRGEI V L+NL  E    I RG+RIAQ+++             
Sbjct: 78  RHGVTVLNSPGTVDADYRGEINVLLVNLGSE-AFTIRRGERIAQMIVAPVTRVELVRAAA 136

Query: 132 XXXTVRGDQGYGSTGK 147
              T RG  G+GSTG+
Sbjct: 137 LPATPRGSGGFGSTGR 152


>DUT_ANADF RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  109 bits (273), Expect = 1e-26
 Identities = 56/103 (54%), Positives = 71/103 (68%), Gaps = 1/103 (0%)

Query: 16  LPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           L LP+    G AG+DL A     +APG R +V TG+A+ +P G  G V PRSGLA R G+
Sbjct: 17  LELPRYETDGAAGLDLRADEPVTLAPGERRLVPTGLALEIPPGHEGQVRPRSGLAVRHGV 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
            +VNAPGTID+DYRGE+ V L+N   ++P+   RGDRIAQLVI
Sbjct: 77  GMVNAPGTIDSDYRGEVGVVLVN-HGQEPVTFARGDRIAQLVI 118


>DUT_SYNWW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score =  109 bits (272), Expect = 2e-26
 Identities = 59/134 (44%), Positives = 84/134 (62%), Gaps = 3/134 (2%)

Query: 15  ELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAR 72
           +LPLP+    G +G+DL+A  D   +I  G   +V TG+A+A+P G    + PRSGLA +
Sbjct: 12  DLPLPRYMTPGSSGLDLYAAVDEEILIPSGKIVLVPTGLALAIPEGYEAQIRPRSGLALK 71

Query: 73  EGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXX 132
            G++++N PGTIDADYRGEIKV +INL  +K  ++ RG+RIAQ+V  +            
Sbjct: 72  YGITLLNTPGTIDADYRGEIKVIVINLG-DKDYILKRGERIAQMVFSRVEKAEFMEVKSL 130

Query: 133 XXTVRGDQGYGSTG 146
             T+RG  G+G TG
Sbjct: 131 DETLRGAGGFGHTG 144


>DUT_PROA2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score =  109 bits (272), Expect = 2e-26
 Identities = 62/142 (43%), Positives = 82/142 (57%), Gaps = 3/142 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVH 64
           + IVR++K   LP+ A +  AG+D+ A  D    I P    +V TG+A+ LP G    + 
Sbjct: 4   VNIVRVNKNAILPRYATQHAAGMDIAACLDVPLTIQPSETVLVPTGLAVELPEGYEAQLR 63

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA +  +S+ NAP TIDADYRGE+KV L+NL  E P  +  GDRIAQ+VI +    
Sbjct: 64  PRSGLALKYAISLPNAPATIDADYRGEVKVILVNLGQE-PFCVNHGDRIAQMVIARYEHA 122

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RG  G+G TG
Sbjct: 123 ELQEVEELSRTPRGSGGFGHTG 144


>DUT_RHIL3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 156

 Score =  108 bits (271), Expect = 2e-26
 Identities = 65/151 (43%), Positives = 89/151 (58%), Gaps = 8/151 (5%)

Query: 3   DLAP-IKIVRL--DKELPLPKRAHRGDAGVDLHATTDAV----IAPGHREIVGTGIAIAL 55
           DL+P + ++RL   + L LP    +G AG+DL A  D      + PG R +V TG    +
Sbjct: 6   DLSPTLNLIRLANGEGLDLPAYESKGAAGMDLRAAVDEAAPLTLLPGKRALVPTGFIFEI 65

Query: 56  PLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
           P G  G V PRSGLA + G++ +N+PGT+D+DYRGE+KV L NL  E+  +I+RG RIAQ
Sbjct: 66  PEGFEGQVRPRSGLAFKNGITCLNSPGTVDSDYRGEVKVLLANLG-EEAFVISRGMRIAQ 124

Query: 116 LVIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           +VI                T+RG  G+GSTG
Sbjct: 125 MVIAPVTQMRVAEITEASETMRGAGGFGSTG 155


>DUT_ZYMMO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 146

 Score =  108 bits (270), Expect = 3e-26
 Identities = 60/131 (45%), Positives = 76/131 (58%), Gaps = 1/131 (0%)

Query: 16  LPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           LP P  A  G AG+D+ +  D ++ P  R  V TG A+A+P G    V  RSGLA + G+
Sbjct: 16  LPFPSYASEGAAGMDVVSAEDVILQPMQRYPVKTGFAVAIPNGYEIQVRARSGLALKHGI 75

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
           +  NAPGTID+DYRGE+K+ LINL  E    I RGDRIAQL++                T
Sbjct: 76  ACPNAPGTIDSDYRGEVKILLINLGSE-AFEIKRGDRIAQLILASVTQAVFCEVTDLDDT 134

Query: 136 VRGDQGYGSTG 146
            RG  G+GSTG
Sbjct: 135 QRGHNGFGSTG 145


>DUT_RHOP2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  108 bits (270), Expect = 3e-26
 Identities = 69/153 (45%), Positives = 87/153 (56%), Gaps = 7/153 (4%)

Query: 1   MTDLAPIKIVRLD--KELPLPKRAHRGDAGVDLHATTDA----VIAPGHREIVGTGIAIA 54
           M+    ++I RL   + LPLP       AG+DL A   A     +APG   +V TG+ IA
Sbjct: 1   MSPAIAVEIKRLPHAEGLPLPAYQSAHAAGLDLCAANSADAPLSLAPGCHMLVPTGLCIA 60

Query: 55  LPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           LP      V PRSGLAA+ G++++NAPGTIDADYRGEI V LIN   E P  I RG+RIA
Sbjct: 61  LPPNYEAQVRPRSGLAAKHGVTVLNAPGTIDADYRGEIGVLLINHGKE-PFTIRRGERIA 119

Query: 115 QLVIQKXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
           Q++I                T RG  G+GSTG+
Sbjct: 120 QMIIAPVVRAELISVETLSETARGVGGFGSTGR 152


>DUT_ACICJ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  108 bits (270), Expect = 3e-26
 Identities = 69/148 (46%), Positives = 84/148 (56%), Gaps = 3/148 (2%)

Query: 1   MTDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLG 58
           MT    +K +     LPLP  A  G AG+DL A  DA  VIAPG R +V TG+AIALP  
Sbjct: 1   MTIAVAVKRLAHGAGLPLPDYATAGSAGLDLLAAVDAPVVIAPGARALVPTGLAIALPPD 60

Query: 59  TVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
               V PRSGLA + G+ I N+PGTID+DYRGEI+V ++N   E    +TRG RIAQ V+
Sbjct: 61  FELQVRPRSGLALKHGIVIPNSPGTIDSDYRGEIQVIVLNAGTE-AFEVTRGMRIAQAVL 119

Query: 119 QKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
                           T R   G+GSTG
Sbjct: 120 APVSRLVWQETDDLDRTAREAGGFGSTG 147


>DUT_HYDS0 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score =  108 bits (269), Expect = 4e-26
 Identities = 74/139 (53%), Positives = 96/139 (69%), Gaps = 2/139 (1%)

Query: 9   IVRLDKELPLPKRAHRGDAGVDLHATTDAV-IAPGHREIVGTGIAIALPLGTVGLVHPRS 67
           + +L ++  LP  A  G +G+DL    D V I P  R +V TGIAI LP G    + PRS
Sbjct: 5   VKKLREDAALPFYATSGASGLDLFCVDDVVVIRPFERVLVSTGIAIELPEGYEAQIRPRS 64

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GLA ++G++++N+PGTID DYRGEIKV LINL  +K ++I +G+RIAQ+           
Sbjct: 65  GLALKKGVTVLNSPGTIDHDYRGEIKVILINLS-DKEVIIEKGERIAQMXXXXXXXXXXX 123

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  T R D G+GSTG
Sbjct: 124 XXXXXSNTQRQDGGFGSTG 142


>DUT_THEPX RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  107 bits (268), Expect = 5e-26
 Identities = 61/144 (42%), Positives = 85/144 (59%), Gaps = 5/144 (3%)

Query: 7   IKIVRLD--KELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALPLGTVGL 62
           +KI + D  K+LPLP     G AG+DL+A    + ++ PG  +++ TGI I LP      
Sbjct: 5   LKIKKTDDAKDLPLPAYMSEGAAGMDLYANVKEEVILQPGEIKLIPTGIQIELPPNFEAQ 64

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA   G++++N PGTID+DYRGEIK+ +INL  E  + I RG RIAQ+VI +  
Sbjct: 65  IRPRSGLALNYGITLLNTPGTIDSDYRGEIKLIVINLGKE-AVKIARGQRIAQMVINQIV 123

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T R + G+G TG
Sbjct: 124 RPTIVEAEILSETKRDEGGFGHTG 147


>DUT_THEP3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  107 bits (268), Expect = 5e-26
 Identities = 61/144 (42%), Positives = 85/144 (59%), Gaps = 5/144 (3%)

Query: 7   IKIVRLD--KELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALPLGTVGL 62
           +KI + D  K+LPLP     G AG+DL+A    + ++ PG  +++ TGI I LP      
Sbjct: 5   LKIKKTDDAKDLPLPAYMSEGAAGMDLYANVKEEVILQPGEIKLIPTGIQIELPPNFEAQ 64

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA   G++++N PGTID+DYRGEIK+ +INL  E  + I RG RIAQ+VI +  
Sbjct: 65  IRPRSGLALNYGITLLNTPGTIDSDYRGEIKLIVINLGKE-AVKIARGQRIAQMVINQIV 123

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T R + G+G TG
Sbjct: 124 RPTIVEAEILSETKRDEGGFGHTG 147


>DUT_RICBR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score =  107 bits (268), Expect = 5e-26
 Identities = 65/146 (44%), Positives = 86/146 (58%), Gaps = 4/146 (2%)

Query: 4   LAPIKIVRLDKEL-PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV 60
           +  +K+ +LD     LP+ A    AG+DL A  +    I  G  +++ TGIAIALP    
Sbjct: 3   ITQVKVKKLDNFFGKLPEYATDHSAGMDLTAANEQPITIKAGEIQLIPTGIAIALPELFE 62

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLAA+ G+++ N+PGTIDADYRGEIKV LINL  +   +I +G RIAQ+VI K
Sbjct: 63  AQIRPRSGLAAKNGITVANSPGTIDADYRGEIKVILINLGKD-DFVIEKGMRIAQMVISK 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T RG  G+GSTG
Sbjct: 122 YERISWKESETLEETARGSGGFGSTG 147


>DUT_RICB8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score =  107 bits (268), Expect = 5e-26
 Identities = 65/146 (44%), Positives = 86/146 (58%), Gaps = 4/146 (2%)

Query: 4   LAPIKIVRLDKEL-PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV 60
           +  +K+ +LD     LP+ A    AG+DL A  +    I  G  +++ TGIAIALP    
Sbjct: 3   ITQVKVKKLDNFFGKLPEYATDHSAGMDLTAANEQPITIKAGEIQLIPTGIAIALPELFE 62

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLAA+ G+++ N+PGTIDADYRGEIKV LINL  +   +I +G RIAQ+VI K
Sbjct: 63  AQIRPRSGLAAKNGITVANSPGTIDADYRGEIKVILINLGKD-DFVIEKGMRIAQMVISK 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T RG  G+GSTG
Sbjct: 122 YERISWKESETLEETARGSGGFGSTG 147


>DUT_RICAH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  107 bits (268), Expect = 5e-26
 Identities = 63/147 (42%), Positives = 87/147 (59%), Gaps = 4/147 (2%)

Query: 3   DLAPIKIVRLDK-ELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGT 59
           ++  +KI +L+     LP+ A    AG+DL A  +    I  G  +++ TGIAIALP   
Sbjct: 2   NITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAGEIQLIPTGIAIALPYSF 61

Query: 60  VGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQ 119
              + PRSGLA + G+++ N+PGTIDADYRGEIKV LINL  +   +I +G RIAQ++I 
Sbjct: 62  EAQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGTQ-DFVIEKGMRIAQIIIS 120

Query: 120 KXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           K              T+RG  G+GSTG
Sbjct: 121 KYERILWEESSILTETMRGSGGFGSTG 147


>DUT_RICTY RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  107 bits (267), Expect = 7e-26
 Identities = 63/131 (48%), Positives = 80/131 (61%), Gaps = 3/131 (2%)

Query: 18  LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           LP  A    AGVDL A  +   +I  G  +++ TGIAIALP      + PRSGLA + G+
Sbjct: 18  LPAYATEHSAGVDLIAANEQTILIKVGSIQLIPTGIAIALPDSFEAQIRPRSGLAIKHGI 77

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
           ++ N+PGTIDADYRGEIKV LINL  +K  +I RG RIAQ++I K              T
Sbjct: 78  TVANSPGTIDADYRGEIKVLLINLG-KKDFLIERGMRIAQMIIAKYERVLWAETSILTET 136

Query: 136 VRGDQGYGSTG 146
           +RG  G+GSTG
Sbjct: 137 MRGRGGFGSTG 147


>DUT_RICPR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  107 bits (267), Expect = 7e-26
 Identities = 65/143 (45%), Positives = 86/143 (60%), Gaps = 4/143 (2%)

Query: 7   IKIVRLDKELP-LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLV 63
           +KI +L+  L  LP+ A    AG+DL A  +    I  G  +++ TGIAIALP      +
Sbjct: 6   VKIKKLENFLGNLPEYATEHSAGMDLVAANEQSITIKVGSIQLIPTGIAIALPESFEAQI 65

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSGLA + G+++ N+PGTIDADYRGEIKV LINL   K  +I +G RIAQ++I K   
Sbjct: 66  RPRSGLAVKHGITVANSPGTIDADYRGEIKVLLINLG-NKDFIIEKGMRIAQMIIAKYER 124

Query: 124 XXXXXXXXXXXTVRGDQGYGSTG 146
                      T+RG  G+GSTG
Sbjct: 125 VLWAETSILTETMRGRGGFGSTG 147


>DUT_TRIEI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 142

 Score =  107 bits (266), Expect = 9e-26
 Identities = 57/140 (40%), Positives = 83/140 (59%), Gaps = 1/140 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +KI +LD+   +P  AH+GDAG+DL +  ++ I PG  +++ TGI+I LP GT   + PR
Sbjct: 3   LKIKKLDELAIIPFYAHKGDAGLDLFSIDESTINPGESKLIHTGISIELPSGTEAQIRPR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA +  ++++N PGTID  YRGEI + LIN   +    +T+  +IAQ+VI        
Sbjct: 63  SGLALKHQITVLNTPGTIDETYRGEIGIILIN-HGKNSFQVTKRMKIAQMVITSVLSVKV 121

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   T R   G+GSTG
Sbjct: 122 EEVNQLSTTQRDINGFGSTG 141


>DUT_RICFE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  107 bits (266), Expect = 9e-26
 Identities = 64/146 (43%), Positives = 86/146 (58%), Gaps = 4/146 (2%)

Query: 4   LAPIKIVRLDK-ELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV 60
           +  +KI +L+     LP+ A    AG+DL A  +    I  G  +++ TGIAIALP    
Sbjct: 3   ITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAGEIQLIPTGIAIALPDSFE 62

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLA + G+++ N+PGTIDADYRGEIKV LINL  E   +I +G RIAQ++I K
Sbjct: 63  AQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGKE-DFVIEKGMRIAQMIIAK 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T+RG  G+GSTG
Sbjct: 122 YERILWEESSSLTETMRGSGGFGSTG 147


>DUT_RHIEC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 156

 Score =  107 bits (266), Expect = 9e-26
 Identities = 62/146 (42%), Positives = 84/146 (57%), Gaps = 7/146 (4%)

Query: 7   IKIVRL--DKELPLPKRAHRGDAGVDLHATTDA----VIAPGHREIVGTGIAIALPLGTV 60
           + ++RL   + L LP    +G AG+DL A  D      +APG R ++ TG    +P G  
Sbjct: 11  LNLIRLANGEGLDLPAYESKGAAGMDLRAAVDGDAPLTLAPGERALLPTGFIFEIPEGFE 70

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           G V PRSGLA + G++ +N+PGT+D+DYRGE+KV L NL  E+  +I RG RIAQ+VI  
Sbjct: 71  GQVRPRSGLAFKHGITCLNSPGTVDSDYRGEVKVLLANLG-EEAFVIERGMRIAQMVIAP 129

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T RG  G+GSTG
Sbjct: 130 VTQARVTEIAAASETARGAGGFGSTG 155


>DUT_PORGI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score =  106 bits (265), Expect = 1e-25
 Identities = 63/143 (44%), Positives = 81/143 (56%), Gaps = 4/143 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVH 64
           IKI+      PLP  A    AG+DL A+ +  I   P  R ++ TG+ I LP+G    + 
Sbjct: 3   IKIINRSHH-PLPTYATSASAGMDLRASIEEPITLLPLERRLIPTGLFIELPVGYEAQIR 61

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA R G+++VN+PGTIDADYRGEI + +INL    P  I  G+RI QLVI +    
Sbjct: 62  PRSGLALRHGITLVNSPGTIDADYRGEIGIIMINLS-NTPFTIADGERICQLVIARHEQA 120

Query: 125 XXXXXXXXXXTVRGDQGYGSTGK 147
                     T RG  G+G TGK
Sbjct: 121 EWVLTDELADTERGAGGFGHTGK 143


>DUT_PORG3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score =  106 bits (265), Expect = 1e-25
 Identities = 63/143 (44%), Positives = 81/143 (56%), Gaps = 4/143 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVH 64
           IKI+      PLP  A    AG+DL A+ +  I   P  R ++ TG+ I LP+G    + 
Sbjct: 3   IKIINRSHH-PLPAYATSASAGMDLRASIEEPITLLPLERRLIPTGLFIELPVGYEAQIR 61

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA R G+++VN+PGTIDADYRGEI + +INL    P  I  G+RI QLVI +    
Sbjct: 62  PRSGLALRHGITLVNSPGTIDADYRGEIGIIMINLS-NTPFTIADGERICQLVIARHEQA 120

Query: 125 XXXXXXXXXXTVRGDQGYGSTGK 147
                     T RG  G+G TGK
Sbjct: 121 EWVLTDELADTERGAGGFGHTGK 143


>DUT_CLONN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 142

 Score =  106 bits (265), Expect = 1e-25
 Identities = 68/138 (49%), Positives = 96/138 (69%), Gaps = 1/138 (0%)

Query: 9   IVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSG 68
           + + +++  +P +AH GDAG+DL +  +  + P  R+++ TGI I LP  T   + PRSG
Sbjct: 5   VEKTNEKAIIPFQAHEGDAGMDLFSVEEITLKPMERKLIHTGIKIQLPKDTEAQIRPRSG 64

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXX 128
           LA + G++++N PGTID  YRGEI + LINL  E+   +  G +IAQ+VI+         
Sbjct: 65  LALKHGITVLNTPGTIDEGYRGEIGIILINLGSEE-FKVEEGMKIAQMVIKPXXXXXXXX 123

Query: 129 XXXXXXTVRGDQGYGSTG 146
                   RG+ G+GSTG
Sbjct: 124 XXXXXXXXRGENGFGSTG 141


>DUT_CLODI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 143

 Score =  106 bits (265), Expect = 1e-25
 Identities = 53/140 (37%), Positives = 84/140 (60%), Gaps = 1/140 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +K+ +L+ +  +P  AH+GDAG+DL++  + VI PG  +++ TGI I LP  T   V PR
Sbjct: 4   LKVKKLNDDAIIPNFAHKGDAGMDLYSIEEVVIPPGETKLIKTGICIELPTMTEAQVRPR 63

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA +  ++++N PGTID  YRGE+K+ LIN   +    + +  +IAQ++++       
Sbjct: 64  SGLALKHSVTVLNTPGTIDEGYRGELKIILIN-HGKNDFKVEKHMKIAQMIVKPIYDINI 122

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   + RG  G+GSTG
Sbjct: 123 EEVKELSDSERGKGGFGSTG 142


>DUT_CLOD6 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 143

 Score =  106 bits (265), Expect = 1e-25
 Identities = 53/140 (37%), Positives = 84/140 (60%), Gaps = 1/140 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +K+ +L+ +  +P  AH+GDAG+DL++  + VI PG  +++ TGI I LP  T   V PR
Sbjct: 4   LKVKKLNDDAIIPNFAHKGDAGMDLYSIEEVVIPPGETKLIKTGICIELPTMTEAQVRPR 63

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA +  ++++N PGTID  YRGE+K+ LIN   +    + +  +IAQ++++       
Sbjct: 64  SGLALKHSVTVLNTPGTIDEGYRGELKIILIN-HGKNDFKVEKHMKIAQMIVKPIYDINI 122

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   + RG  G+GSTG
Sbjct: 123 EEVKELSDSERGKGGFGSTG 142


>DUT_RICM5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  106 bits (264), Expect = 1e-25
 Identities = 64/146 (43%), Positives = 86/146 (58%), Gaps = 4/146 (2%)

Query: 4   LAPIKIVRLDK-ELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV 60
           +  +KI +L+     LP+ A    AG+DL A  +    I  G  +++ TGIAIALP    
Sbjct: 3   ITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAGAIQLIPTGIAIALPDSFE 62

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLA + G+++ N+PGTIDADYRGEIKV LINL  E   +I +G RIAQ++I K
Sbjct: 63  AQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAK 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T+RG  G+GSTG
Sbjct: 122 YERILWEESSSLMETMRGSGGFGSTG 147


>DUT_AGRRK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 156

 Score =  106 bits (264), Expect = 1e-25
 Identities = 64/152 (42%), Positives = 87/152 (57%), Gaps = 8/152 (5%)

Query: 2   TDLAP-IKIVRL--DKELPLPKRAHRGDAGVDLHAT----TDAVIAPGHREIVGTGIAIA 54
           TD  P + ++RL   + L LP    +G AG+DL A     T   +APG R +V +G    
Sbjct: 5   TDTRPTLNLIRLAHGRGLDLPAYETKGAAGMDLRAAIEDGTTLTLAPGKRALVPSGFIFE 64

Query: 55  LPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           +P G    + PRSGLA + G++ +N+PGT+D+DYRGE+KV LIN   ++P  ITRG RIA
Sbjct: 65  IPEGFEAQIRPRSGLAFKNGITCLNSPGTVDSDYRGEVKVLLIN-HGDEPFEITRGMRIA 123

Query: 115 QLVIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           Q+VI                T RG  G+GSTG
Sbjct: 124 QVVIAPVTQVRVAEITEVSDTARGAGGFGSTG 155


>DUT_RICCK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  105 bits (263), Expect = 2e-25
 Identities = 62/131 (47%), Positives = 79/131 (60%), Gaps = 3/131 (2%)

Query: 18  LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           LPK A    AG+DL A      +I  G  +++ TGIAIALP      + PRSGLA + G+
Sbjct: 18  LPKYATEHSAGMDLIAANKQPIIIKIGEIQLIPTGIAIALPDLFEAQIRPRSGLAVKHGI 77

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
           ++ N+PGTID+DYRGEIKV LINL  E   +I +G RIAQ++I K              T
Sbjct: 78  TVANSPGTIDSDYRGEIKVILINLGKE-DFIIEKGMRIAQMIISKYERILWKESNTLEET 136

Query: 136 VRGDQGYGSTG 146
           VRG  G+GSTG
Sbjct: 137 VRGSGGFGSTG 147


>DUT_RHOCS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score =  105 bits (263), Expect = 2e-25
 Identities = 62/124 (50%), Positives = 82/124 (66%), Gaps = 6/124 (4%)

Query: 1   MTDLAPIKIVRLDK--ELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALP 56
           MTDL+ I + RL    +LPLP  A    AG+DL A      ++APG R ++ TG+AIALP
Sbjct: 1   MTDLS-IAVTRLPHGADLPLPAYATEHAAGMDLLAAVAEPVILAPGERRLIPTGLAIALP 59

Query: 57  LGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQL 116
            G    V PRSGLA + G++++N+PGTIDADYRGE+ V L NL  + P  + RG RIAQ+
Sbjct: 60  DGYEAQVRPRSGLALKHGITLLNSPGTIDADYRGEVGVILANLGAD-PFTVERGMRIAQM 118

Query: 117 VIQK 120
           VI +
Sbjct: 119 VIAR 122


>DUT_CLOAB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score =  105 bits (263), Expect = 2e-25
 Identities = 71/140 (50%), Positives = 95/140 (67%), Gaps = 1/140 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +KI ++D    LP+ AH GDAG+DL +  + VI  G   ++GTGI + LP  T   V PR
Sbjct: 4   LKIKKIDDAAILPECAHEGDAGLDLFSVEEKVIKAGESALIGTGIQMELPPETEAQVRPR 63

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA +  ++++N+PGTID  YRGE+K+ LIN   E    + +  +IAQ+VI+       
Sbjct: 64  SGLALKHSITVLNSPGTIDEGYRGEVKIILINHGKE-DFKVEKSMKIAQMVIKPXXXXXX 122

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                     RG  G+GSTG
Sbjct: 123 XXXXXXXXXDRGTGGFGSTG 142


>DUT_CHLP8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score =  105 bits (263), Expect = 2e-25
 Identities = 62/142 (43%), Positives = 81/142 (57%), Gaps = 3/142 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVH 64
           +KIVRL ++  LP  A    AG+D+ A  DA +   P    ++ TG+AI LP G    + 
Sbjct: 4   VKIVRLKEKASLPAYATAHAAGMDVSACLDAPVTLEPSSSALIPTGLAIELPEGYEAQLR 63

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA R  +S+ N+P TIDADYRGE+ V LIN   E P  +  GDRIAQ+V+ K    
Sbjct: 64  PRSGLALRHLISLPNSPATIDADYRGEVGVILINHGRE-PFTVNHGDRIAQMVVSKVDRV 122

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RG+ G+G TG
Sbjct: 123 AFEEVDSLSDTERGEGGFGHTG 144


>DUT_RHIE6 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 156

 Score =  105 bits (262), Expect = 3e-25
 Identities = 62/146 (42%), Positives = 83/146 (56%), Gaps = 7/146 (4%)

Query: 7   IKIVRL--DKELPLPKRAHRGDAGVDLHATTDA----VIAPGHREIVGTGIAIALPLGTV 60
           + ++RL   + L LP    +G AG+DL A  D      + PG R +V TG    +P G  
Sbjct: 11  LNLIRLANGEGLELPAYESQGAAGMDLRAAVDGDAPLTLPPGKRALVPTGFIFEIPEGFE 70

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           G V PRSGLA + G++ +N+PGT+D+DYRGE+KV L NL  E+  +I RG RIAQ+VI  
Sbjct: 71  GQVRPRSGLAFKHGITCLNSPGTVDSDYRGEVKVLLANLG-EEAFVIERGMRIAQMVIAP 129

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T RG  G+GSTG
Sbjct: 130 VTQARVAEITAASETARGAGGFGSTG 155


>DUT_PROVI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  105 bits (262), Expect = 3e-25
 Identities = 72/142 (50%), Positives = 92/142 (64%), Gaps = 3/142 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +KIVRL+K+  LP  A    AG+D+ A  +   V+ P    ++  G AI LP+G    + 
Sbjct: 4   VKIVRLNKQAFLPVYATAHAAGMDVSACLEEPVVVEPFSTALIPAGFAIELPIGYEMQLR 63

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA R  +++ N+P TIDADYRGE+KV LIN  P+ P  +  GDRIAQ+        
Sbjct: 64  PRSGLALRSMITLANSPATIDADYRGEVKVILINHGPQ-PFTVNNGDRIAQMXXXXXXXX 122

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     TVRGD G+G TG
Sbjct: 123 XXXXXXXLGETVRGDGGFGHTG 144


>DUT_HELHP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 158

 Score =  105 bits (262), Expect = 3e-25
 Identities = 58/120 (48%), Positives = 74/120 (61%), Gaps = 1/120 (0%)

Query: 27  AGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDA 86
           AG DLHA  D++I    R +VGTG+A  +  G    V PRSGLA   G+S++N PGTID+
Sbjct: 27  AGFDLHAVEDSLIKARDRGLVGTGLAFEIESGFEVQVRPRSGLALHNGVSVLNTPGTIDS 86

Query: 87  DYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           DYRGEIKV LIN   E    I RGDRIAQ V+ +              +VRG++G+GS+G
Sbjct: 87  DYRGEIKVILINHSNE-DFHIHRGDRIAQAVVSEVTQAVFTEVQELGQSVRGERGFGSSG 145


>DUT_FLAJ1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score =  105 bits (262), Expect = 3e-25
 Identities = 60/131 (45%), Positives = 79/131 (60%), Gaps = 3/131 (2%)

Query: 18  LPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           LP       AG+DL A       + P  R IV TG+ I LP+G    V PRSGLAA++G+
Sbjct: 13  LPNYETIASAGMDLRANIIEPITLKPLERTIVKTGLFIELPIGYEAQVRPRSGLAAKKGV 72

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
           +++N+PGT+DADYRGEI V L+NL  E+  +I  G+RIAQL+I K              T
Sbjct: 73  TVLNSPGTVDADYRGEIGVILVNLSNEE-FVIENGERIAQLIIAKHERAEWIEVEELSET 131

Query: 136 VRGDQGYGSTG 146
            RG+ G+GSTG
Sbjct: 132 SRGEGGFGSTG 142


>DUT_RHILW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 156

 Score =  105 bits (261), Expect = 3e-25
 Identities = 64/151 (42%), Positives = 84/151 (55%), Gaps = 8/151 (5%)

Query: 3   DLAP-IKIVRL--DKELPLPKRAHRGDAGVDLHATTDAV----IAPGHREIVGTGIAIAL 55
           DL P + ++RL   + L LP    +G AG+DL A  D      + PG R +V TG    +
Sbjct: 6   DLRPTLNLIRLANGEGLDLPAYESKGAAGMDLRAAVDEAAPLTLQPGKRALVPTGFIFEI 65

Query: 56  PLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
           P G  G V PRSGLA + G++ +N+PGT+D+DYRGE+KV L NL  E    + RG RIAQ
Sbjct: 66  PEGFEGQVRPRSGLAFKHGITCLNSPGTVDSDYRGEVKVLLANLGDE-AFTVERGMRIAQ 124

Query: 116 LVIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           +VI                T RG  G+GSTG
Sbjct: 125 MVIAPVTQMRVAESAAASETTRGAGGFGSTG 155


>DUT_DESPS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score =  104 bits (260), Expect = 4e-25
 Identities = 64/138 (46%), Positives = 79/138 (57%), Gaps = 3/138 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSG 68
           R  + L LP     G AG+D+ A  DA   I PG   ++ TG A+A+P G    V PRSG
Sbjct: 13  RETETLSLPAYETEGAAGMDVAACLDADCTIEPGDIVLIPTGFALAIPTGYEIQVRPRSG 72

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXX 128
           LA + GL++VNAPGTIDADYRGE+ V LINL   + + I  GDRIAQLV+          
Sbjct: 73  LAIKHGLTVVNAPGTIDADYRGEVGVGLINLG-RQAVTIHHGDRIAQLVLAPVLQARWTV 131

Query: 129 XXXXXXTVRGDQGYGSTG 146
                 T RG  G+G TG
Sbjct: 132 VTELEATERGAGGFGHTG 149


>DUT_PARL1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score =  104 bits (259), Expect = 6e-25
 Identities = 60/124 (48%), Positives = 79/124 (63%), Gaps = 7/124 (5%)

Query: 1   MTDLAPIKIVRLDKE--LPLPKRAHRGDAGVDLHATTDA----VIAPGHREIVGTGIAIA 54
           M  L  +++ RL     LPLP+    G AG+DL A        V+APG R +V TG+AIA
Sbjct: 1   MNPLIDVRVQRLPHSDGLPLPRYETSGAAGMDLIAALPEGEPMVLAPGERAMVPTGLAIA 60

Query: 55  LPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
           LP G    V PRSGLAA+ G++++N+PGT+D DYRGE+KV LIN   +    I RG RIA
Sbjct: 61  LPQGFEAQVRPRSGLAAKNGVTVLNSPGTVDCDYRGEVKVILINHGAD-AFTIERGTRIA 119

Query: 115 QLVI 118
           Q+V+
Sbjct: 120 QMVV 123


>DUT_DEBHA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 160

 Score =  104 bits (259), Expect = 6e-25
 Identities = 61/143 (42%), Positives = 84/143 (58%), Gaps = 5/143 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +++    +   LP R     AG D++A+ +AVI    + +VGT I++A+P+GT G V PR
Sbjct: 20  LRVFLRSENATLPTRGSVLSAGYDIYASEEAVIPAQGQGLVGTDISVAVPIGTYGRVAPR 79

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK--XXXX 124
           SGLA + G+S     G IDADYRGE+KV L N   +K   I +GDRIAQLV++K      
Sbjct: 80  SGLAVKHGIS--TGAGVIDADYRGEVKVVLFN-HAQKDFTIQKGDRIAQLVLEKIVMADI 136

Query: 125 XXXXXXXXXXTVRGDQGYGSTGK 147
                     T RG+ G+GSTGK
Sbjct: 137 KQITAEELDITARGEGGFGSTGK 159


>DUT_CAUCR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score =  104 bits (259), Expect = 6e-25
 Identities = 64/136 (47%), Positives = 81/136 (59%), Gaps = 5/136 (3%)

Query: 15  ELPLPKRAHRGDAGVDL--HATTDA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA 70
           +LP+P  A  G AG DL  H   DA  V+ PG R +  TG ++A+P G    V PRSGLA
Sbjct: 20  DLPVPAYATVGAAGFDLRAHVPDDAPIVLKPGARCMAPTGFSVAIPDGYEMQVRPRSGLA 79

Query: 71  AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXX 130
            + G+++VNAPGT+D+DYRG++ V LINL  E+   I RGDRIAQ VI            
Sbjct: 80  LKNGVTVVNAPGTVDSDYRGQVCVLLINLG-EEDFTIRRGDRIAQGVIAAAPQWPLVEVE 138

Query: 131 XXXXTVRGDQGYGSTG 146
               T RG  G+GSTG
Sbjct: 139 DLDATERGAGGFGSTG 154


>DUT_CAUCN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score =  104 bits (259), Expect = 6e-25
 Identities = 64/136 (47%), Positives = 81/136 (59%), Gaps = 5/136 (3%)

Query: 15  ELPLPKRAHRGDAGVDL--HATTDA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLA 70
           +LP+P  A  G AG DL  H   DA  V+ PG R +  TG ++A+P G    V PRSGLA
Sbjct: 20  DLPVPAYATVGAAGFDLRAHVPDDAPIVLKPGARCMAPTGFSVAIPDGYEMQVRPRSGLA 79

Query: 71  AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXX 130
            + G+++VNAPGT+D+DYRG++ V LINL  E+   I RGDRIAQ VI            
Sbjct: 80  LKNGVTVVNAPGTVDSDYRGQVCVLLINLG-EEDFTIRRGDRIAQGVIAAAPQWPLVEVE 138

Query: 131 XXXXTVRGDQGYGSTG 146
               T RG  G+GSTG
Sbjct: 139 DLDATERGAGGFGSTG 154


>DUT_RICRS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  103 bits (258), Expect = 7e-25
 Identities = 63/146 (43%), Positives = 85/146 (58%), Gaps = 4/146 (2%)

Query: 4   LAPIKIVRLDK-ELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV 60
           +  +KI +L+     LP+ A    AG+DL A  +    I     +++ TGIAIALP    
Sbjct: 3   ITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAAAIQLIPTGIAIALPDSFE 62

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLA + G+++ N+PGTIDADYRGEIKV LINL  E   +I +G RIAQ++I K
Sbjct: 63  AQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAK 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T+RG  G+GSTG
Sbjct: 122 YERILWEESISLMETMRGSGGFGSTG 147


>DUT_RICRO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  103 bits (258), Expect = 7e-25
 Identities = 63/146 (43%), Positives = 85/146 (58%), Gaps = 4/146 (2%)

Query: 4   LAPIKIVRLDK-ELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV 60
           +  +KI +L+     LP+ A    AG+DL A  +    I     +++ TGIAIALP    
Sbjct: 3   ITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAAAIQLIPTGIAIALPDSFE 62

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLA + G+++ N+PGTIDADYRGEIKV LINL  E   +I +G RIAQ++I K
Sbjct: 63  AQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAK 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T+RG  G+GSTG
Sbjct: 122 YERILWEESISLMETMRGSGGFGSTG 147


>DUT_RICCN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  103 bits (258), Expect = 7e-25
 Identities = 63/146 (43%), Positives = 85/146 (58%), Gaps = 4/146 (2%)

Query: 4   LAPIKIVRLDK-ELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV 60
           +  +KI +L+     LP+ A    AG+DL A  +    I     +++ TGIAIALP    
Sbjct: 3   ITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAAAIQLIPTGIAIALPDSFE 62

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLA + G+++ N+PGTIDADYRGEIKV LINL  E   +I +G RIAQ++I K
Sbjct: 63  AQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAK 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T+RG  G+GSTG
Sbjct: 122 YERILWEESSSLMETMRGSGGFGSTG 147


>DUT_RICAE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  103 bits (258), Expect = 7e-25
 Identities = 63/146 (43%), Positives = 85/146 (58%), Gaps = 4/146 (2%)

Query: 4   LAPIKIVRLDK-ELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV 60
           +  +KI +L+     LP+ A    AG+DL A  +    I     +++ TGIAIALP    
Sbjct: 3   ITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAAAIQLIPTGIAIALPDSFE 62

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLA + G+++ N+PGTIDADYRGEIKV LINL  E   +I +G RIAQ++I K
Sbjct: 63  AQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAK 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T+RG  G+GSTG
Sbjct: 122 YERILWEESSSLMETMRGSGGFGSTG 147


>DUT_GLOVI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  103 bits (258), Expect = 7e-25
 Identities = 60/114 (52%), Positives = 72/114 (63%), Gaps = 3/114 (2%)

Query: 3   DLAPIKIVRLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALPLGTV 60
           D   + I RL     LP  AH GDAG+DL A       IAPG    V TGIA+ LP G +
Sbjct: 2   DPVRVAIQRLAHCFALPTCAHPGDAGLDLFAAHAVPLSIAPGRFTRVPTGIALGLPAGYM 61

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIA 114
             V PRSGLAAR G+S++N PG ID  YRGEI+V LIN   E P++++RGDRIA
Sbjct: 62  AFVQPRSGLAARHGISVLNTPGLIDCGYRGEIQVLLIN-HGEVPVVVSRGDRIA 114


>DUT_BACV8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score =  103 bits (257), Expect = 1e-24
 Identities = 61/143 (42%), Positives = 84/143 (58%), Gaps = 4/143 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVH 64
           I+++   K   LP+ A    AG+D+ A  D   V+ P  R +V TG+ IALP G    + 
Sbjct: 3   IQVINKSKHA-LPEYATGQSAGMDIRANLDEPIVLKPLQRCLVPTGLYIALPEGFEAQIR 61

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA ++G+ ++N+PGTIDADYRGEI + L+NL  E   MI  G+RIAQ+V+ +    
Sbjct: 62  PRSGLAIKKGIGVLNSPGTIDADYRGEICIILVNLSSE-DFMIEDGERIAQMVVARHEHA 120

Query: 125 XXXXXXXXXXTVRGDQGYGSTGK 147
                     T RG  G+G TGK
Sbjct: 121 EWQEVEVLDETERGAGGFGHTGK 143


>DUT_CHLTE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  103 bits (256), Expect = 1e-24
 Identities = 62/145 (42%), Positives = 82/145 (56%), Gaps = 3/145 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVH 64
           +KIVRL+++  LP  A    AG+D+ A  DA   +      ++ TG AI LP G    + 
Sbjct: 4   VKIVRLNQKAILPVYATAHAAGMDVSACLDAPVTVPSSASALIPTGFAIELPEGYEAQLR 63

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA R  +S+ N+P TIDADYRGE+ V LIN   E P  ++ GDRIAQ+V+ K    
Sbjct: 64  PRSGLALRHCISLPNSPATIDADYRGEVGVILINHGRE-PFTVSHGDRIAQMVVAKVDHV 122

Query: 125 XXXXXXXXXXTVRGDQGYGSTGKTA 149
                     T RG+ G+G TG  A
Sbjct: 123 VFEEVESLSETARGEGGFGHTGVQA 147


>DUT_CHLCH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score =  103 bits (256), Expect = 1e-24
 Identities = 61/142 (42%), Positives = 78/142 (54%), Gaps = 3/142 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH 64
           IKIVRL               G+D+ A  +A +  AP    ++ TG A+ LP+G    + 
Sbjct: 4   IKIVRLXXXXXXXXXXXXXXXGMDVAACLEAPVSVAPFSTALIPTGFALELPIGYEAQLR 63

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA R  +S+ N P TIDADYRGE+KV LIN   E P M+  GDRIAQ+VI +    
Sbjct: 64  PRSGLALRSMISLPNTPATIDADYRGEVKVILINYGKE-PFMVQHGDRIAQMVIARVEQV 122

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     TVRG+ G+G TG
Sbjct: 123 QFEEVAELSATVRGEGGFGHTG 144


>DUT_NAUPA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 142

 Score =  102 bits (255), Expect = 2e-24
 Identities = 67/141 (47%), Positives = 90/141 (63%), Gaps = 1/141 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +KI +L++E  +P    +  AG DLH+  D +I PG R+++GTG+A  +  G    + PR
Sbjct: 3   LKIKKLNQEALIPAYQTKEAAGFDLHSIEDVIIKPGERKLIGTGLAFEIEFGYEVQIRPR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA + G++++N PGTID+DYRGEIKV LIN   E    I + +R              
Sbjct: 63  SGLAFKHGITVLNTPGTIDSDYRGEIKVLLINHSNE-AFEIKKEERXXXXXXXXXXXXXX 121

Query: 127 XXXXXXXXTVRGDQGYGSTGK 147
                   T RG  G+GSTGK
Sbjct: 122 XXXXXLSDTERGAGGFGSTGK 142


>DUT_CYAP7 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score =  102 bits (255), Expect = 2e-24
 Identities = 53/112 (47%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +K+ +L+K   LPK  H  D+G+DL A  D  I PG  ++V TGIAI LP  T   + PR
Sbjct: 3   LKVTKLEKAAILPKYVHSDDSGLDLSAIEDLEIPPGESQLVPTGIAIELPPNTEAQIRPR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           SGLA +  ++++N PGT+D  YRGEI V LIN   +    +TRG +IAQ+VI
Sbjct: 63  SGLALKHQITVLNTPGTVDEGYRGEIGVILIN-HGKNSFKVTRGMKIAQMVI 113


>DUT_ALKMQ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score =  102 bits (255), Expect = 2e-24
 Identities = 58/140 (41%), Positives = 80/140 (57%), Gaps = 1/140 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           IKI R++    LP+ AH GDAG+DL +  + VI PG   ++ TGI I LP  T   + PR
Sbjct: 4   IKIKRINNLAKLPEYAHDGDAGMDLFSIEEKVIDPGGVALIHTGIKIELPEKTEAQIRPR 63

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA +  ++++N PGTID  YRGEI V LIN   E    + +  ++AQ+VI+       
Sbjct: 64  SGLALKNSITVLNTPGTIDEGYRGEIGVILINHGKES-FKVEKHMKVAQMVIKPVLKVKI 122

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   T R + G+GSTG
Sbjct: 123 LEVDELSDTQRAEGGFGSTG 142


>DUT_RHOSK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score =  102 bits (254), Expect = 2e-24
 Identities = 61/150 (40%), Positives = 81/150 (54%), Gaps = 11/150 (7%)

Query: 7   IKIVR---LDKELPLPKRAHRGDAGVDLHATTDA-------VIAPGHREIVGTGIAIALP 56
           ++++R    D  LPLP     G AG DL A           V+AP  R +V TG+ I +P
Sbjct: 5   VRVIREDWADAALPLPSYETAGAAGADLRANLPPESRAEGLVLAPLGRVLVPTGLRIEIP 64

Query: 57  LGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQL 116
            G    + PRSGLA + G+S+ N+PGTID+DYRG + V L+NL  E P  +  GDRIAQ+
Sbjct: 65  EGFEVQIRPRSGLALKHGISLPNSPGTIDSDYRGPLGVILVNLGAE-PFRVAHGDRIAQM 123

Query: 117 VIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           V+                T RG  G+GSTG
Sbjct: 124 VVAPVVQAGFELVEGLGATARGAGGFGSTG 153


>DUT_FINM2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 143

 Score =  102 bits (254), Expect = 2e-24
 Identities = 57/142 (40%), Positives = 84/142 (59%), Gaps = 4/142 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +KI+      PLPK +  G +G+DL A T  D  + P  R ++ TGI I++P G    + 
Sbjct: 3   VKIINKSNN-PLPKYSTIGSSGMDLRAYTENDITLKPLERTLIPTGIYISIPEGYEIQIR 61

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ + G++++N  GTID+DYRGEIK+ ++NL  E+   I+ GDRI Q+++QK    
Sbjct: 62  PRSGLSIKHGITLINCVGTIDSDYRGEIKIPVVNLSNEE-YTISTGDRICQMILQKYENI 120

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T R D G+G TG
Sbjct: 121 EFAEVEVLDETDRNDGGFGHTG 142


>DUT_CHLL2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score =  102 bits (254), Expect = 2e-24
 Identities = 58/145 (40%), Positives = 84/145 (57%), Gaps = 3/145 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +KIVR++K+  LP  A    AG+D+ A  D   ++ P    ++ +G AI LP G    + 
Sbjct: 4   VKIVRVNKKAHLPVYATAHAAGMDVAACLDEPVMLEPFSTALIPSGFAIELPEGYEAQLR 63

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA +  +S+ N+P TIDADYRGE++V L+N   E P  +  GDRIAQ+V+ +    
Sbjct: 64  PRSGLALKHLISLPNSPATIDADYRGEVRVILVNFGKE-PFSVAHGDRIAQMVVSRVERV 122

Query: 125 XXXXXXXXXXTVRGDQGYGSTGKTA 149
                     T RG+ G+G TG +A
Sbjct: 123 DFDEAEELSMTQRGEGGFGHTGISA 147


>DUT_RICPU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  101 bits (252), Expect = 4e-24
 Identities = 62/145 (42%), Positives = 84/145 (57%), Gaps = 4/145 (2%)

Query: 4   LAPIKIVRLDK-ELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV 60
           +  +KI +L+     LP+ A    AG+DL A  +    I     +++ TGIAIALP    
Sbjct: 3   ITQVKIKKLENFSGSLPEYATEHSAGMDLIAANEQPITIKAAAIQLIPTGIAIALPDSFE 62

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLA + G+++ N+PGTIDADYRGEIKV LINL  E   +I +G RIAQ++I K
Sbjct: 63  AQIRPRSGLAVKHGITVANSPGTIDADYRGEIKVILINLGKE-DFIIEKGMRIAQMIIAK 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGST 145
                         T+RG  G+GST
Sbjct: 122 YERILWEESISLMETMRGSGGFGST 146


>DUT_GEOSL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score =  101 bits (252), Expect = 4e-24
 Identities = 58/146 (39%), Positives = 78/146 (53%), Gaps = 3/146 (2%)

Query: 4   LAPIKIVRLDKELPLPK--RAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVG 61
           L  I+ +R   +LPLP+    H                 PG R +V TGIAIALP G   
Sbjct: 5   LVKIRRIRSGSDLPLPRYMTPHAAGMXXXXXXXXXXXXEPGERALVPTGIAIALPDGFEA 64

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
            + PRSGLA + G+++VN+PGTID DYRGEI V ++N   +   ++ RG+RIAQ+V    
Sbjct: 65  QIRPRSGLALKHGIALVNSPGTIDPDYRGEIGVIIVNHGAD-AFVVRRGERIAQMVFAPF 123

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGK 147
                        T RGD G+G TG+
Sbjct: 124 VRAELLDVDELDETARGDGGFGHTGR 149


>DUT_CYTH3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score =  101 bits (252), Expect = 4e-24
 Identities = 63/143 (44%), Positives = 82/143 (57%), Gaps = 4/143 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +KIV       LP       AG+DL A  T   V+ P  R++V TG+ I LP  T   + 
Sbjct: 14  VKIVNKSNNA-LPAYQTAQAAGMDLSAYITEAIVLQPLQRQLVPTGLFIELPEHTEAQIR 72

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA + G++++N+PGTIDADYRGEIKV L+NL  E    I  G+RIAQ+VI K    
Sbjct: 73  PRSGLAFKHGITVLNSPGTIDADYRGEIKVLLVNLSNE-AFTIQSGERIAQIVIAKVEHA 131

Query: 125 XXXXXXXXXXTVRGDQGYGSTGK 147
                     ++R   G+GSTGK
Sbjct: 132 HFVEVEELSDSLRAAAGFGSTGK 154


>DUT_CHLPB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score =  101 bits (252), Expect = 4e-24
 Identities = 58/145 (40%), Positives = 83/145 (57%), Gaps = 3/145 (2%)

Query: 4   LAPIKIVRLDKELPLPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVG 61
           +  + +VR++++  LP  A    AG+DL A  D    +AP    ++ TG+AI LP G   
Sbjct: 1   MVKVPVVRVNEKAILPHYATFQAAGMDLAACLDEPVTLAPFSTALIPTGLAIELPPGYEA 60

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
            + PRSGLA +  +S+ NAP TIDADYRGE+ V L+N   + P ++  GDRIAQ+V+ + 
Sbjct: 61  QLRPRSGLALKHMISLPNAPATIDADYRGEVMVILVNYG-KTPFIVCHGDRIAQMVVARY 119

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTG 146
                        T RGD G+G TG
Sbjct: 120 EHVRLEEVKALSETDRGDGGFGHTG 144


>DUT_BRUSU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score =  101 bits (252), Expect = 4e-24
 Identities = 62/144 (43%), Positives = 79/144 (54%), Gaps = 7/144 (4%)

Query: 9   IVRLD--KELPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALPLGTVGL 62
           I+RL+  K L LP     G AG+DL A        V+ PG R +V TG+ + +P G    
Sbjct: 13  IIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQ 72

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA + G++ +N PGTID+DYRGE+KV LINL  +    I RG RIAQ V     
Sbjct: 73  IRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVI 131

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG  G+GSTG
Sbjct: 132 QPKIEERAKISETARGAGGFGSTG 155


>DUT_BRUSI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score =  101 bits (252), Expect = 4e-24
 Identities = 62/144 (43%), Positives = 79/144 (54%), Gaps = 7/144 (4%)

Query: 9   IVRLD--KELPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALPLGTVGL 62
           I+RL+  K L LP     G AG+DL A        V+ PG R +V TG+ + +P G    
Sbjct: 13  IIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQ 72

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA + G++ +N PGTID+DYRGE+KV LINL  +    I RG RIAQ V     
Sbjct: 73  IRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVI 131

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG  G+GSTG
Sbjct: 132 QPKIEERAKISETARGAGGFGSTG 155


>DUT_BRUME RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score =  101 bits (252), Expect = 4e-24
 Identities = 62/144 (43%), Positives = 79/144 (54%), Gaps = 7/144 (4%)

Query: 9   IVRLD--KELPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALPLGTVGL 62
           I+RL+  K L LP     G AG+DL A        V+ PG R +V TG+ + +P G    
Sbjct: 13  IIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQ 72

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA + G++ +N PGTID+DYRGE+KV LINL  +    I RG RIAQ V     
Sbjct: 73  IRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVI 131

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG  G+GSTG
Sbjct: 132 QPKIEERAKISETARGAGGFGSTG 155


>DUT_BRUMB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score =  101 bits (252), Expect = 4e-24
 Identities = 62/144 (43%), Positives = 79/144 (54%), Gaps = 7/144 (4%)

Query: 9   IVRLD--KELPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALPLGTVGL 62
           I+RL+  K L LP     G AG+DL A        V+ PG R +V TG+ + +P G    
Sbjct: 13  IIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQ 72

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA + G++ +N PGTID+DYRGE+KV LINL  +    I RG RIAQ V     
Sbjct: 73  IRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVI 131

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG  G+GSTG
Sbjct: 132 QPKIEERAKISETARGAGGFGSTG 155


>DUT_BRUC2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score =  101 bits (252), Expect = 4e-24
 Identities = 62/144 (43%), Positives = 79/144 (54%), Gaps = 7/144 (4%)

Query: 9   IVRLD--KELPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALPLGTVGL 62
           I+RL+  K L LP     G AG+DL A        V+ PG R +V TG+ + +P G    
Sbjct: 13  IIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQ 72

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA + G++ +N PGTID+DYRGE+KV LINL  +    I RG RIAQ V     
Sbjct: 73  IRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVI 131

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG  G+GSTG
Sbjct: 132 QPKIEERAKISETARGAGGFGSTG 155


>DUT_BRUAB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score =  101 bits (252), Expect = 4e-24
 Identities = 62/144 (43%), Positives = 79/144 (54%), Gaps = 7/144 (4%)

Query: 9   IVRLD--KELPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALPLGTVGL 62
           I+RL+  K L LP     G AG+DL A        V+ PG R +V TG+ + +P G    
Sbjct: 13  IIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQ 72

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA + G++ +N PGTID+DYRGE+KV LINL  +    I RG RIAQ V     
Sbjct: 73  IRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVI 131

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG  G+GSTG
Sbjct: 132 QPKIEERAKISETARGAGGFGSTG 155


>DUT_BRUA2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score =  101 bits (252), Expect = 4e-24
 Identities = 62/144 (43%), Positives = 79/144 (54%), Gaps = 7/144 (4%)

Query: 9   IVRLD--KELPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALPLGTVGL 62
           I+RL+  K L LP     G AG+DL A        V+ PG R +V TG+ + +P G    
Sbjct: 13  IIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQ 72

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA + G++ +N PGTID+DYRGE+KV LINL  +    I RG RIAQ V     
Sbjct: 73  IRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVI 131

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG  G+GSTG
Sbjct: 132 QPKIEERAKISETARGAGGFGSTG 155


>DUT_BRUA1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score =  101 bits (252), Expect = 4e-24
 Identities = 62/144 (43%), Positives = 79/144 (54%), Gaps = 7/144 (4%)

Query: 9   IVRLD--KELPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALPLGTVGL 62
           I+RL+  K L LP     G AG+DL A        V+ PG R +V TG+ + +P G    
Sbjct: 13  IIRLEHAKGLDLPAYETAGSAGMDLRAAVAEDRQIVLLPGRRTLVPTGLILEIPQGYEVQ 72

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA + G++ +N PGTID+DYRGE+KV LINL  +    I RG RIAQ V     
Sbjct: 73  IRPRSGLAFKNGITCLNTPGTIDSDYRGEVKVLLINLG-DDDFRIERGMRIAQAVFAPVI 131

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG  G+GSTG
Sbjct: 132 QPKIEERAKISETARGAGGFGSTG 155


>DUT_RHOS4 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score =  101 bits (251), Expect = 5e-24
 Identities = 61/150 (40%), Positives = 81/150 (54%), Gaps = 11/150 (7%)

Query: 7   IKIVR---LDKELPLPKRAHRGDAGVDLHATTDA-------VIAPGHREIVGTGIAIALP 56
           ++++R    D  LPLP     G AG DL A           V+AP  R +V TG+ I +P
Sbjct: 5   VRVIREDWADTALPLPGYETAGAAGADLRANLPPESRAEGLVLAPLGRVLVPTGLRIEIP 64

Query: 57  LGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQL 116
            G    + PRSGLA + G+S+ N+PGTID+DYRG + V L+NL  E P  +  GDRIAQ+
Sbjct: 65  DGFEVQIRPRSGLALKHGISLPNSPGTIDSDYRGPLGVILVNLGDE-PFRVAHGDRIAQM 123

Query: 117 VIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           V+                T RG  G+GSTG
Sbjct: 124 VVAPVVQARFELADGLGATARGAGGFGSTG 153


>DUT_GEOMG RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  101 bits (251), Expect = 5e-24
 Identities = 56/135 (41%), Positives = 73/135 (54%), Gaps = 1/135 (0%)

Query: 13  DKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAR 72
           D+ LP     H                 PG R++V TG+AIALP G    + PRSGLA +
Sbjct: 15  DQNLPCYMTVHAAGMXXXXXXXXXXXXNPGERKLVPTGLAIALPDGFEAQIRPRSGLALK 74

Query: 73  EGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXX 132
            G+++VN+PGTID DYRGEI V LIN   E P ++ RG+RIAQ+V               
Sbjct: 75  HGIALVNSPGTIDPDYRGEIGVILINHGSE-PFVVRRGERIAQMVFAPFARAELVEVDEL 133

Query: 133 XXTVRGDQGYGSTGK 147
             T RG+ G+G TG+
Sbjct: 134 DETARGEGGFGHTGR 148


>DUT_BRAJA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  101 bits (251), Expect = 5e-24
 Identities = 74/136 (54%), Positives = 89/136 (65%), Gaps = 5/136 (3%)

Query: 16  LPLPKRAHRGDAGVDLHATT--DA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAA 71
           LPLP       AG+DL A    DA   +A G   +V TG+AIALP G    V PRSGLAA
Sbjct: 18  LPLPAYQTAEAAGLDLMAAVPEDAPLTLASGRYALVPTGLAIALPPGHEAQVRPRSGLAA 77

Query: 72  REGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXX 131
           + G++++N+PGTIDADYRGEIKV LIN       +I RG+RIAQ+               
Sbjct: 78  KHGVTVLNSPGTIDADYRGEIKVILIN-HGAAAFVIKRGERIAQMXXXXXXXXXXXXXXT 136

Query: 132 XXXTVRGDQGYGSTGK 147
              T RG  G+GSTG+
Sbjct: 137 LSATDRGAGGFGSTGR 152


>DUT_RHILO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 161

 Score =  100 bits (250), Expect = 6e-24
 Identities = 54/106 (50%), Positives = 70/106 (66%), Gaps = 5/106 (4%)

Query: 16  LPLPKRAHRGDAGVDLHATTD----AVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAA 71
           LPLP     G AG+DL A        +I PG R +V TG+ + +P G  G V PRSGLA 
Sbjct: 26  LPLPAYESTGAAGMDLRAAVPDDRPLLILPGKRSLVPTGLILEIPEGMEGQVRPRSGLAF 85

Query: 72  REGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLV 117
           + GL+++N+PGT+D+DYRGE+KV LINL  E    +TRG RIAQ+V
Sbjct: 86  KHGLTVLNSPGTVDSDYRGEVKVLLINLGDE-DFAVTRGMRIAQIV 130


>DUT_CHLPD RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score =  100 bits (250), Expect = 6e-24
 Identities = 58/142 (40%), Positives = 81/142 (57%), Gaps = 3/142 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +KIVRL+++  LP  A    AG+D+ A  +   V+ P    ++ +G AI LP G    + 
Sbjct: 4   VKIVRLNEKALLPVYATTHAAGMDVAACLEENVVVLPFETALIPSGFAIELPEGYEAQLR 63

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA R  +S+ N P TIDADYRGE+K+ LIN   E P ++  GDR+AQ+V+ K    
Sbjct: 64  PRSGLALRHLISLPNTPATIDADYRGEVKIILINYGQE-PFVVHHGDRVAQMVVAKVERV 122

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     + R D G+G TG
Sbjct: 123 FFDEVLTLASSSRADGGFGHTG 144


>DUT_SOLUE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score =  100 bits (249), Expect = 8e-24
 Identities = 57/143 (39%), Positives = 81/143 (56%), Gaps = 4/143 (2%)

Query: 7   IKIVRLDKELPLPKRAH--RGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           I+I R   +  LP  AH    DAG+DLHA  D  + PG   +V TG+ + +P G    V 
Sbjct: 7   IRIQRTHPQAILPTYAHGPAEDAGMDLHAVEDVTLEPGVARLVSTGLTLEVPPGFEAQVR 66

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA +  ++I NAPGTID  YRGE++V ++NL  +    +  GDRIAQ+++ +    
Sbjct: 67  PRSGLALKHAITIPNAPGTIDPGYRGEVRVIMLNLGRD-AYTVHAGDRIAQMIVTRYEAV 125

Query: 125 XXXXXXXXXXTVRGDQGYGSTGK 147
                     T RG  G+GS+G+
Sbjct: 126 EWLEGSLADST-RGAGGFGSSGR 147


>DUT_ORITI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score =  100 bits (249), Expect = 8e-24
 Identities = 56/141 (39%), Positives = 84/141 (59%), Gaps = 3/141 (2%)

Query: 8   KIVRLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALPLGTVGLVHP 65
           +I + +    LP  +  G AG+DL+A   +  +I P    +V  GIAI+LP G    +  
Sbjct: 7   QIYQFEGTSSLPAYSTNGSAGMDLYAAIASPMIIKPHETALVPAGIAISLPYGYEAQIRS 66

Query: 66  RSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXX 125
           RSGLA++ G+ ++N+PGTID+DYRGE+K+ +INL  +K   +T   RIAQ+VI K     
Sbjct: 67  RSGLASKFGVIVLNSPGTIDSDYRGELKIIMINLG-QKDFQLTPAMRIAQMVIAKYEVIS 125

Query: 126 XXXXXXXXXTVRGDQGYGSTG 146
                    T RG++G+GS+G
Sbjct: 126 WEIVDDLDETERGEKGFGSSG 146


>DUT_BEII9 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 160

 Score =  100 bits (249), Expect = 8e-24
 Identities = 55/115 (47%), Positives = 69/115 (60%), Gaps = 2/115 (1%)

Query: 32  HATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGE 91
           H TT  V+ PG R ++ TG  + +P G    V PRSGLA + G++++N PGTIDADYRGE
Sbjct: 43  HGTT-LVLEPGGRHLLPTGFCLEIPEGYEAQVRPRSGLARKHGVTVLNTPGTIDADYRGE 101

Query: 92  IKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           I V LIN+  E P  I RG RIAQLV+                T RG+ G+GSTG
Sbjct: 102 IGVILINMGDE-PFEIVRGTRIAQLVVAPCVQAELIETHTLSDTERGEDGFGSTG 155


>DUT_MARMM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score =  100 bits (248), Expect = 1e-23
 Identities = 60/119 (50%), Positives = 74/119 (62%), Gaps = 7/119 (5%)

Query: 6   PIKIVRLD--KELPLPKRAHRGDAGVDLHATTDA----VIAPGHREIVGTGIAIALPLGT 59
           P+KI  LD  + L LP       AG+DL A   A     I PG   ++  GIAIALP G 
Sbjct: 5   PVKIKPLDHYEGLALPAYETPQSAGMDLRAAVPADEPVSIPPGEWRLIPVGIAIALPAGF 64

Query: 60  VGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
              V PRSGLAA+ G+S VN PGT+DADYRGEI+V LIN   +   ++ RGDRIAQ++I
Sbjct: 65  EAQVRPRSGLAAKHGISCVNTPGTVDADYRGEIRVNLIN-HGQANFVVNRGDRIAQMII 122


>DUT_PELPB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 99.8 bits (247), Expect = 1e-23
 Identities = 55/116 (47%), Positives = 74/116 (63%), Gaps = 3/116 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVH 64
           +KIVRL+K+  LP  A    AG+D+ A  +A   I P    ++ +G A+ LP G    + 
Sbjct: 4   VKIVRLNKQASLPVYATAHAAGMDISACIEAPITIQPSTTALIPSGFALELPEGYEAQLR 63

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           PRSGLA R  +S+ N P TIDADYRGE+KV LIN   E P +++ GDRIAQ+V+ K
Sbjct: 64  PRSGLALRSMISLPNTPATIDADYRGEVKVILINYGKE-PFLVSHGDRIAQMVVAK 118


>DUT_AGRT5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 156

 Score = 99.8 bits (247), Expect = 1e-23
 Identities = 74/146 (50%), Positives = 94/146 (64%), Gaps = 7/146 (4%)

Query: 7   IKIVRLDK--ELPLPKRAHRGDAGVDLHATTDAV----IAPGHREIVGTGIAIALPLGTV 60
           +++VRL    +L LP    RG AG+DL A   A     + PG R +V TG    +P G  
Sbjct: 11  LRLVRLANGADLELPSYETRGAAGMDLRAAVPADEPLNLQPGERALVPTGFIFEVPQGYE 70

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             + PRSGLA + G++ +N+PGT+D+DYRGE+KV L NL  +    I RG RIAQ+VI  
Sbjct: 71  AQIRPRSGLAIKNGITCLNSPGTVDSDYRGEVKVILANLG-QDDFTIERGMRIAQMVIAP 129

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                           RG  G+GSTG
Sbjct: 130 XXXXXXXXXXXXXXXARGAGGFGSTG 155


>DUT_SYNP2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 142

 Score = 99.4 bits (246), Expect = 2e-23
 Identities = 49/112 (43%), Positives = 74/112 (66%), Gaps = 1/112 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +++++L     +PK  H GD+GVDLHA     IAP    ++ TG+A  +P+GT   + PR
Sbjct: 3   LRLLKLHPNAIIPKYQHEGDSGVDLHAIEPVAIAPHKTALIKTGLAAEIPIGTELQIRPR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           SGLA ++ ++++N+PGTIDA+YRGEI V LIN   +    +  G RIAQ+V+
Sbjct: 63  SGLALKQSVTVLNSPGTIDANYRGEIGVILIN-HSDTVFEVKAGMRIAQMVM 113


>DUT_ORITB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 99.0 bits (245), Expect = 2e-23
 Identities = 56/141 (39%), Positives = 82/141 (58%), Gaps = 3/141 (2%)

Query: 8   KIVRLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALPLGTVGLVHP 65
           +I + +    LP  +  G AG+DL+A   +  +I P    +V  GIAI+LP G    +  
Sbjct: 7   QIYQFEGASSLPAYSTNGSAGMDLYAAIASPMIIKPHETALVPAGIAISLPYGYEAQIRS 66

Query: 66  RSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXX 125
           RSGLA++ G+ ++N+PGTID+DYRGE+K+ +INL  +K   +T   RIAQ+VI K     
Sbjct: 67  RSGLASKFGVIVLNSPGTIDSDYRGELKIIMINLG-QKDFQLTPAMRIAQMVIAKYEVVS 125

Query: 126 XXXXXXXXXTVRGDQGYGSTG 146
                    T RG  G+GS+G
Sbjct: 126 WELVDDLDETERGKNGFGSSG 146


>DUT_BRASO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 99.0 bits (245), Expect = 2e-23
 Identities = 54/106 (50%), Positives = 67/106 (63%), Gaps = 1/106 (0%)

Query: 42  GHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDP 101
           G   +V TG++IALP G    V PRSGLAAR G++++N+PGTIDADYRGE+ V LIN   
Sbjct: 48  GSHAMVPTGLSIALPDGFEAQVRPRSGLAARHGVTVLNSPGTIDADYRGEVCVLLINHGK 107

Query: 102 EKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
           E P  I RG+RIAQ+VI                T RG  G+GSTG+
Sbjct: 108 E-PFTIQRGERIAQMVIASVVRAELAITTTLSETARGSGGFGSTGR 152


>DUT_AZOC5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score = 98.6 bits (244), Expect = 3e-23
 Identities = 63/146 (43%), Positives = 81/146 (55%), Gaps = 7/146 (4%)

Query: 7   IKIVRLDK--ELPLPKRAHRGDAGVDLHATTDAVIAP----GHREIVGTGIAIALPLGTV 60
           + +VRL    +LPLP+ A    AG+DL              G   +V TG+A+ LP G  
Sbjct: 8   VPVVRLPHGMDLPLPEYATAASAGMDLXXXXXXXXXXXXXXGAWALVPTGLALELPEGME 67

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
             V PRSGLA + G++++NAPGTIDADYRGE+ V LIN   E P  ++RG RIAQ+VI  
Sbjct: 68  AQVRPRSGLALKFGVTVLNAPGTIDADYRGEVGVILINHGRE-PFTVSRGMRIAQMVIAG 126

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T RG  G+GSTG
Sbjct: 127 VQQITLVETGNLGETARGVGGFGSTG 152


>DUT_RHOPB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 97.4 bits (241), Expect = 7e-23
 Identities = 51/102 (50%), Positives = 66/102 (64%), Gaps = 1/102 (0%)

Query: 46  IVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPI 105
           +V TG+ +ALP G    V PRSGLAAR G++++NAPGTIDADYRGEI V LIN    +P 
Sbjct: 52  LVPTGLTLALPPGYEAQVRPRSGLAARHGVTVLNAPGTIDADYRGEIGVLLIN-HGSQPF 110

Query: 106 MITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
            + RG+RIAQ+V+ +              T RG  G+GSTG+
Sbjct: 111 TVRRGERIAQMVVARVARVDLTVAASLETTERGSGGFGSTGR 152


>DUT_NITHX RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 97.4 bits (241), Expect = 7e-23
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 5/107 (4%)

Query: 16  LPLPKRAHRGDAGVDLHAT----TDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAA 71
           LPLP       AG+DL A     T  V+A G   +V TG+ IALP G    V PRSGLAA
Sbjct: 18  LPLPAYHSSQAAGLDLMAAVPEQTPLVLAAGQYAMVPTGLIIALPDGFEAQVRPRSGLAA 77

Query: 72  REGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + G++++N+PGT+DADYRGEI V L+NL    P  I RG+RIAQ+++
Sbjct: 78  KHGVTVLNSPGTVDADYRGEINVLLVNLG-NAPFTIRRGERIAQMIV 123


>DUT_BACTN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score = 97.1 bits (240), Expect = 9e-23
 Identities = 55/116 (47%), Positives = 76/116 (65%), Gaps = 4/116 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH 64
           ++++   K  PLP  A    AG+D+ A     I  AP  R +V TGI IALP G    V 
Sbjct: 3   VQVINKSKH-PLPAYATELSAGMDIRANLSEPITLAPLQRCLVPTGIYIALPQGFEAQVR 61

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           PRSGLA ++G++++N+PGTIDADYRGE+ + L+NL  E P +I  G+RIAQ+VI +
Sbjct: 62  PRSGLAIKKGITVLNSPGTIDADYRGEVCIILVNLSSE-PFVIEDGERIAQMVIAR 116


>DUT_SCHPO RecName: Full=Probable deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 140

 Score = 96.3 bits (238), Expect = 2e-22
 Identities = 55/139 (39%), Positives = 80/139 (57%), Gaps = 5/139 (3%)

Query: 9   IVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSG 68
           + +L ++  +P +     AG DL+A  + ++    + +V T +AIA+P GT G V PRSG
Sbjct: 5   VQKLSEKATIPTKGSANSAGYDLYAAAECIVPRRGKVLVDTDLAIAVPEGTYGRVAPRSG 64

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINL-DPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           LA++   SI    G IDADYRG ++V L N  D + PI +  GDRIAQL++++       
Sbjct: 65  LASKH--SIDTGAGVIDADYRGHVRVLLFNYSDVDFPIKV--GDRIAQLILERIVNPPVI 120

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  TVRG  G+GSTG
Sbjct: 121 LVESLEATVRGANGFGSTG 139


>DUT_CYAA5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 142

 Score = 96.3 bits (238), Expect = 2e-22
 Identities = 53/124 (42%), Positives = 71/124 (57%), Gaps = 1/124 (0%)

Query: 23  HRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPG 82
           H  D+G+DL +T    I  G  ++V TGI+I LP  T   + PRSGLA +  ++++N PG
Sbjct: 19  HDNDSGLDLVSTETVEIPSGESKLVKTGISIELPPNTEAQIRPRSGLALKHQITVLNTPG 78

Query: 83  TIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGY 142
           TID  YRGEI V LIN   ++   +T G RIAQ+VI                T+RG  G+
Sbjct: 79  TIDEGYRGEIGVILIN-HGKRSFKVTEGMRIAQMVIAPVIRVKIQEVEQLSDTIRGQGGF 137

Query: 143 GSTG 146
           GSTG
Sbjct: 138 GSTG 141


>DUT_SINMW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 160

 Score = 95.5 bits (236), Expect = 3e-22
 Identities = 56/123 (45%), Positives = 75/123 (60%), Gaps = 8/123 (6%)

Query: 3   DLAP-IKIVRLD--KELPLPKRAHRGDAGVDLHATTDA----VIAPGHREIVGTGIAIAL 55
           DL P + +VRL   + L LP     G AG+DL A   A     I PG R +V TG    +
Sbjct: 9   DLTPDLTLVRLSHGEGLDLPAYETAGAAGMDLRAAVPADEPMTIRPGARTLVPTGFVFEI 68

Query: 56  PLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
           P G  G + PRSGLA + G++ +N PGT+D+DYRGE+KV L+NL  +   ++ RG RIAQ
Sbjct: 69  PAGHEGQIRPRSGLAFKHGITCLNTPGTVDSDYRGEVKVLLVNLGSD-DFVVERGMRIAQ 127

Query: 116 LVI 118
           +VI
Sbjct: 128 MVI 130


>DUT_RHOPT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 95.5 bits (236), Expect = 3e-22
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 5/107 (4%)

Query: 16  LPLPKRAHRGDAGVDLHATT--DA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAA 71
           LPLP+      AG+DL A    DA   + PG   +V TG+ IALP      V PRSGLAA
Sbjct: 18  LPLPEYQTAHAAGLDLIAAVPQDAPLTLQPGRYVLVPTGLTIALPENYEAQVRPRSGLAA 77

Query: 72  REGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + G++++NAPGTIDADYRGEI V LIN   E P  I RG+RIAQ+VI
Sbjct: 78  KHGVTVLNAPGTIDADYRGEIGVLLINHGTE-PFAIRRGERIAQMVI 123


>DUT_RHOPA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 95.5 bits (236), Expect = 3e-22
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 5/107 (4%)

Query: 16  LPLPKRAHRGDAGVDLHATT--DA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAA 71
           LPLP+      AG+DL A    DA   + PG   +V TG+ IALP      V PRSGLAA
Sbjct: 18  LPLPEYQTAHAAGLDLIAAVPQDAPLTLQPGRYVLVPTGLTIALPENYEAQVRPRSGLAA 77

Query: 72  REGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + G++++NAPGTIDADYRGEI V LIN   E P  I RG+RIAQ+VI
Sbjct: 78  KHGVTVLNAPGTIDADYRGEIGVLLINHGTE-PFAIRRGERIAQMVI 123


>DUT_FUSNN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 146

 Score = 95.5 bits (236), Expect = 3e-22
 Identities = 55/143 (38%), Positives = 81/143 (56%), Gaps = 4/143 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHRE--IVGTGIAIALPLGTVGLVH 64
           +K++R ++ + LPK    G AG+D+ A     I     E  +V TG+ +A+P G    V 
Sbjct: 6   VKVIR-EEGVELPKYETEGSAGMDVRANIKESITLKSLERILVPTGLKVAIPEGYEIQVR 64

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGLA + G++++N PGT+D+DYRGE+KV ++NL  E    I   +RI Q V+ K    
Sbjct: 65  PRSGLAIKHGITMLNTPGTVDSDYRGELKVIVVNLSNE-AYTIEPNERIGQFVLNKIEQI 123

Query: 125 XXXXXXXXXXTVRGDQGYGSTGK 147
                     T RG+ G+G TGK
Sbjct: 124 EFVEVEELDSTERGESGFGHTGK 146


>DUT_BDEBA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 95.5 bits (236), Expect = 3e-22
 Identities = 57/144 (39%), Positives = 81/144 (56%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDK-ELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALPLGTVGLV 63
           +KI +L+     LP+    G +G D+ A      V+ PG R ++ TG++  +PLG     
Sbjct: 6   VKIKKLENFHGDLPQYQSLGASGFDVRAQLAGPVVLNPGERAMIPTGLSFEIPLGYEIQA 65

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSG AA+ GL+++N PGTIDADYRGE+K+ +INL  E  + I   +R AQLV+     
Sbjct: 66  RPRSGWAAKSGLTVLNTPGTIDADYRGEVKIIVINLGNE-AVTINDQERCAQLVLAPVIQ 124

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      T RG  G+GSTG+
Sbjct: 125 AQFELVNELSDTERGAGGFGSTGR 148


>DUT_WOLSU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 95.1 bits (235), Expect = 3e-22
 Identities = 55/142 (38%), Positives = 73/142 (51%), Gaps = 1/142 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           I++++L     +P     G AG DL       I P  R +V T             + PR
Sbjct: 9   IRLLKLHPNAVIPAYQSAGAAGFDLCCVESLEIPPLGRALVSTXXXXXXXXXXXXQIRPR 68

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA + G++++N PGT+D+DYRGEIKV LINL  E    I  GDRIAQ V+ +      
Sbjct: 69  SGLALKHGITVLNTPGTVDSDYRGEIKVILINLGAES-FSIQAGDRIAQGVVSRLSIAEL 127

Query: 127 XXXXXXXXTVRGDQGYGSTGKT 148
                   T RG  G+GSTGK+
Sbjct: 128 CEVESLDETARGAGGFGSTGKS 149


>DUT_HUMAN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase, mitochondrial;       
           Short=dUTPase;         EC=3.6.1.23;
          Length = 252

 Score = 95.1 bits (235), Expect = 3e-22
 Identities = 56/141 (39%), Positives = 73/141 (51%), Gaps = 3/141 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           ++  RL +    P R     AG DL++  D  I P  + +V T I IALP G  G V PR
Sbjct: 114 LRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPR 173

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLAA+  + +    G ID DYRG + V L N   EK   + +GDRIAQL+ ++      
Sbjct: 174 SGLAAKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICERIFYPEI 230

Query: 127 XXXXXXXXTVRGDQGYGSTGK 147
                   T RG  G+GSTGK
Sbjct: 231 EEVQALDDTERGSGGFGSTGK 251


>DUT_TREPS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 146

 Score = 94.7 bits (234), Expect = 4e-22
 Identities = 55/131 (41%), Positives = 73/131 (55%), Gaps = 4/131 (3%)

Query: 19  PKRAHRGDAGVDLHATTDA---VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           P+    G +G DL A        + P  R +V TG+ + LP+G    + PRSGLA   G+
Sbjct: 15  PEYQTLGSSGADLRAFLPGGPLEVHPLGRVLVPTGVCVELPVGLEMQIRPRSGLALEYGV 74

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
           +++N+PGTIDADYRGEI+V L+NL      +++ GDRIAQ VI                T
Sbjct: 75  TVLNSPGTIDADYRGEIRVLLVNLG-LAAFVVSHGDRIAQAVISSVLRVEYVRSGSISLT 133

Query: 136 VRGDQGYGSTG 146
            RG  GYGSTG
Sbjct: 134 ERGKGGYGSTG 144


>DUT_TREPA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 146

 Score = 94.7 bits (234), Expect = 4e-22
 Identities = 55/131 (41%), Positives = 73/131 (55%), Gaps = 4/131 (3%)

Query: 19  PKRAHRGDAGVDLHATTDA---VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           P+    G +G DL A        + P  R +V TG+ + LP+G    + PRSGLA   G+
Sbjct: 15  PEYQTLGSSGADLRAFLPGGPLEVHPLGRVLVPTGVCVELPVGLEMQIRPRSGLALEYGV 74

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
           +++N+PGTIDADYRGEI+V L+NL      +++ GDRIAQ VI                T
Sbjct: 75  TVLNSPGTIDADYRGEIRVLLVNLG-LAAFVVSHGDRIAQAVISSVLRVEYVRSGSISLT 133

Query: 136 VRGDQGYGSTG 146
            RG  GYGSTG
Sbjct: 134 ERGKGGYGSTG 144


>DUT_HALHL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score = 94.0 bits (232), Expect = 8e-22
 Identities = 60/146 (41%), Positives = 80/146 (54%), Gaps = 5/146 (3%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVG 61
           A I   RL  E+PLP  A  G A +DL A  D  +A  PG R ++GTG+A+ +   G VG
Sbjct: 7   ARIVDARLGSEIPLPDYATDGSAAIDLRACLDEPLALEPGQRRLIGTGLAVNIHDPGLVG 66

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           +V  RSGL+ + GL +    G ID+DY GEI V L + D  +P  IT G+RIAQL+ Q  
Sbjct: 67  VVASRSGLSLKHGLRVAQGIGVIDSDYHGEIGVILAH-DGTEPYTITPGERIAQLLFQPV 125

Query: 122 XXXXXXXXXXXXXTV-RGDQGYGSTG 146
                        T  RG+ G+G +G
Sbjct: 126 VQVTLDYVSAFSATTERGEGGFGHSG 151


>DUT_BACFR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score = 94.0 bits (232), Expect = 8e-22
 Identities = 54/116 (46%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH 64
           I+++   K  PLP  A    AG+D+ A     I  AP  R +V TG+ IALP G    + 
Sbjct: 3   IQVINKSKH-PLPAYATELSAGMDIRANISEPISLAPMQRCLVPTGLFIALPQGFEAQIR 61

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           PRSGLA ++G++++N+PGTIDADYRGEI + L+NL  E   +I  G+RIAQ+VI +
Sbjct: 62  PRSGLALKKGITVLNSPGTIDADYRGEICIILVNLSAE-TFVIEDGERIAQMVIAR 116


>DUT_BACFN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score = 94.0 bits (232), Expect = 8e-22
 Identities = 54/116 (46%), Positives = 75/116 (64%), Gaps = 4/116 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH 64
           I+++   K  PLP  A    AG+D+ A     I  AP  R +V TG+ IALP G    + 
Sbjct: 3   IQVINKSKH-PLPAYATELSAGMDIRANISEPISLAPMQRCLVPTGLFIALPQGFEAQIR 61

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           PRSGLA ++G++++N+PGTIDADYRGEI + L+NL  E   +I  G+RIAQ+VI +
Sbjct: 62  PRSGLALKKGITVLNSPGTIDADYRGEICIILVNLSAE-TFVIEDGERIAQMVIAR 116


>DUT_RHIME RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 160

 Score = 93.6 bits (231), Expect = 1e-21
 Identities = 54/118 (45%), Positives = 71/118 (60%), Gaps = 7/118 (5%)

Query: 7   IKIVRLD--KELPLPKRAHRGDAGVDLHATTDA----VIAPGHREIVGTGIAIALPLGTV 60
           + +VRL   + L LP     G AG+DL A   A     I PG R +V TG    +P G  
Sbjct: 14  LTLVRLPHGEGLDLPAYETAGAAGMDLRAALPADEPMTIRPGERALVPTGFIFEIPAGHE 73

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           G + PRSGLA + G++ +N PGT+D+DYRGE+KV L+NL  E    + RG RIAQ+VI
Sbjct: 74  GQIRPRSGLAFKHGITCLNTPGTVDSDYRGEVKVLLVNLGAE-DFAVERGMRIAQMVI 130


>DUT_BARHE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 184

 Score = 92.8 bits (229), Expect = 2e-21
 Identities = 64/153 (41%), Positives = 80/153 (52%), Gaps = 14/153 (9%)

Query: 7   IKIVRLD--KELPLPKRAHRGDAGVDLHATTD----AVIAPGHREIVGTGIAIALPLGTV 60
           + I RLD  + L LP  A  G AG+DL A        ++APG R ++ TG+   L  G  
Sbjct: 31  LSIQRLDHGQGLELPHYATAGSAGLDLRAALSEEETVILAPGQRALIPTGLIFHLSPGFE 90

Query: 61  GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQ- 119
             + PRSGLA + G++ +N PGTID+DYRGE+KV LIN   E    I RG RIAQ VI  
Sbjct: 91  AQIRPRSGLALKHGITCLNTPGTIDSDYRGEVKVLLINCGQE-DFAIKRGMRIAQTVIAP 149

Query: 120 ----KXXXXXXXXXXXXXXTV--RGDQGYGSTG 146
                              TV  RG  G+GSTG
Sbjct: 150 VLQVNVCALEPQQNESTKNTVGNRGAGGFGSTG 182


>DUT_RAT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 205

 Score = 92.4 bits (228), Expect = 2e-21
 Identities = 56/145 (38%), Positives = 74/145 (51%), Gaps = 3/145 (2%)

Query: 3   DLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGL 62
           D A ++ VRL +    P R     AG DL++  D  I    + +V T I IA+P G  G 
Sbjct: 63  DDASLRFVRLSEHATAPTRGSARAAGYDLYSAYDYTIPSMEKALVKTDIQIAVPSGCYGR 122

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           V PRSGLA +  + +    G ID DYRG + V L N   EK   + +GDRIAQL+ ++  
Sbjct: 123 VAPRSGLAVKHFIDV--GAGVIDEDYRGNVGVVLFNFGKEK-FEVKKGDRIAQLICERIL 179

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTGK 147
                       T RG  G+GSTGK
Sbjct: 180 YPDLEEVQTLDNTERGSGGFGSTGK 204


>DUT_HELMI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 163

 Score = 92.0 bits (227), Expect = 3e-21
 Identities = 72/158 (45%), Positives = 93/158 (58%), Gaps = 20/158 (12%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAV-----------------IAPGHREIVGT 49
           ++I RL  E  +P+R  +  +G DLH   DAV                 I PG R +V T
Sbjct: 3   VQIKRLHPEAMIPERQTKLASGFDLHVL-DAVLPENASDPYYDHFEAIRIFPGERILVRT 61

Query: 50  GIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITR 109
           GIAI +  G    V PRSGLA R G++++N+PGT+DADY G++ V LINL  +K + I +
Sbjct: 62  GIAIQMGEGMEAQVRPRSGLALRHGITLLNSPGTVDADYTGDVGVILINLG-DKHVDIRK 120

Query: 110 GDRIAQLVIQK-XXXXXXXXXXXXXXTVRGDQGYGSTG 146
            DR+AQLV Q                   GD G+G TG
Sbjct: 121 KDRVAQLVFQPVFHQVXXXXXXXXXXXXXGDGGFGHTG 158


>DUT_HELAH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 92.0 bits (227), Expect = 3e-21
 Identities = 53/114 (46%), Positives = 69/114 (60%), Gaps = 1/114 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           IKI ++     +PK    G +G DLHA  +AVI P    +V  GI ++L +G    V  R
Sbjct: 3   IKIQKIHPNALIPKYQTEGSSGFDLHAVENAVIKPHSVGLVRIGICLSLEVGYELQVRTR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLA    + ++N+PGT+D DYRGEIKV L NL  +K   I  GDRIAQ V+QK
Sbjct: 63  SGLALNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFTIQVGDRIAQGVVQK 115


>DUT_CHLTR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 92.0 bits (227), Expect = 3e-21
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVHPRSG 68
           +L+    LP+ A  G +G D+ A  +  IA  PG R ++ TGI++ +P G    V  RSG
Sbjct: 6   KLESGSSLPEYATSGASGADVRANINEPIAILPGQRALIPTGISVEIPHGYEIQVRSRSG 65

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXXXXXX 127
           LA++ G+ ++ +PGT+DADYRGEI+V L NL  E   ++  G RIAQLV+ K        
Sbjct: 66  LASKYGVIVLQSPGTVDADYRGEIRVILANLG-EATFIVEPGMRIAQLVVAKVEQVSFVE 124

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG  G+G TG+
Sbjct: 125 TQEELTATARGTGGFGHTGE 144


>DUT_CHLTB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 92.0 bits (227), Expect = 3e-21
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVHPRSG 68
           +L+    LP+ A  G +G D+ A  +  IA  PG R ++ TGI++ +P G    V  RSG
Sbjct: 6   KLESGSSLPEYATSGASGADVRANINEPIAILPGQRALIPTGISVEIPHGYEIQVRSRSG 65

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXXXXXX 127
           LA++ G+ ++ +PGT+DADYRGEI+V L NL  E   ++  G RIAQLV+ K        
Sbjct: 66  LASKYGVIVLQSPGTVDADYRGEIRVILANLG-EATFIVEPGMRIAQLVVAKVEQVSFVE 124

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG  G+G TG+
Sbjct: 125 TQEELTATARGTGGFGHTGE 144


>DUT_CHLTA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 92.0 bits (227), Expect = 3e-21
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVHPRSG 68
           +L+    LP+ A  G +G D+ A  +  IA  PG R ++ TGI++ +P G    V  RSG
Sbjct: 6   KLESGSSLPEYATSGASGADVRANINEPIAILPGQRALIPTGISVEIPHGYEIQVRSRSG 65

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXXXXXX 127
           LA++ G+ ++ +PGT+DADYRGEI+V L NL  E   ++  G RIAQLV+ K        
Sbjct: 66  LASKYGVIVLQSPGTVDADYRGEIRVILANLG-EATFIVEPGMRIAQLVVAKVEQVSFVE 124

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG  G+G TG+
Sbjct: 125 TQEELTATARGTGGFGHTGE 144


>DUT_CHLT2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 92.0 bits (227), Expect = 3e-21
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVHPRSG 68
           +L+    LP+ A  G +G D+ A  +  IA  PG R ++ TGI++ +P G    V  RSG
Sbjct: 6   KLESGSSLPEYATSGASGADVRANINEPIAILPGQRALIPTGISVEIPHGYEIQVRSRSG 65

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXXXXXX 127
           LA++ G+ ++ +PGT+DADYRGEI+V L NL  E   ++  G RIAQLV+ K        
Sbjct: 66  LASKYGVIVLQSPGTVDADYRGEIRVILANLG-EATFIVEPGMRIAQLVVAKVEQVSFVE 124

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG  G+G TG+
Sbjct: 125 TQEELTATARGTGGFGHTGE 144


>DUT_CANAL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 159

 Score = 91.7 bits (226), Expect = 4e-21
 Identities = 57/132 (43%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           +P +     AG DL++   A I    + +V T I+I +P+GT G V PRSGLA + G+S 
Sbjct: 30  VPTKGSALAAGYDLYSAEAATIPAHGQGLVSTDISIIVPIGTYGRVAPRSGLAVKHGIS- 88

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK--XXXXXXXXXXXXXXT 135
               G IDADYRGE+KV L N   EK   I  GDRIAQLV+++                T
Sbjct: 89  -TGAGVIDADYRGEVKVVLFN-HSEKDFEIKEGDRIAQLVLEQIVNADIKEISLEELDNT 146

Query: 136 VRGDQGYGSTGK 147
            RG+ G+GSTGK
Sbjct: 147 ERGEGGFGSTGK 158


>DUT_SILPO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 48/122 (39%), Positives = 72/122 (59%), Gaps = 8/122 (6%)

Query: 4   LAPIKIVR---LDKELPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALP 56
           +  I+++R    D ++PLP     G AG D+ A         +APG R ++ TG+ + +P
Sbjct: 1   MVAIRVIRDAGADTQVPLPSYETTGAAGADIRANLPDRGSLTLAPGGRALIPTGLRVEIP 60

Query: 57  LGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQL 116
            G    + PRSGLA + G+++ N PGTID+DYRG + V L+N   E P  +  G+RIAQL
Sbjct: 61  AGYEIQIRPRSGLALKHGITLPNTPGTIDSDYRGPLGVILLNAGAE-PFEVVHGERIAQL 119

Query: 117 VI 118
           V+
Sbjct: 120 VV 121


>DUT_CHLMU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 91.3 bits (225), Expect = 5e-21
 Identities = 56/140 (40%), Positives = 78/140 (55%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVHPRSG 68
           +L+    LP+ A  G +G D+ A     IA  PG R ++ TGI++ +P G    V  RSG
Sbjct: 6   KLESGSSLPEYATSGASGADVRANISEPIAILPGQRALIPTGISVDIPHGYEIQVRSRSG 65

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXXXXXX 127
           LA + G+ ++ +PGT+DADYRGEI+V L NL  E   ++  G RIAQLV+ K        
Sbjct: 66  LAVKYGVIVLQSPGTVDADYRGEIRVILANLG-ESTFIVEPGMRIAQLVVAKVEQVSFVE 124

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG  G+G TG+
Sbjct: 125 TQEELTATARGTGGFGHTGE 144


>DUT_HELPJ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 90.5 bits (223), Expect = 8e-21
 Identities = 51/114 (44%), Positives = 68/114 (59%), Gaps = 1/114 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           IKI ++     +PK    G +G DLHA  + VI P    +V  GI ++L +G    V  R
Sbjct: 3   IKIQKIHPNALIPKYQTEGSSGFDLHAVEEVVIKPHSVGLVRIGICLSLEVGYELQVRTR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLA    + ++N+PGT+D DYRGEIKV L NL  +K   +  GDRIAQ V+QK
Sbjct: 63  SGLALNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK 115


>DUT_CHLPN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 90.1 bits (222), Expect = 1e-20
 Identities = 57/138 (41%), Positives = 75/138 (54%), Gaps = 4/138 (2%)

Query: 12  LDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVHPRSGL 69
           LD    LP+    G AG DL A  +  IA  PG R ++ TGI   +P G    V PRSGL
Sbjct: 7   LDSGGELPEYTTPGAAGADLRANIEEPIALLPGQRALIPTGIKAEIPEGYELQVRPRSGL 66

Query: 70  AAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXXXXXXX 128
           A + G++++N+PGTID+DYRGEI+V LIN   +   +I    RIAQ+V+           
Sbjct: 67  ALKHGITVLNSPGTIDSDYRGEIRVILINFG-DSTFIIEPKMRIAQVVLSPVVQATFVVK 125

Query: 129 XXXXXXTVRGDQGYGSTG 146
                 T RG  G+G TG
Sbjct: 126 QESLAETARGSGGFGHTG 143


>DUT_BARBK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 177

 Score = 90.1 bits (222), Expect = 1e-20
 Identities = 51/107 (47%), Positives = 65/107 (60%), Gaps = 5/107 (4%)

Query: 16  LPLPKRAHRGDAGVDLHATT----DAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAA 71
           L LP  A  G AG+DL A         ++PG R ++ TG+   L  G    + PRSGLA 
Sbjct: 29  LGLPHYATEGSAGLDLRAALPENESITLSPGQRALIPTGLIFHLSPGFEAQIRPRSGLAL 88

Query: 72  REGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + G++ +N PGTID+DYRGE+KV LINL  E   +I RG RIAQ VI
Sbjct: 89  KNGITCLNTPGTIDSDYRGEVKVLLINLGQE-DFIIERGMRIAQTVI 134


>DUT_ROSDO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 89.7 bits (221), Expect = 1e-20
 Identities = 49/109 (44%), Positives = 67/109 (61%), Gaps = 4/109 (3%)

Query: 13  DKELPLPKRAHRGDAGVDLHATTD---AVIAPGHREIVGTGIAIALPLGTVGLVHPRSGL 69
           D  +PLP     G AG D+ A        +APG R +V TG+ +A+P G    + PRSGL
Sbjct: 15  DTSVPLPAYETSGAAGADIRANCPDGPVTLAPGARALVPTGLRMAIPQGYEVQIRPRSGL 74

Query: 70  AAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           A R G+++VN+PGTID+DYRG + V + NL  +    IT G RIAQ+V+
Sbjct: 75  ALRHGITLVNSPGTIDSDYRGAVGVIMQNLG-DAAFEITHGMRIAQMVV 122


>DUT_DESHY RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 89.7 bits (221), Expect = 1e-20
 Identities = 57/114 (50%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVG-LV 63
           I  VR DK   LP+ A  G AGVDL A+ D    I PG    + TG+AI LP   VG  V
Sbjct: 8   IAYVRKDKAPKLPQYATPGAAGVDLQASLDQELTIEPGQIVKIPTGLAIELPHAGVGAFV 67

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLV 117
             RSGLA++ GL++ N  G ID+DYRGEI V +IN   E P ++  GDRIAQ+V
Sbjct: 68  FARSGLASKYGLALANGVGVIDSDYRGEILVAVINQGSE-PFVVKDGDRIAQMV 120


>DUT_DESHD RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 89.7 bits (221), Expect = 1e-20
 Identities = 57/114 (50%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVG-LV 63
           I  VR DK   LP+ A  G AGVDL A+ D    I PG    + TG+AI LP   VG  V
Sbjct: 8   IAYVRKDKAPKLPQYATPGAAGVDLQASLDQELTIEPGQIVKIPTGLAIELPHAGVGAFV 67

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLV 117
             RSGLA++ GL++ N  G ID+DYRGEI V +IN   E P ++  GDRIAQ+V
Sbjct: 68  FARSGLASKYGLALANGVGVIDSDYRGEILVAVINQGSE-PFVVKDGDRIAQMV 120


>DUT_TREDE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score = 89.0 bits (219), Expect = 2e-20
 Identities = 56/131 (42%), Positives = 73/131 (55%), Gaps = 3/131 (2%)

Query: 18  LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGL 75
           LP+    G AG DL A  +   ++ P  R ++ TG+++ LP G    V PRSGLA + G+
Sbjct: 13  LPEYKTSGSAGADLRALIEEPIILKPMQRCLIPTGLSVELPKGIELQVRPRSGLALKHGI 72

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
           +++N PGT+D+DYRGE+ V LINL  E    I  GDR                      T
Sbjct: 73  TVLNTPGTVDSDYRGELAVLLINLGNE-DFKIENGDRXXXXXXXXXXXXDFLQKDELSNT 131

Query: 136 VRGDQGYGSTG 146
            RG  GYGSTG
Sbjct: 132 ERGAGGYGSTG 142


>DUT_HELPH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 89.0 bits (219), Expect = 2e-20
 Identities = 50/114 (43%), Positives = 67/114 (58%), Gaps = 1/114 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           IKI ++     +PK    G +G DLHA  +  I P    +V  GI ++L +G    V  R
Sbjct: 3   IKIQKIHPNALIPKYQTEGSSGFDLHAVEEVTIKPHSVGLVKIGICLSLEVGYELQVRTR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLA    + ++N+PGT+D DYRGEIKV L NL  +K   +  GDRIAQ V+QK
Sbjct: 63  SGLALNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK 115


>DUT_HELP2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 89.0 bits (219), Expect = 2e-20
 Identities = 50/114 (43%), Positives = 67/114 (58%), Gaps = 1/114 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           IKI ++     +PK    G +G DLHA  +  I P    +V  GI ++L +G    V  R
Sbjct: 3   IKIQKIHPNALIPKYQTEGSSGFDLHAVEEVTIKPHSVGLVKIGICLSLEVGYELQVRTR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLA    + ++N+PGT+D DYRGEIKV L NL  +K   +  GDRIAQ V+QK
Sbjct: 63  SGLALNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK 115


>DUT_HELPY RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 88.6 bits (218), Expect = 3e-20
 Identities = 50/114 (43%), Positives = 68/114 (59%), Gaps = 1/114 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           IKI ++     +PK    G +G DLHA  + +I P    +V  GI ++L +G    V  R
Sbjct: 3   IKIQKIHPNALIPKYQTDGSSGFDLHAVEEVMIKPHSVGLVKIGICLSLEVGYELQVRTR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLA    + ++N+PGT+D DYRGEIKV L NL  +K   +  GDRIAQ V+QK
Sbjct: 63  SGLALNHQVMVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK 115


>DUT_HELPS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 88.6 bits (218), Expect = 3e-20
 Identities = 50/114 (43%), Positives = 68/114 (59%), Gaps = 1/114 (0%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           IKI ++     +PK    G +G DLHA  + +I P    +V  GI ++L +G    V  R
Sbjct: 3   IKIQKIHPNALIPKYQTEGSSGFDLHAIEEVMIKPHSVGLVKIGICLSLEVGYELQVRTR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           SGLA    + ++N+PGT+D DYRGEIKV L NL  +K   +  GDRIAQ V+QK
Sbjct: 63  SGLALNHQVVVLNSPGTVDNDYRGEIKVILANLS-DKDFKVQVGDRIAQGVVQK 115


>DUT_ADEG8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 163

 Score = 88.2 bits (217), Expect = 4e-20
 Identities = 52/144 (36%), Positives = 76/144 (52%), Gaps = 7/144 (4%)

Query: 6   PIKIVRLDKELPL---PKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGL 62
           P+K++   K  P    P+RA  G AG DL ++ D V+ P  R ++ T ++   P G  G 
Sbjct: 12  PVKLL-FKKHSPFAVTPQRATSGAAGYDLCSSADVVVPPKSRSLIPTDLSFQFPRGVYGR 70

Query: 63  VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXX 122
           + PRSGLA +  + +    G ID+DYRG + V L N   +    + RGDRIAQL++++  
Sbjct: 71  IAPRSGLAVKFFIDV--GAGVIDSDYRGIVSVLLFNFS-DHNFNVRRGDRIAQLILERHL 127

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                       T RG  G+GSTG
Sbjct: 128 TPDLEERSGLDETARGAAGFGSTG 151


>DUT_ACTPJ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 87.8 bits (216), Expect = 5e-20
 Identities = 53/140 (37%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A T++   +APG   ++ TGI+I +       ++ PRS
Sbjct: 12  RIGNEFPLPAYATEGSAGLDLRALTESALTVAPGQTVLIPTGISIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V L N   +KP  +  GDRIAQLV          
Sbjct: 72  GLGHKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFTVEVGDRIAQLVFVPVVQASFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVNDFAQTERGEGGFGHSGK 150


>DUT_ACTP7 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 87.8 bits (216), Expect = 5e-20
 Identities = 53/140 (37%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A T++   +APG   ++ TGI+I +       ++ PRS
Sbjct: 12  RIGNEFPLPAYATEGSAGLDLRALTESALTVAPGQTVLIPTGISIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V L N   +KP  +  GDRIAQLV          
Sbjct: 72  GLGHKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFTVEVGDRIAQLVFVPVVQASFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVNDFAQTERGEGGFGHSGK 150


>DUT_ACTP2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 87.8 bits (216), Expect = 5e-20
 Identities = 53/140 (37%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A T++   +APG   ++ TGI+I +       ++ PRS
Sbjct: 12  RIGNEFPLPAYATEGSAGLDLRALTESALTVAPGQTVLIPTGISIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V L N   +KP  +  GDRIAQLV          
Sbjct: 72  GLGHKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFTVEVGDRIAQLVFVPVVQARFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVNDFAQTERGEGGFGHSGK 150


>DUT_IDILO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 87.4 bits (215), Expect = 7e-20
 Identities = 54/141 (38%), Positives = 77/141 (54%), Gaps = 4/141 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           R+ + +PLP+ A +G AG+DL A  D    I PG  +++GTGIA+ +        + PRS
Sbjct: 12  RIGQSIPLPEYATQGSAGMDLRACLDQPLTIEPGQTQLIGTGIAMYIGDPNYAATILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + GL + N  G ID+DY+GE+KV   N    +   I  GDRIAQLVI         
Sbjct: 72  GLGHKHGLVLGNLVGLIDSDYQGELKVSCWNRS-NQAYTIEPGDRIAQLVILPVVQAQMS 130

Query: 128 XXXXXXXTVRGDQGYGSTGKT 148
                  T RG+ G+G +G++
Sbjct: 131 IVEEFHETDRGEGGFGHSGRS 151


>DUT_SOLLC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 169

 Score = 87.0 bits (214), Expect = 9e-20
 Identities = 52/139 (37%), Positives = 73/139 (52%), Gaps = 3/139 (2%)

Query: 8   KIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRS 67
           ++ +L +   LP RA    AG DL +  +  +    + +V T ++IA+P GT   + PRS
Sbjct: 33  RVKKLSENAVLPSRASSLAAGYDLSSAAETKVPARGKALVPTDLSIAVPQGTYARIAPRS 92

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GLA +  + +    G IDADYRG + V L N   E    +  GDRIAQL++QK       
Sbjct: 93  GLAWKYSIDV--GAGVIDADYRGPVGVVLFN-HSEVDFEVKVGDRIAQLIVQKIVTPEVE 149

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  TVRG  G+GSTG
Sbjct: 150 QVDDLDSTVRGSGGFGSTG 168


>DUT_METSB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 160

 Score = 87.0 bits (214), Expect = 9e-20
 Identities = 42/80 (52%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 39  IAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLIN 98
           + PG R +V TG+ + +P    G + PRSGLA + G++++NAPGTID+DYRGE+ V LIN
Sbjct: 45  LEPGERRLVPTGLVLQIPPSHEGQLRPRSGLALKAGVTVLNAPGTIDSDYRGEVGVLLIN 104

Query: 99  LDPEKPIMITRGDRIAQLVI 118
              E P  I RG+RIAQL+I
Sbjct: 105 FGAE-PFEIARGERIAQLII 123


>DUT_LEPBL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 86.7 bits (213), Expect = 1e-19
 Identities = 55/144 (38%), Positives = 80/144 (55%), Gaps = 6/144 (4%)

Query: 6   PIKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLV 63
           PIK +R + ELP+ +  H   AG D+HA  D+  ++ P    +V TG++  +P      +
Sbjct: 4   PIKKLRSNAELPVLQTKHA--AGYDVHACLDSNLILEPNKVTLVPTGLSFEIPQEYHFEI 61

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSG + +  + I N+PGTID+DYRGE+ + L NL    P +I  G RIAQL+I++   
Sbjct: 62  RPRSGFSTKNQILIPNSPGTIDSDYRGELMIPLFNLG-NIPFVIEHGMRIAQLLIRETHY 120

Query: 124 XXXXXXXXXXXTV-RGDQGYGSTG 146
                      T  RG  G+GSTG
Sbjct: 121 TNWELVSEFTDTTERGTGGFGSTG 144


>DUT_LEPBJ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 86.7 bits (213), Expect = 1e-19
 Identities = 55/144 (38%), Positives = 80/144 (55%), Gaps = 6/144 (4%)

Query: 6   PIKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLV 63
           PIK +R + ELP+ +  H   AG D+HA  D+  ++ P    +V TG++  +P      +
Sbjct: 4   PIKKLRSNAELPVLQTKHA--AGYDVHACLDSNLILEPNKVTLVPTGLSFEIPQEYHFEI 61

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSG + +  + I N+PGTID+DYRGE+ + L NL    P +I  G RIAQL+I++   
Sbjct: 62  RPRSGFSTKNQILIPNSPGTIDSDYRGELMIPLFNLG-NIPFVIEHGMRIAQLLIRETHY 120

Query: 124 XXXXXXXXXXXTV-RGDQGYGSTG 146
                      T  RG  G+GSTG
Sbjct: 121 TNWELVSEFTDTTERGTGGFGSTG 144


>DUT_BARQU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 185

 Score = 86.7 bits (213), Expect = 1e-19
 Identities = 51/117 (43%), Positives = 66/117 (56%), Gaps = 5/117 (4%)

Query: 6   PIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIA----PGHREIVGTGIAIALPLGTVG 61
           P++ +   + L LP  A  G AG+DL             PG R ++ TG+   L  G   
Sbjct: 31  PVECLEHGQGLELPHYATSGSAGLDLRXXXXXXXXXXXXPGQRALIPTGLVFHLLPGFEA 90

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
            + PRSGLA + G++ +N PGTID+DYRGEIK+ LINL  E    I RG RIAQ VI
Sbjct: 91  QIRPRSGLALKHGITCLNTPGTIDSDYRGEIKILLINLGQEN-FSIQRGMRIAQTVI 146


>DUT_PROMH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 86.3 bits (212), Expect = 2e-19
 Identities = 53/140 (37%), Positives = 78/140 (55%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+ +E PLP  A  G AG+DL A  DA  V+APG  E++ TG+A+ +   G   +V PRS
Sbjct: 12  RIGQEYPLPAYATTGSAGLDLRACLDAPLVLAPGQTELLPTGLAVHIADEGLAAMVLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   ++   I  G+RIAQ+VI         
Sbjct: 72  GLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQAFTIEPGERIAQMVIVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG  G+G +G+
Sbjct: 131 IVEDFTATERGTGGFGHSGR 150


>DUT_LEPIN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 85.9 bits (211), Expect = 2e-19
 Identities = 55/143 (38%), Positives = 82/143 (57%), Gaps = 6/143 (4%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVH 64
           ++ +R + ELPL +      AG D+HA  D+  V+ PG+  +V TG++ A+P      + 
Sbjct: 5   VQKLRPNAELPLLQTKQA--AGYDIHACLDSKLVLEPGNVGLVPTGLSFAIPQEFHFEIR 62

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXX 123
           PRSG + +  + I N+PGTID+DYRGE+ + L+NL  +   +I  G RIAQL+I+K    
Sbjct: 63  PRSGFSTKNRILIPNSPGTIDSDYRGELMIPLLNLG-DSSFIIEHGMRIAQLLIRKTWYA 121

Query: 124 XXXXXXXXXXXTVRGDQGYGSTG 146
                      T RG  G+GSTG
Sbjct: 122 DWELVSEFADRTERGANGFGSTG 144


>DUT_LEPIC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 85.9 bits (211), Expect = 2e-19
 Identities = 55/143 (38%), Positives = 82/143 (57%), Gaps = 6/143 (4%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVGLVH 64
           ++ +R + ELPL +      AG D+HA  D+  V+ PG+  +V TG++ A+P      + 
Sbjct: 5   VQKLRPNAELPLLQTKQA--AGYDIHACLDSKLVLEPGNVGLVPTGLSFAIPQEFHFEIR 62

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXX 123
           PRSG + +  + I N+PGTID+DYRGE+ + L+NL  +   +I  G RIAQL+I+K    
Sbjct: 63  PRSGFSTKNRILIPNSPGTIDSDYRGELMIPLLNLG-DSSFIIEHGMRIAQLLIRKTWYA 121

Query: 124 XXXXXXXXXXXTVRGDQGYGSTG 146
                      T RG  G+GSTG
Sbjct: 122 DWELVSEFADRTERGANGFGSTG 144


>DUT_PBCV1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 141

 Score = 85.5 bits (210), Expect = 3e-19
 Identities = 46/117 (39%), Positives = 71/117 (60%), Gaps = 3/117 (2%)

Query: 4   LAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLV 63
           ++ + + +L +    P R   G AG D+ +  D V+    R  V TGI+I +P GT G +
Sbjct: 1   MSSLLVKKLVESATTPMRGSEGAAGYDISSVEDVVVPAMGRIAVSTGISIRVPNGTYGRI 60

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
            PRSGLA + G+ ++   G ID+DYRGE+K  L N   E+  +I +GDRIAQL++++
Sbjct: 61  APRSGLAYKYGIDVL--AGVIDSDYRGELKAILYN-TTERDYIIKKGDRIAQLILEQ 114


>DUT_ADEG1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 178

 Score = 85.1 bits (209), Expect = 4e-19
 Identities = 53/140 (37%), Positives = 68/140 (48%), Gaps = 3/140 (2%)

Query: 10  VRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGL 69
           VRL      P RA  G AG DL +  D  +    R +V T +    P G  G + PRSGL
Sbjct: 25  VRLSPHAVPPVRATHGAAGYDLFSAYDIKVPARGRALVPTDLVFQFPPGCYGRIAPRSGL 84

Query: 70  AAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXX 129
           AA+  + +    G ID DYRG + V L N   E    I RGDR+AQL++++         
Sbjct: 85  AAKFFIDV--GAGVIDPDYRGNVSVVLFNFS-ESSFNIRRGDRVAQLILERIMVPELSEL 141

Query: 130 XXXXXTVRGDQGYGSTGKTA 149
                T RG  G+GSTG  A
Sbjct: 142 TQLGETDRGASGFGSTGMGA 161


>DUT_PARUW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 50/138 (36%), Positives = 71/138 (51%), Gaps = 1/138 (0%)

Query: 9   IVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSG 68
           ++  ++ LP         A V  +      I PG   ++ TG+ +A+P G    V PRSG
Sbjct: 14  LIENEELLPFYMTPEAAGADVKAYLKESLEIPPGQSALIPTGMRLAIPEGYEIQVRPRSG 73

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXX 128
           LA +  ++++N PGTIDADYRGEIK+ LIN       ++  G RIAQLV+ +        
Sbjct: 74  LALKHQVTVLNTPGTIDADYRGEIKIILIN-HGTNAFIVEPGMRIAQLVLAQVLRANFVL 132

Query: 129 XXXXXXTVRGDQGYGSTG 146
                 T RG  G+G TG
Sbjct: 133 SEELESTQRGVGGFGHTG 150


>DUT_CHLT3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 50/110 (45%), Positives = 68/110 (61%), Gaps = 3/110 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREI--VGTGIAIALPLGTVGLVHPRSG 68
           +L  E  LPK A  G AG+D+ A  D  I+   + +  V TG+A+ +P G    + PRSG
Sbjct: 8   KLHPEARLPKYATEGAAGMDISACLDEPISVEAQSVALVPTGLALEIPPGYEAQLRPRSG 67

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           LA +  +S+ NAP TIDAD+RGE+KV LIN   +    +  GDRIAQ+VI
Sbjct: 68  LALKHLISLPNAPATIDADFRGELKVILIN-HGKDAFEVKHGDRIAQMVI 116


>DUT_ACIBY RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 68/140 (48%), Positives = 88/140 (62%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL KE PLP  A  G AG+DL A  D  I   PG   +V TG+AI +  +   GL+ PRS
Sbjct: 11  RLGKEWPLPSYATAGSAGLDLRACLDEAIEIEPGQTVLVKTGMAIYIHDVNFAGLILPRS 70

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V + N   +    +  G+R+AQ V+         
Sbjct: 71  GLGHKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXX 129

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T+RG  G+G TGK
Sbjct: 130 XXXXXXXTLRGAGGFGHTGK 149


>DUT_ACIBT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 68/140 (48%), Positives = 88/140 (62%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL KE PLP  A  G AG+DL A  D  I   PG   +V TG+AI +  +   GL+ PRS
Sbjct: 11  RLGKEWPLPSYATAGSAGLDLRACLDEAIEIEPGQTVLVKTGMAIYIHDVNFAGLILPRS 70

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V + N   +    +  G+R+AQ V+         
Sbjct: 71  GLGHKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXX 129

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T+RG  G+G TGK
Sbjct: 130 XXXXXXXTLRGAGGFGHTGK 149


>DUT_ACIBS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 68/140 (48%), Positives = 88/140 (62%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL KE PLP  A  G AG+DL A  D  I   PG   +V TG+AI +  +   GL+ PRS
Sbjct: 11  RLGKEWPLPSYATAGSAGLDLRACLDEAIEIEPGQTVLVKTGMAIYIHDVNFAGLILPRS 70

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V + N   +    +  G+R+AQ V+         
Sbjct: 71  GLGHKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXX 129

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T+RG  G+G TGK
Sbjct: 130 XXXXXXXTLRGAGGFGHTGK 149


>DUT_ACIBC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 68/140 (48%), Positives = 88/140 (62%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL KE PLP  A  G AG+DL A  D  I   PG   +V TG+AI +  +   GL+ PRS
Sbjct: 11  RLGKEWPLPSYATAGSAGLDLRACLDEAIEIEPGQTVLVKTGMAIYIHDVNFAGLILPRS 70

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V + N   +    +  G+R+AQ V+         
Sbjct: 71  GLGHKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXX 129

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T+RG  G+G TGK
Sbjct: 130 XXXXXXXTLRGAGGFGHTGK 149


>DUT_ACIB5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 68/140 (48%), Positives = 88/140 (62%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL KE PLP  A  G AG+DL A  D  I   PG   +V TG+AI +  +   GL+ PRS
Sbjct: 11  RLGKEWPLPSYATAGSAGLDLRACLDEAIEIEPGQTVLVKTGMAIYIHDVNFAGLILPRS 70

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V + N   +    +  G+R+AQ V+         
Sbjct: 71  GLGHKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXX 129

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T+RG  G+G TGK
Sbjct: 130 XXXXXXXTLRGAGGFGHTGK 149


>DUT_ACIB3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 84.7 bits (208), Expect = 5e-19
 Identities = 68/140 (48%), Positives = 88/140 (62%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL KE PLP  A  G AG+DL A  D  I   PG   +V TG+AI +  +   GL+ PRS
Sbjct: 11  RLGKEWPLPSYATAGSAGLDLRACLDEAIEIEPGQTVLVKTGMAIYIHDVNFAGLILPRS 70

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V + N   +    +  G+R+AQ V+         
Sbjct: 71  GLGHKHGIVLGNLVGLIDSDYQGELMVSVWNRG-QTTFRLEPGERLAQYVLVPXXXXXXX 129

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T+RG  G+G TGK
Sbjct: 130 XXXXXXXTLRGAGGFGHTGK 149


>DUT_ASHGO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score = 84.3 bits (207), Expect = 6e-19
 Identities = 65/144 (45%), Positives = 91/144 (63%), Gaps = 5/144 (3%)

Query: 5   APIKIVRLDKELPL-PKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLV 63
           AP   V+L  E  + P +     AG D++A+ D VI    + +V T ++  +P+GT G +
Sbjct: 12  APTLKVQLRSENAIAPTKGSAAAAGYDIYASQDCVIPGRGQGLVATDVSFTVPVGTYGRI 71

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XX 122
            PRSGLA + G  I    G +D DY GE+K+ L N   ++   + RGDR+AQLV+++   
Sbjct: 72  APRSGLAVKHG--IQTGAGVVDRDYTGEVKIVLFN-HSDRDYAVKRGDRVAQLVLERIXX 128

Query: 123 XXXXXXXXXXXXTVRGDQGYGSTG 146
                         RG+ G+GSTG
Sbjct: 129 XXXXXXXXXXXXXXRGEGGFGSTG 152


>DUT_NEUCR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 165

 Score = 84.0 bits (206), Expect = 8e-19
 Identities = 45/115 (39%), Positives = 70/115 (60%), Gaps = 3/115 (2%)

Query: 6   PIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHP 65
           P+ I +L  +  LP R     AG D++A+ +  I    + +V T I++A+P GT G + P
Sbjct: 17  PLLIKKLSDKARLPTRGSAFAAGYDIYASKETTIPARGKGLVETDISMAVPAGTYGRIAP 76

Query: 66  RSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK 120
           RSGLAA+  + +    G IDADYRG++KV L N   +   ++  GDR+AQLV+++
Sbjct: 77  RSGLAAKNFIDV--GAGVIDADYRGQVKVLLFN-HSDVDFVVNEGDRVAQLVLER 128


>DUT_COXBN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 84.0 bits (206), Expect = 8e-19
 Identities = 59/152 (38%), Positives = 77/152 (50%), Gaps = 6/152 (3%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP 56
           MT    +KI+  RL  E PLP  A +G AG+DL A  D    I P    ++ TG+AI L 
Sbjct: 1   MTHSVQLKILDKRLGSEFPLPAYATKGSAGLDLRACLDEPLKIEPDETCLISTGLAIYLG 60

Query: 57  LGTVGL-VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              V   + PRSGL  + G+ + N  G ID+DY+G + V   N   E P  I  GDRIAQ
Sbjct: 61  HSNVAATILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRGKE-PYTINPGDRIAQ 119

Query: 116 LVIQKXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
           LV+                T RG  G+GS+G+
Sbjct: 120 LVVLPILKAQFAVVEEFELTERGAGGFGSSGQ 151


>DUT_PSYIN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 83.6 bits (205), Expect = 1e-18
 Identities = 51/140 (36%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+ KE PLP+ A  G AG+DL A  D   +I PG  +++ TGIAI +   G    + PRS
Sbjct: 12  RIGKEFPLPEHATAGSAGMDLRACIDQALIIKPGETQLIPTGIAIHISDPGLAATILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   E    +  G+R+AQLV          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRSTES-FRLEPGERLAQLVFLPVVQATFE 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  + RG+ G+G +GK
Sbjct: 131 IVDEFKSSERGEGGFGHSGK 150


>DUT_YARLI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 157

 Score = 83.2 bits (204), Expect = 1e-18
 Identities = 51/142 (35%), Positives = 74/142 (52%), Gaps = 5/142 (3%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +K+  L++    P R     AG DL+A  +  I    R +V  G+++++P GT   + PR
Sbjct: 3   LKVAFLNENARAPTRGSVHAAGYDLYAAEEKTIPANGRGLVDLGLSMSIPEGTYARIAPR 62

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK--XXXX 124
           SGLA + GLS     G ID DYRG +KV L N   E    +T GDR+AQ+++++      
Sbjct: 63  SGLAVKNGLS--TGAGVIDYDYRGPVKVMLFNHSTE-DFNVTIGDRVAQMILERIVTPEV 119

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RG  G+GSTG
Sbjct: 120 QVVQTNDLESTERGAGGFGSTG 141


>DUT_PSEAE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 83.2 bits (204), Expect = 1e-18
 Identities = 53/139 (38%), Positives = 74/139 (53%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           RL  + PLP+ A  G AG+DL A    D+V+ PG   ++ TG++I +   G   LV PRS
Sbjct: 12  RLGSDFPLPQYATPGSAGLDLRAMLKEDSVLGPGQTLLIPTGLSIYIADPGLAALVLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   E P  I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-ESPFTIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 LVEAFDESQRGAGGFGHSG 149


>DUT_PSEA8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 83.2 bits (204), Expect = 1e-18
 Identities = 53/139 (38%), Positives = 74/139 (53%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           RL  + PLP+ A  G AG+DL A    D+V+ PG   ++ TG++I +   G   LV PRS
Sbjct: 12  RLGSDFPLPQYATPGSAGLDLRAMLKEDSVLGPGQTLLIPTGLSIYIADPGLAALVLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   E P  I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-ESPFTIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 LVEAFDESQRGAGGFGHSG 149


>DUT_HAES2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 83.2 bits (204), Expect = 1e-18
 Identities = 52/140 (37%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    + PG  +++ TG++I +       ++ PRS
Sbjct: 12  RIGTEFPLPTYATIGSAGLDLRALVDEGFEVQPGETKLISTGLSIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V L N   +KP  I  GDRIAQLV          
Sbjct: 72  GLGHKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFKIEIGDRIAQLVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVEEFQQTDRGNGGFGHSGK 150


>DUT_HAES1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 83.2 bits (204), Expect = 1e-18
 Identities = 52/140 (37%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    + PG  +++ TG++I +       ++ PRS
Sbjct: 12  RIGTEFPLPTYATIGSAGLDLRALVDEGFEVQPGETKLISTGLSIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V L N   +KP  I  GDRIAQLV          
Sbjct: 72  GLGHKNGIVLGNLVGLIDSDYQGPLMVSLWNRS-DKPFKIEIGDRIAQLVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVEEFQQTDRGNGGFGHSGK 150


>DUT_SHEON RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 82.8 bits (203), Expect = 2e-18
 Identities = 52/139 (37%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG  ++V TGIAI +   G   L+ PRS
Sbjct: 13  RIGSEFPLPAYATPGSAGMDLRAMIDTTMTIAPGETQLVPTGIAIHVADPGLAALILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G +D+DY+G + V   N   + P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLVDSDYQGPLMVSCWNRS-DTPFTLEIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_PSEAB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.8 bits (203), Expect = 2e-18
 Identities = 53/139 (38%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           RL  + PLP+ A  G AG+DL A    D V+ PG   ++ TG++I +   G   LV PRS
Sbjct: 12  RLGSDFPLPQYATPGSAGLDLRAMLKEDTVLGPGQTLLIPTGLSIYIADPGLAALVLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   E P  I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-ESPFTIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 LVEQFDESQRGAGGFGHSG 149


>DUT_NITOC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.8 bits (203), Expect = 2e-18
 Identities = 53/140 (37%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVH-PRS 67
           RL KE PLP  A  G AG+DL A  +  +A  PG  +++ TG+AI +       V  PRS
Sbjct: 12  RLGKEFPLPDYATAGAAGLDLRACIERPLAILPGATKLIPTGLAIYIADPRFAAVLLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  ++G+ + N  G ID+DY+GEI V   N   E P  +  G+RIAQ++          
Sbjct: 72  GLGHKQGIVLGNLVGLIDSDYQGEILVSCWNRGAE-PFTLAVGERIAQMIFVPVVQMEFE 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T+RG+ G+G TG+
Sbjct: 131 QVETFTATLRGEGGFGHTGR 150


>DUT_COXBU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 82.8 bits (203), Expect = 2e-18
 Identities = 59/152 (38%), Positives = 76/152 (50%), Gaps = 6/152 (3%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP 56
           MT    +KI+  RL  E PLP  A  G AG+DL A  D    I P    ++ TG+AI L 
Sbjct: 1   MTHSVQLKILDKRLGSEFPLPAYATTGSAGLDLRACLDEPLKIEPDETCLISTGLAIYLG 60

Query: 57  LGTVGL-VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              V   + PRSGL  + G+ + N  G ID+DY+G + V   N   E P  I  GDRIAQ
Sbjct: 61  HSNVAATILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRGKE-PYTINPGDRIAQ 119

Query: 116 LVIQKXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
           LV+                T RG  G+GS+G+
Sbjct: 120 LVVLPILKAQFAVVEEFELTERGAGGFGSSGQ 151


>DUT_COXBR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 82.8 bits (203), Expect = 2e-18
 Identities = 59/152 (38%), Positives = 76/152 (50%), Gaps = 6/152 (3%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP 56
           MT    +KI+  RL  E PLP  A  G AG+DL A  D    I P    ++ TG+AI L 
Sbjct: 1   MTHSVQLKILDKRLGSEFPLPAYATTGSAGLDLRACLDEPLKIEPDETCLISTGLAIYLG 60

Query: 57  LGTVGL-VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              V   + PRSGL  + G+ + N  G ID+DY+G + V   N   E P  I  GDRIAQ
Sbjct: 61  HSNVAATILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRGKE-PYTINPGDRIAQ 119

Query: 116 LVIQKXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
           LV+                T RG  G+GS+G+
Sbjct: 120 LVVLPILKAQFAVVEEFELTERGAGGFGSSGQ 151


>DUT_ACTSZ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.8 bits (203), Expect = 2e-18
 Identities = 50/140 (35%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  + PLP  A  G AG+DL A TD    I PG  +++ TG+++ +    +  ++ PRS
Sbjct: 12  RIGAQFPLPAYATTGSAGLDLRALTDEAFEIQPGETKLIPTGLSVYIADPQLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V + N   +KP  +  GDRIAQLV          
Sbjct: 72  GLGHKHGVVLGNLVGLIDSDYQGPLMVSMWNRS-DKPFKVEVGDRIAQLVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVAEFEQTDRGEGGFGHSGK 150


>DUT_PSEE4 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.4 bits (202), Expect = 2e-18
 Identities = 51/139 (36%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL  E PLP+ A  G AG+DL A    D V+ PG   ++ TG+++ +   G   ++ PRS
Sbjct: 12  RLGTEFPLPQYATPGSAGLDLRALLKEDTVLEPGQTLLIPTGLSVYIGDPGLAAMILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N     P  IT G+RIAQL++         
Sbjct: 72  GLGHKHGVVLGNLVGLIDSDYQGELMVSCWNRG-NTPFTITIGERIAQLILVPVVQAHFD 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  T RG  G+G +G
Sbjct: 131 IVEQFDETQRGTGGFGHSG 149


>DUT_PSEA7 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.4 bits (202), Expect = 2e-18
 Identities = 53/139 (38%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           RL  + PLP+ A  G AG+DL A    D V+ PG   ++ TG++I +   G   LV PRS
Sbjct: 12  RLGTDFPLPQYATPGSAGLDLRAMLEEDTVLGPGQTLLIPTGLSIHIADPGLAALVLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   E P  I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-ESPFTIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 LVEQFDESQRGAGGFGHSG 149


>DUT_KLULA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 82.4 bits (202), Expect = 2e-18
 Identities = 49/142 (34%), Positives = 73/142 (51%), Gaps = 4/142 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +K+     +  +P +     AG D++A+   VI    + I  T I+  +P+GT G + PR
Sbjct: 9   LKVQLRSADAKVPTKGSTTAAGYDIYASQPGVIPARGQGIAKTDISFTVPVGTYGRIAPR 68

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXXXX 125
           SGLA + G  I    G +D DY GE+ + L N   +K   I +GDR+AQL+++K      
Sbjct: 69  SGLAVKHG--IQTGAGVVDRDYTGEVGIVLFN-HSDKDFQINKGDRVAQLILEKIVEDAE 125

Query: 126 XXXXXXXXXTVRGDQGYGSTGK 147
                    T RG  G+GSTGK
Sbjct: 126 IVVVESLEETQRGAGGFGSTGK 147


>DUT_HAEDU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 82.4 bits (202), Expect = 2e-18
 Identities = 51/140 (36%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+ +E PLP  A  G AG+DL A  D+ I    G   ++ TGI++ +       ++ PRS
Sbjct: 13  RIGREFPLPTYATTGSAGLDLRALIDSAITVEAGQTVLIPTGISVYIADPNLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V + N   +KP  I  GDRIAQLV          
Sbjct: 73  GLGHKNGIVLGNLVGLIDSDYQGPLMVSIWNRS-DKPFTIEVGDRIAQLVFVPVVQASFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 132 IVTDFEQTSRGEGGFGHSGK 151


>DUT_CHLFF RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 82.4 bits (202), Expect = 2e-18
 Identities = 53/140 (37%), Positives = 71/140 (50%), Gaps = 4/140 (2%)

Query: 12  LDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVHPRSGL 69
           L+  + LP+ A  G +G DL A  +  IA  PG R +V TGI + +P G    V PRSGL
Sbjct: 7   LESGVDLPEYATEGASGADLRANIEEPIAVLPGQRVLVPTGIKMQIPQGYEVQVRPRSGL 66

Query: 70  AAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIM--ITRGDRIAQLVIQKXXXXXXX 127
           A + G+ +VN+PGTIDADYRGE+ + L N      I+    R                  
Sbjct: 67  ALKHGIMVVNSPGTIDADYRGEVCIILANFGESTFIIEPKMRXXXXXXXXXXXXKFIVVD 126

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG +G+G TG+
Sbjct: 127 QEEGLTTTSRGSRGFGHTGE 146


>DUT_YEAST RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 82.0 bits (201), Expect = 3e-18
 Identities = 49/141 (34%), Positives = 73/141 (51%), Gaps = 4/141 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +KI        +P +     AG D++A+ D  I    + +V T I+  +P+GT G + PR
Sbjct: 9   LKIQLRSASATVPTKGSATAAGYDIYASQDITIPAMGQGMVSTDISFTVPVGTYGRIAPR 68

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXXXX 125
           SGLA + G  I    G +D DY GE+KV L N   ++   I +GDR+AQL+++K      
Sbjct: 69  SGLAVKNG--IQTGAGVVDRDYTGEVKVVLFN-HSQRDFAIKKGDRVAQLILEKIVDDAQ 125

Query: 126 XXXXXXXXXTVRGDQGYGSTG 146
                    + RG  G+GSTG
Sbjct: 126 IVVVDSLEESARGAGGFGSTG 146


>DUT_PSEMY RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.0 bits (201), Expect = 3e-18
 Identities = 52/139 (37%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL +E PLP+ A  G AG+DL A    D V+ PG   ++ TG++I +   G   ++ PRS
Sbjct: 12  RLGQEFPLPQYATPGSAGLDLRAMLKEDIVLEPGQTVLIPTGLSIYIGDPGLAAMILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N     P  I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-HTPFTIAIGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  T RG  G+G +G
Sbjct: 131 LVEQFDETQRGAGGFGHSG 149


>DUT_HAEIN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.0 bits (201), Expect = 3e-18
 Identities = 52/140 (37%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    I PG  +++ TG++I +       ++ PRS
Sbjct: 12  RIGNEFPLPTYATEGSAGLDLRALIDESFEIQPGETKLIPTGLSIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V + N   E P  I  GDRIAQLV          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGPLMVSMWNRGNE-PFKIEVGDRIAQLVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVEDFQQTERGEGGFGHSGK 150


>DUT_HAEIG RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.0 bits (201), Expect = 3e-18
 Identities = 52/140 (37%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    I PG  +++ TG++I +       ++ PRS
Sbjct: 12  RIGNEFPLPTYATEGSAGLDLRALIDESFEIQPGETKLIPTGLSIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V + N   E P  I  GDRIAQLV          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGPLMVSMWNRGNE-PFKIEVGDRIAQLVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVEDFQQTERGEGGFGHSGK 150


>DUT_HAEIE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.0 bits (201), Expect = 3e-18
 Identities = 52/140 (37%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    I PG  +++ TG++I +       ++ PRS
Sbjct: 12  RIGNEFPLPTYATEGSAGLDLRALIDESFEIQPGETKLIPTGLSIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V + N   E P  I  GDRIAQLV          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGPLMVSMWNRGNE-PFKIEVGDRIAQLVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVEDFQQTERGEGGFGHSGK 150


>DUT_HAEI8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 82.0 bits (201), Expect = 3e-18
 Identities = 52/140 (37%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    I PG  +++ TG++I +       ++ PRS
Sbjct: 12  RIGNEFPLPTYATEGSAGLDLRALIDESFEIQPGETKLIPTGLSIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V + N   E P  I  GDRIAQLV          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGPLMVSMWNRGNE-PFKIEVGDRIAQLVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVEDFQQTERGEGGFGHSGK 150


>DUT_CANGA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score = 82.0 bits (201), Expect = 3e-18
 Identities = 49/122 (40%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 27  AGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDA 86
           AG D++A+ D VI    + +V T I+  +P GT G + PRSGLA + G  I    G +D 
Sbjct: 26  AGYDIYASADYVIPAMGQGMVPTDISFTVPEGTYGRIAPRSGLAVKHG--IQTGAGVVDR 83

Query: 87  DYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-XXXXXXXXXXXXXXTVRGDQGYGST 145
           DY GE+K+ L N   +K   I RGDR+AQL+++K               + RG  G+GST
Sbjct: 84  DYTGEVKIILFN-HSQKDFEIKRGDRVAQLILEKIVDDAEVVVVESLEDSQRGAGGFGST 142

Query: 146 GK 147
           GK
Sbjct: 143 GK 144


>DUT_SHESM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 51/139 (36%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG  +++ TGIAI +   G   ++ PRS
Sbjct: 13  RIGSEFPLPAYATPGSAGMDLRAMIDTTMTIAPGETQLIPTGIAIHVADPGLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   + P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DTPFTLEIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_SHESA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 51/139 (36%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG  +++ TGIAI +   G   ++ PRS
Sbjct: 13  RIGSEFPLPAYATPGSAGMDLRAMIDTTMTIAPGETQLIPTGIAIHVADPGLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   + P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DTPFTLEIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_PASMU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 51/140 (36%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  E PLP  A  G AG+DL A  DA   +  G   ++ TG+++ +   T+  ++ PRS
Sbjct: 12  RIGTEFPLPTYATEGSAGLDLRALIDAPMTVEAGQTVLIPTGLSLYIADPTLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V L N   E P  +  GDRIAQLV          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGPLMVSLWNRSTE-PFKVEVGDRIAQLVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 VVSDFAQTERGEGGFGHSGK 150


>DUT_METCA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 52/140 (37%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL  E+PLP  A  G AG+DL A  DA  V+ PG   ++ TG AI +       ++ PRS
Sbjct: 12  RLGNEIPLPHYATPGAAGLDLRACLDASLVLQPGETRLIPTGFAIHIGDPDLAAVLLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V   N  PE P  I  G+RIAQ+V          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQVLVSCWNRGPE-PFEIAVGERIAQMVFVPVVQVSFE 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  + R + G+G TG+
Sbjct: 131 QVEAFAESRRAEGGFGHTGR 150


>DUT_CHLCV RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 81.6 bits (200), Expect = 4e-18
 Identities = 54/144 (37%), Positives = 73/144 (50%), Gaps = 6/144 (4%)

Query: 9   IVRLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVHPR 66
           +  L+    LP+ A  G +G DL A  +  IA  PG R ++ TGI + +P G    V PR
Sbjct: 4   VCELESGADLPEYATEGASGADLRAHIEEPIAVLPGQRVLIPTGIKMQIPQGYEVQVRPR 63

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRI---AQLVIQKXXX 123
           SGLA + G+ +VN+PGTIDADYRGE+ + L N   E   +I    RI             
Sbjct: 64  SGLALKHGIMVVNSPGTIDADYRGEVCIILANFG-ESTFIIEPKMRIXXXXXXXXXXXKF 122

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      T RG +G+G TG+
Sbjct: 123 IVVDQEEGLTATSRGSRGFGHTGE 146


>DUT_SWPVK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 142

 Score = 81.3 bits (199), Expect = 5e-18
 Identities = 48/140 (34%), Positives = 72/140 (51%), Gaps = 3/140 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +K V+L     +P R+  G AG DL++     + P +R +V T I + +P    G + PR
Sbjct: 5   VKCVKLSNNAIIPNRSMSGSAGYDLYSAYSYTVKPYNRILVRTDICLMIPDKCYGRISPR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGL+    + I    G ID+DYRGEI +  IN +      I  GDRIAQ++ ++      
Sbjct: 65  SGLSLNYNIDI--GGGVIDSDYRGEIGIVFIN-NGCSDFNIKVGDRIAQIIFERVEYPIM 121

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   T RG+ G+GS+G
Sbjct: 122 EEVKCLEDTERGNSGFGSSG 141


>DUT_SHESW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 81.3 bits (199), Expect = 5e-18
 Identities = 51/139 (36%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG  +++ TGIAI +   G   ++ PRS
Sbjct: 13  RIGSEFPLPAYATLGSAGMDLRAMIDTTMTIAPGETQLIPTGIAIHVADPGLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N     P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-NSPFTLDIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_SHEPC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 81.3 bits (199), Expect = 5e-18
 Identities = 51/139 (36%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG  +++ TGIAI +   G   ++ PRS
Sbjct: 13  RIGSEFPLPAYATLGSAGMDLRAMIDTTMTIAPGETQLIPTGIAIHVADPGLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N     P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-NSPFTLDIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_SHEB5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 80.9 bits (198), Expect = 7e-18
 Identities = 51/139 (36%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG   ++ TGIAI +   G   ++ PRS
Sbjct: 13  RIGSEFPLPAYATPGSAGMDLRAMIDTTLTIAPGETVLIPTGIAIHVADQGLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   + P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DSPFALEIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_DICDI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 179

 Score = 80.9 bits (198), Expect = 7e-18
 Identities = 47/139 (33%), Positives = 72/139 (51%), Gaps = 3/139 (2%)

Query: 8   KIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRS 67
           K+ +L  +  +P+R  +G AG DL +  + V+    + +  T + IA+P GT G + PRS
Sbjct: 39  KVKKLSDKAIIPQRGSKGAAGYDLSSAHELVVPAHGKALAMTDLQIAIPDGTYGRIAPRS 98

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GLA +  +      G ID+DYRG + V L N   +    +  GDR+AQL+ ++       
Sbjct: 99  GLAWKNFIDC--GAGVIDSDYRGNVGVVLFN-HSDVDFKVAVGDRVAQLIFERIVTPEPL 155

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  T RG  G+GSTG
Sbjct: 156 EVDEIDETQRGAGGFGSTG 174


>DUT_BLOPB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 80.9 bits (198), Expect = 7e-18
 Identities = 56/142 (39%), Positives = 75/142 (52%), Gaps = 6/142 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV-G 61
           +KI+  R+ K   LPK A  G AG+DL A  D    I PG   ++ TGIAI +    + G
Sbjct: 6   VKIIDNRIYKHFYLPKYATSGSAGLDLSACLDKPLTIYPGKTHLISTGIAIHISDTKIAG 65

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           ++ PRSGL  + G+ + N  G ID+DY+GE+ V L N  P+K I +  G RIAQLV    
Sbjct: 66  VILPRSGLGHKYGIVLGNLVGLIDSDYQGELIVSLWNRGPKKYI-VYPGKRIAQLVFMPI 124

Query: 122 XXXXXXXXXXXXXTVRGDQGYG 143
                        T RG  G+G
Sbjct: 125 IQVRFSIVKSFIPTERGPHGFG 146


>DUT_SHEB9 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 80.5 bits (197), Expect = 9e-18
 Identities = 51/139 (36%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG   ++ TGIAI +   G   ++ PRS
Sbjct: 13  RIGSEFPLPAYATPGSAGMDLRAMIDTTLTIAPGETVLIPTGIAIHVADPGLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   + P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DSPFALEIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_SHEB8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 80.5 bits (197), Expect = 9e-18
 Identities = 51/139 (36%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG   ++ TGIAI +   G   ++ PRS
Sbjct: 13  RIGSEFPLPAYATPGSAGMDLRAMIDTTLTIAPGETVLIPTGIAIHVADPGLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   + P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DSPFALEIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_SHEB2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 80.5 bits (197), Expect = 9e-18
 Identities = 51/139 (36%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG   ++ TGIAI +   G   ++ PRS
Sbjct: 13  RIGSEFPLPAYATPGSAGMDLRAMIDTTLTIAPGETVLIPTGIAIHVADPGLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   + P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DSPFALEIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_PSEPW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 80.5 bits (197), Expect = 9e-18
 Identities = 51/139 (36%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL  E PLP+ A  G AG+DL A    D V+ PG   ++ TG++I +   G   ++ PRS
Sbjct: 12  RLGSEFPLPQYATPGSAGLDLRALLKEDTVLEPGQTLLIPTGLSIYIGDPGLAAMILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N     P  I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-NTPFTIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 VVEAFDESQRGTGGFGHSG 149


>DUT_HAHCH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 80.5 bits (197), Expect = 9e-18
 Identities = 53/139 (38%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           RL  E+PLP  A  G AG+DL A       + PG   ++ TG+AI L   G   ++ PRS
Sbjct: 13  RLGNEIPLPAYATDGSAGLDLRACLAEPVTLQPGETTLIPTGMAIHLSDPGLAAMLLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   E    I+ G+RIAQ+VI         
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGEVMVSCWNRGNE-AFTISVGERIAQMVIVPVVQVGFE 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+GSTG
Sbjct: 132 IVDDFDDSSRGAGGFGSTG 150


>DUT_BRASB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 80.5 bits (197), Expect = 9e-18
 Identities = 60/106 (56%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 42  GHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDP 101
           G   +V TG+++ALP G    V PRSGLAAR G++++NAPGT+DADYRGEI V LIN   
Sbjct: 48  GSHAMVPTGLSLALPDGYEAQVRPRSGLAARHGVTVLNAPGTVDADYRGEICVLLINHGK 107

Query: 102 EKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
           E P  I RG+                          G  G+GSTG+
Sbjct: 108 E-PFTIRRGEXXXXXXXXXXXXXXXXXXXXXXXXXXGSGGFGSTGR 152


>DUT_ALCBS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 80.5 bits (197), Expect = 9e-18
 Identities = 49/140 (35%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           RL   +PLP  A  G AG+DL A       + PG  E++ TG++I +   G  G++ PRS
Sbjct: 11  RLGDSIPLPHYATDGSAGLDLRAMVKEPLTLQPGDTELLPTGMSIFIDDPGYAGMILPRS 70

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   ++P  +  G+R+AQLVI         
Sbjct: 71  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QQPFTLEPGERVAQLVIVPVMQVELK 129

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  + RG+ G+G +G+
Sbjct: 130 QVESFSASKRGEGGFGHSGR 149


>DUT_SHESR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 80.1 bits (196), Expect = 1e-17
 Identities = 51/139 (36%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG  +++ TGIAI +   G   ++ PRS
Sbjct: 13  RIGSEFPLPAYATLGSAGMDLRAMIDTTMTIAPGETQLIPTGIAIHVADPGLAAVLLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   + P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DIPFTLEIGDRLAQLVFVPVVQAQFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDSSDRGEGGFGHSG 150


>DUT_SHEHH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 80.1 bits (196), Expect = 1e-17
 Identities = 53/139 (38%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  E PLP  A  G AG+DL A TD   VI PG   ++ TGIAI +   ++  ++ PRS
Sbjct: 13  RIGTEFPLPAYATPGSAGMDLRAITDTQLVIQPGETVLIPTGIAIHVADPSLAAIILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   E P  I  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRGSE-PFTIEIGDRLAQLVFVPVVQAEFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 132 LVDEFNQSDRGTGGFGHSG 150


>DUT_MANSM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 80.1 bits (196), Expect = 1e-17
 Identities = 50/140 (35%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  +    + PG  +++ TG++I +       ++ PRS
Sbjct: 12  RIGNEFPLPAYATSGSAGLDLRALIEEGFDLQPGETKLIPTGLSIYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V + N   E+P  I  GDRIAQLV          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGPLMVSMWNRG-EQPFRIEVGDRIAQLVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVTDFTQTERGEGGFGHSGK 150


>DUT_VACCP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 79.7 bits (195), Expect = 1e-17
 Identities = 49/142 (34%), Positives = 71/142 (50%), Gaps = 4/142 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +P++ V+       P R   G AG DL++  D  I PG R+++ T I++++P    G + 
Sbjct: 8   SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKICYGRIA 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ +               YRG I V LIN + +    +  GDRIAQL+ Q+    
Sbjct: 68  PRSGLSLK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYP 123

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RGDQG+GSTG
Sbjct: 124 ELEEVQSLDSTNRGDQGFGSTG 145


>DUT_VACCC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 79.7 bits (195), Expect = 1e-17
 Identities = 49/142 (34%), Positives = 71/142 (50%), Gaps = 4/142 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +P++ V+       P R   G AG DL++  D  I PG R+++ T I++++P    G + 
Sbjct: 8   SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKICYGRIA 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ +               YRG I V LIN + +    +  GDRIAQL+ Q+    
Sbjct: 68  PRSGLSLK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYP 123

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RGDQG+GSTG
Sbjct: 124 ELEEVQSLDSTNRGDQGFGSTG 145


>DUT_VACCA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 79.7 bits (195), Expect = 1e-17
 Identities = 49/142 (34%), Positives = 71/142 (50%), Gaps = 4/142 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +P++ V+       P R   G AG DL++  D  I PG R+++ T I++++P    G + 
Sbjct: 8   SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKICYGRIA 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ +               YRG I V LIN + +    +  GDRIAQL+ Q+    
Sbjct: 68  PRSGLSLK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYP 123

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RGDQG+GSTG
Sbjct: 124 ELEEVQSLDSTNRGDQGFGSTG 145


>DUT_SHEPA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 79.7 bits (195), Expect = 1e-17
 Identities = 53/139 (38%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  E PLP  A  G AG+DL A TD   VI PG   ++ TGIAI +   ++  ++ PRS
Sbjct: 13  RIGTEFPLPAYATPGSAGMDLRAITDTQLVIQPGETVLIPTGIAIHVADPSLAAIILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   E P  I  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRGSE-PFTIEIGDRLAQLVFVPVVQAEFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 132 LVDEFNQSDRGAGGFGHSG 150


>DUT_SHEWM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 79.3 bits (194), Expect = 2e-17
 Identities = 50/139 (35%), Positives = 74/139 (53%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  E PLP  A  G AG+DL A   T   +APG   ++ TGI+I +   ++  ++ PRS
Sbjct: 13  RIGSEYPLPAYATPGSAGMDLRAMIETSLSVAPGETRLIPTGISIHVADPSLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   +KP  I  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRG-DKPYTIEIGDRLAQLVFVPVVQAEFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  ++RG+ G+G +G
Sbjct: 132 LVDEFDNSLRGEGGFGHSG 150


>DUT_PSEPG RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 79.3 bits (194), Expect = 2e-17
 Identities = 51/139 (36%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL  E PLP  A  G AG+DL A    D V+ PG   ++ TG++I +   G   ++ PRS
Sbjct: 12  RLGSEFPLPTYATPGSAGLDLRALLKEDTVLEPGQTLLIPTGLSIYIGDPGLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N     P  I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRS-NTPFTIAVGERIAQLVLVPVVQAHFD 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 IVEAFDESQRGAGGFGHSG 149


>DUT_CHLAB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 79.3 bits (194), Expect = 2e-17
 Identities = 53/144 (36%), Positives = 72/144 (50%), Gaps = 6/144 (4%)

Query: 9   IVRLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVGLVHPR 66
           +  L+  + LP+ A  G +G DL A     +A  PG R +V TGI + +P G    V PR
Sbjct: 4   LCELESGVSLPEYATEGASGADLRANIKEPMAVLPGQRVLVPTGIKMQIPQGYEVQVRPR 63

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRI---AQLVIQKXXX 123
           SG A + G+ +VN+PGTIDADYRGE+ + L N   E   +I    RI             
Sbjct: 64  SGFALKHGIMVVNSPGTIDADYRGEVCIILANFG-ESTFIIEPKMRIXXXXXXXXXXXKF 122

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      T RG +G+G TG+
Sbjct: 123 IAVDQEEGLTTTSRGSRGFGHTGE 146


>DUT_THIDA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 146

 Score = 79.0 bits (193), Expect = 3e-17
 Identities = 55/144 (38%), Positives = 75/144 (52%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALP-LGTVGLV 63
           +KI+       LP  A  G AG+DL A  DA I  APG   +V TG+AI L   G   L+
Sbjct: 3   VKILDARLRDQLPHYATPGAAGLDLRACIDAPITLAPGETRLVPTGMAIHLADPGYAALI 62

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSGL  + G+ + N  G ID+DY+G++ V   N   E+   +   +R+AQLVI     
Sbjct: 63  LPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSAWNRS-EQSFELVPLERLAQLVIVPVVQ 121

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      T RG+ G+GSTG+
Sbjct: 122 ARFNIVEAFETTARGEGGFGSTGR 145


>DUT_SERP5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 79.0 bits (193), Expect = 3e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+ K+ PLP  A  G AG+DL A  D+ +  APG  +++ TG+AI +       ++ PRS
Sbjct: 13  RIGKDFPLPTYATPGSAGLDLRACLDSAVELAPGETQLLPTGLAIHIADTDLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +K   I  G+RIAQ+V          
Sbjct: 73  GLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QKSFTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  + RG  G+G +G+
Sbjct: 132 LVEEFDSSERGAGGFGHSGR 151


>DUT_PSEPK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 79.0 bits (193), Expect = 3e-17
 Identities = 50/139 (35%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL  E PLP  A  G AG+DL A    D ++ PG   ++ TG++I +   G   ++ PRS
Sbjct: 12  RLGSEFPLPAYATPGSAGLDLRALLKEDTILEPGQTVLIPTGLSIYIGDPGLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N     P  I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-NTPFTIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 IVEAFDESQRGAGGFGHSG 149


>DUT_NEIG2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 79.0 bits (193), Expect = 3e-17
 Identities = 54/133 (40%), Positives = 72/133 (54%), Gaps = 6/133 (4%)

Query: 18  LPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIAL--PLGTVGLVHPRSGLAARE 73
           +P  A  G AG+DL A  D   V+ PG   +V TG+AI L  P  T  L+ PRSGL  + 
Sbjct: 18  IPAYATEGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLANPAYTAVLL-PRSGLGHKH 76

Query: 74  GLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXX 133
           G+ + N  G ID+DY+GE+KV L N   E P  +   +RIAQ+VI               
Sbjct: 77  GIVLGNLVGLIDSDYQGELKVSLWNRGSE-PFTVKPFERIAQMVIVPVVQAGFKRVEEFV 135

Query: 134 XTVRGDQGYGSTG 146
            + RG+ G+GSTG
Sbjct: 136 GSSRGEGGFGSTG 148


>DUT_ACIAD RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 79.0 bits (193), Expect = 3e-17
 Identities = 50/140 (35%), Positives = 72/140 (51%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL +E PLP  A  G AG+DL A  D  I   PG   ++ TG+AI +      GL+ PRS
Sbjct: 11  RLGQEWPLPSYATTGSAGLDLRACLDEAIQIEPGQTVLIKTGMAIYIHDTNFAGLILPRS 70

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ + + N   +    +  G+R+AQ V+         
Sbjct: 71  GLGHKHGIVLGNLVGLIDSDYQGELMISVWNRG-QNTFTLEPGERLAQYVLVPVIQAEFE 129

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG  G+G TG+
Sbjct: 130 QVEEFVATDRGAGGFGHTGQ 149


>DUT_FOWPV RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 145

 Score = 78.6 bits (192), Expect = 3e-17
 Identities = 47/143 (32%), Positives = 73/143 (51%), Gaps = 6/143 (4%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           + + ++     LP +     AG DL++  D VI P ++E++ T I + +P G  G + PR
Sbjct: 4   VTVYKISDRAKLPYKQTSYSAGYDLYSAYDYVIEPMNKELIKTDIILKIPNGYYGRIAPR 63

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK---XXX 123
           SGLA    + +    G ID+DYRG + V L N    +   + +GDRIAQ++ +K      
Sbjct: 64  SGLAYNYFIDV--GAGVIDSDYRGNVGVLLFNFGSTQ-FNVCKGDRIAQIIFEKIAYPKI 120

Query: 124 XXXXXXXXXXXTVRGDQGYGSTG 146
                      T RG+ G+GSTG
Sbjct: 121 IEVTTLEEINITDRGNSGFGSTG 143


>DUT_THICR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 52/140 (37%), Positives = 74/140 (52%), Gaps = 5/140 (3%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           RL KE+ +P    +G AG+DL A    D +I PG   ++ TG+AI L   G   ++ PRS
Sbjct: 13  RLGKEIEMPHYGTKGSAGLDLRACIENDMIIEPGQTVLIPTGMAIHLDDPGLAAMLLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI-QKXXXXXX 126
           GL  + G+ + N  G ID+DY+G + V   N   E+   +T G+RIAQ+VI         
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-EEAYNVTVGERIAQMVIVPVLQPVFT 131

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   T RG+ G+G TG
Sbjct: 132 QVEEFGDATERGEGGFGHTG 151


>DUT_SHISS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDSTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_SHIDS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_SHIBS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_SHIB3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_SHEDO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/139 (34%), Positives = 74/139 (53%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  + PLP  A  G AG+DL A  D    +APG  +++ TGIAI +   ++  ++ PRS
Sbjct: 13  RIGTQFPLPAYATPGSAGMDLRAMVDTELTLAPGETKLIPTGIAIHVADPSLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   + P  +T G+R+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS-DTPFTLTLGERLAQLVFVPVVQAQFT 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFERSDRGEGGFGHSG 150


>DUT_SHEAM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 49/139 (35%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  E PLP  A  G AG+DL A  D    IAPG   ++ TGIA+ +   ++  ++ PRS
Sbjct: 13  RIGSEFPLPAYATPGSAGMDLRAMLDTNLTIAPGETVLIPTGIAVHVADPSLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           G+  + G+ + N  G ID+DY+G + V   N   E P  +  GDR+AQLV          
Sbjct: 73  GMGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRGNE-PYTLQIGDRLAQLVFVPVVQAEFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  ++RG+ G+G +G
Sbjct: 132 LVDEFDTSMRGEGGFGHSG 150


>DUT_PHOLL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           R+ +E PLP  A  G AG+DL A  D  +  APG  E++ TG+AI +       ++ PRS
Sbjct: 13  RIGEEFPLPTYATPGSAGLDLRACLDNAVELAPGQTELLPTGLAIHIGDEQLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +K   I  G+RIAQ+V          
Sbjct: 73  GLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-DKAFTIQPGERIAQIVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  + RG  G+G +G+
Sbjct: 132 LVEDFETSERGSGGFGHSGR 151


>DUT_ESCF3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECOUT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 13  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDN-FTIQPGERIAQMIFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEDFDATDRGEGGFGHSGR 151


>DUT_ECOSM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 13  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEDFDATDRGEGGFGHSGR 151


>DUT_ECOSE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 13  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEDFDATDRGEGGFGHSGR 151


>DUT_ECOLU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECOLC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 13  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEDFDATDRGEGGFGHSGR 151


>DUT_ECOL6 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECOL5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 13  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEDFDATDRGEGGFGHSGR 151


>DUT_ECOK1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 13  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDN-FTIQPGERIAQMIFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEDFDATDRGEGGFGHSGR 151


>DUT_ECOHS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECO8A RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECO81 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDN-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECO7I RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQIIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECO5E RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 13  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEDFDATDRGEGGFGHSGR 151


>DUT_ECO57 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECO55 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECO45 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDN-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECO27 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECO24 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 78.2 bits (191), Expect = 4e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_SHIFL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 13  RVRKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEDFDATDRGEGGFGHSGR 151


>DUT_SHIF8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVRKEFPLPTYATSGSAGLDLRACLDDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_SALAR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDGAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEAFDATERGEGGFGHSGR 151


>DUT_PSEU5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 51/139 (36%), Positives = 74/139 (53%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           RL ++ PLP+ A  G AG+DL A    D V+ PG   ++ TG+AI +   T+  LV PRS
Sbjct: 12  RLGRDFPLPEYATPGSAGLDLRAMLQQDTVLEPGQTLLIPTGLAIHIADPTLAALVLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   +    I  G+RIAQL++         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QSAFTIAVGERIAQLMLVPVVQARFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 LVDSFDSSDRGAGGFGHSG 149


>DUT_PSEP1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 50/139 (35%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           RL  E PLP  A  G AG+DL A    D ++ PG   ++ TG++I +   G   ++ PRS
Sbjct: 12  RLGSEFPLPAYATPGSAGLDLRALLKEDTLLEPGQTILIPTGLSIYIGDPGLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N     P  I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-NTPFTIAVGERIAQLVLVPVVQAHFD 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 IVEAFDESQRGAGGFGHSG 149


>DUT_PSEFS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 51/139 (36%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A    D V+ PG   ++ TG++I +   G   L+ PRS
Sbjct: 12  RIGNEFPLPAYATPGSAGLDLRAMLKEDTVLEPGQTLLIPTGLSIYVGDPGLAALILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   +    I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QTAFNIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  T RG  G+G +G
Sbjct: 131 LVEEFDETQRGAGGFGHSG 149


>DUT_NEIMA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 52/132 (39%), Positives = 71/132 (53%), Gaps = 4/132 (3%)

Query: 18  LPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREG 74
           +P  A +G AG+DL A  D   V+ PG   +V TG+AI L   +   V  PRSGL  + G
Sbjct: 18  VPVYATKGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLADPSYAAVLLPRSGLGHKHG 77

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+GE+KV L N   E P  +   +RIAQ+VI                
Sbjct: 78  IVLGNLVGLIDSDYQGELKVSLWNRSSE-PFTVKPFERIAQMVIVPIVQARFKRVEEFVG 136

Query: 135 TVRGDQGYGSTG 146
           + RG+ G+GSTG
Sbjct: 137 SSRGEGGFGSTG 148


>DUT_HAEPS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 49/140 (35%), Positives = 71/140 (50%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A  +    +  G   ++ TGI++ +       ++ PRS
Sbjct: 12  RIGTEFPLPTYATTGSAGLDLRALIEQPLTVEAGQTVLIPTGISVYIADPNLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V L N   +KP  +  GDRIAQLV          
Sbjct: 72  GLGHKNGIVLGNLIGLIDSDYQGPLMVSLWNRS-DKPFTVEVGDRIAQLVFVPVVQAQFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +GK
Sbjct: 131 IVEEFTATDRGEGGFGHSGK 150


>DUT_ECOLI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 50/140 (35%), Positives = 77/140 (55%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHAT-TDAV-IAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A   DAV +APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECODH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 50/140 (35%), Positives = 77/140 (55%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHAT-TDAV-IAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A   DAV +APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_ECOBW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.8 bits (190), Expect = 6e-17
 Identities = 50/140 (35%), Positives = 77/140 (55%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHAT-TDAV-IAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ KE PLP  A  G AG+DL A   DAV +APG   +V TG+AI +   ++  ++ PRS
Sbjct: 12  RVGKEFPLPTYATSGSAGLDLRACLNDAVELAPGDTTLVPTGLAIHIADPSLAAMMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ + + N   +    I  G+RIAQ++          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMISVWNRGQDS-FTIQPGERIAQMIFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEDFDATDRGEGGFGHSGR 150


>DUT_NEIM0 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 77.4 bits (189), Expect = 7e-17
 Identities = 52/132 (39%), Positives = 69/132 (52%), Gaps = 4/132 (3%)

Query: 18  LPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREG 74
           +P  A  G AG+DL A  D   V+ PG   +V TG+AI L       V  PRSGL  + G
Sbjct: 18  IPAYATEGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLANPAYAAVLLPRSGLGHKHG 77

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+GE+KV L N   E P  +   +RIAQ+VI                
Sbjct: 78  IVLGNLVGLIDSDYQGELKVSLWNRGSE-PFAVKPFERIAQMVIVPVVQAGFKRVEEFVG 136

Query: 135 TVRGDQGYGSTG 146
           + RG+ G+GSTG
Sbjct: 137 SSRGEGGFGSTG 148


>DUT_NEIG1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 77.4 bits (189), Expect = 7e-17
 Identities = 52/132 (39%), Positives = 69/132 (52%), Gaps = 4/132 (3%)

Query: 18  LPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREG 74
           +P  A  G AG+DL A  D   V+ PG   +V TG+AI L       V  PRSGL  + G
Sbjct: 18  IPAYATEGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLANPAYAAVLLPRSGLGHKHG 77

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+GE+KV L N   E P  +   +RIAQ+VI                
Sbjct: 78  IVLGNLVGLIDSDYQGELKVSLWNRGSE-PFAVKPFERIAQMVIVPVVQAGFKRVEEFVG 136

Query: 135 TVRGDQGYGSTG 146
           + RG+ G+GSTG
Sbjct: 137 SSRGEGGFGSTG 148


>DUT_YERPS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 6/146 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVG 61
           IKI+  R+  E PLP  A  G AG+DL A  D  +   PG   ++ TG+AI +       
Sbjct: 6   IKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPGQTTLLPTGLAIHIGDSALAA 65

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           ++ PRSGL  + G+ + N  G ID+DY+G++ V + N   ++P  I  G+RIAQ+V    
Sbjct: 66  VILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPV 124

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGK 147
                        + RG  G+G +G+
Sbjct: 125 VQAEFNLVEDFTDSERGTGGFGHSGR 150


>DUT_YERPG RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 6/146 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVG 61
           IKI+  R+  E PLP  A  G AG+DL A  D  +   PG   ++ TG+AI +       
Sbjct: 6   IKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPGQTTLLPTGLAIHIGDSALAA 65

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           ++ PRSGL  + G+ + N  G ID+DY+G++ V + N   ++P  I  G+RIAQ+V    
Sbjct: 66  VILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPV 124

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGK 147
                        + RG  G+G +G+
Sbjct: 125 VQAEFNLVEDFTDSERGTGGFGHSGR 150


>DUT_YERPE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 6/146 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVG 61
           IKI+  R+  E PLP  A  G AG+DL A  D  +   PG   ++ TG+AI +       
Sbjct: 6   IKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPGQTTLLPTGLAIHIGDSALAA 65

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           ++ PRSGL  + G+ + N  G ID+DY+G++ V + N   ++P  I  G+RIAQ+V    
Sbjct: 66  VILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPV 124

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGK 147
                        + RG  G+G +G+
Sbjct: 125 VQAEFNLVEDFTDSERGTGGFGHSGR 150


>DUT_YERP3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 50/146 (34%), Positives = 76/146 (52%), Gaps = 6/146 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVG 61
           IKI+  R+  E PLP  A  G AG+DL A  D  +   PG   ++ TG+AI +       
Sbjct: 6   IKILDPRVGNEFPLPTYATEGSAGLDLRACLDHAVELQPGQTTLLPTGLAIHIGDSALAA 65

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           ++ PRSGL  + G+ + N  G ID+DY+G++ V + N   ++P  I  G+RIAQ+V    
Sbjct: 66  VILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPV 124

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGK 147
                        + RG  G+G +G+
Sbjct: 125 VQAEFNLVEDFTDSERGTGGFGHSGR 150


>DUT_VARV RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 48/142 (33%), Positives = 70/142 (49%), Gaps = 4/142 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +P++ V+       P R     AG DL++  D  I PG R+++ T I++++P    G + 
Sbjct: 8   SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIA 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ +               YRG I V LIN + +    +  GDRIAQL+ Q+    
Sbjct: 68  PRSGLSLK---XXXXXXXXXXXXYRGNIGVILIN-NGKYTFNVNTGDRIAQLIYQRIYYP 123

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RGDQG+GSTG
Sbjct: 124 ELKEVQSLDSTDRGDQGFGSTG 145


>DUT_SHEFN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 50/145 (34%), Positives = 77/145 (53%), Gaps = 6/145 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTVG- 61
           +KI+  R+  E PLP  A  G AG+DL A  D   VI P    ++ TGIAI +   ++  
Sbjct: 7   LKIIDSRIGNEFPLPAYATPGSAGMDLRAMIDTAMVIEPSQTVLIPTGIAIHVADPSLAA 66

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           ++ PRSG+  + G+ + N  G ID+DY+G++ V   N   +KP  +  GDR+AQL+    
Sbjct: 67  VILPRSGMGHKHGIVLGNLVGLIDSDYQGQLMVSCWNRS-DKPFTLEIGDRLAQLMFVPV 125

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTG 146
                        + RG+ G+G +G
Sbjct: 126 IQATFAVVDEFNSSDRGEGGFGHSG 150


>DUT_SALTY RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 12  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEAFDATERGEGGFGHSGR 150


>DUT_SALTI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 12  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEAFDATERGEGGFGHSGR 150


>DUT_SALSV RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEAFDATERGEGGFGHSGR 151


>DUT_SALPK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 12  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEAFDATERGEGGFGHSGR 150


>DUT_SALPC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEAFDATERGEGGFGHSGR 151


>DUT_SALPB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEAFDATERGEGGFGHSGR 151


>DUT_SALPA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 12  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEAFDATERGEGGFGHSGR 150


>DUT_SALNS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEAFDATERGEGGFGHSGR 151


>DUT_SALHS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEAFDATERGEGGFGHSGR 151


>DUT_SALG2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 12  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEAFDATERGEGGFGHSGR 150


>DUT_SALEP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 12  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 131 LVEAFDATERGEGGFGHSGR 150


>DUT_SALDC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEAFDATERGEGGFGHSGR 151


>DUT_SALCH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEAFDATERGEGGFGHSGR 151


>DUT_SALA4 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEAFDATERGEGGFGHSGR 151


>DUT_CWPXG RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 48/142 (33%), Positives = 70/142 (49%), Gaps = 4/142 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +P++ V+       P R   G AG DL++  D  I PG R+++ T I++++P    G + 
Sbjct: 8   SPVRFVKETNRAKSPTRQSPGAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIA 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ +               YRG I V LIN + +    +  GDRIAQL+ Q+    
Sbjct: 68  PRSGLSLK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYP 123

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RG QG+GSTG
Sbjct: 124 ELEEVQSLDSTDRGAQGFGSTG 145


>DUT_ANTLO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 143

 Score = 77.0 bits (188), Expect = 1e-16
 Identities = 48/140 (34%), Positives = 69/140 (49%), Gaps = 3/140 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           I + RL  +  +P R   G A  DL+A  D V+AP  R+++ TG+ I +PL   G ++ R
Sbjct: 5   ITVKRLFSDAKIPVRHSEGAAAYDLYAYEDTVVAPNERKVIATGVRITVPLSCQGTIYSR 64

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA +  + I      I      +I V + N   + P  + +GDRIAQ+V  K      
Sbjct: 65  SGLALKYCIEIFGV--NIGPGETKDIVVDIYN-HGKMPFNVAKGDRIAQIVFIKLFGGDL 121

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   T RG  G+GSTG
Sbjct: 122 HEVSELSDTKRGSCGWGSTG 141


>DUT_XYLFM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 76.6 bits (187), Expect = 1e-16
 Identities = 66/148 (44%), Positives = 82/148 (55%), Gaps = 8/148 (5%)

Query: 6   PIKIVRLDKEL----PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGT 59
           P++I  LD  L    PLP  A    AG+DL A  DA   + PG  E++ TGIAI L   +
Sbjct: 7   PLQIKILDPRLGTVWPLPTYATEASAGLDLRAALDAPMTLVPGDAELLSTGIAIHLVDPS 66

Query: 60  V-GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           +  +V PRSGL  R G+ + N  G ID+DY+G + V L N   E    I  GDRIAQ   
Sbjct: 67  LCAVVLPRSGLGHRHGIVLGNGTGLIDSDYQGPLLVSLWNRGRE-AFTIEPGDRIAQXXX 125

Query: 119 QKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
                           + RG  G+G TG
Sbjct: 126 XXXXXXXXXXXDTFVESGRGAGGFGHTG 153


>DUT_VACCW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score = 76.6 bits (187), Expect = 1e-16
 Identities = 48/142 (33%), Positives = 70/142 (49%), Gaps = 4/142 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +P++ V+       P R     AG DL++  D  I PG R+++ T I++++P    G + 
Sbjct: 5   SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIA 64

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ +               YRG I V LIN + +    +  GDRIAQL+ Q+    
Sbjct: 65  PRSGLSLK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYP 120

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RGDQG+GSTG
Sbjct: 121 ELEEVQSLDSTNRGDQGFGSTG 142


>DUT_SHELP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 76.6 bits (187), Expect = 1e-16
 Identities = 48/139 (34%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  + PLP  A  G AG+DL A   T  VI PG  +++ TGIA+ +   ++  ++ PRS
Sbjct: 13  RIGSQFPLPAYATPGSAGMDLRAMIETTMVIQPGETQLIPTGIAVHVADPSLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           G+  + G+ + N  G ID+DY+G + V   N   E P  +  GDR+AQLV          
Sbjct: 73  GMGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRSNE-PFTLEIGDRLAQLVFVPVVQAEFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDTSDRGEGGFGHSG 150


>DUT_RABPU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 76.6 bits (187), Expect = 1e-16
 Identities = 48/142 (33%), Positives = 70/142 (49%), Gaps = 4/142 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +P++ V+       P R     AG DL++  D  I PG R+++ T I++++P    G + 
Sbjct: 8   SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYDYTIPPGERQLIKTDISMSMPKFCYGRIA 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ +               YRG I V LIN + +    +  GDRIAQL+ Q+    
Sbjct: 68  PRSGLSLK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYP 123

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RGDQG+GSTG
Sbjct: 124 ELEEVQSLDSTDRGDQGFGSTG 145


>DUT_PRB01 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 139

 Score = 76.6 bits (187), Expect = 1e-16
 Identities = 47/138 (34%), Positives = 75/138 (54%), Gaps = 4/138 (2%)

Query: 12  LDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSG 68
           +  ++PLP+   +G AG+DL A  D+ ++   G  +++  G A+ L   G   +V PRSG
Sbjct: 1   MGSKIPLPQYETKGSAGLDLRACLDSNLSLQAGTSQLIPIGFAMYLEDPGLAAMVIPRSG 60

Query: 69  LAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXX 128
           L ++ G+ + N  G ID+DY+GE+ V   N   +    I  GDRIAQ++I          
Sbjct: 61  LGSKHGIVLGNLVGLIDSDYQGELMVPAWNRS-DTDFEINPGDRIAQMIIVPVIQADFEI 119

Query: 129 XXXXXXTVRGDQGYGSTG 146
                 T RG++G+GS+G
Sbjct: 120 VDEFNETQRGEKGFGSSG 137


>DUT_NEIMB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 76.6 bits (187), Expect = 1e-16
 Identities = 51/132 (38%), Positives = 69/132 (52%), Gaps = 4/132 (3%)

Query: 18  LPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREG 74
           +P  A  G AG+DL A  D   V+ PG   +V TG+AI L       V  PRSGL  + G
Sbjct: 18  VPVYATEGSAGLDLRACLDEEVVLQPGETFLVPTGLAIYLANPAYAAVLLPRSGLGHKHG 77

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+GE+KV L N   E P  +   +RIAQ+V+                
Sbjct: 78  IVLGNLVGLIDSDYQGELKVSLWNRSSE-PFTVKPFERIAQMVVVPIVQAGFKRVEEFVG 136

Query: 135 TVRGDQGYGSTG 146
           + RG+ G+GSTG
Sbjct: 137 SSRGEGGFGSTG 148


>DUT_CITK8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 76.6 bits (187), Expect = 1e-16
 Identities = 49/140 (35%), Positives = 74/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVGLVH-PRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   +V TG+AI +   ++  V  PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLVPTGLAIHIADPSLAAVMLPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSIWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEEFEATDRGEGGFGHSGR 151


>DUT_TOLAT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 76.3 bits (186), Expect = 2e-16
 Identities = 46/110 (41%), Positives = 65/110 (59%), Gaps = 4/110 (3%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+  E PLP+ A  G AG+DL A  DA  V+APG  +++ TG+AI +   G    + PRS
Sbjct: 12  RIGNEFPLPEYATPGSAGLDLRACLDAAVVLAPGETQLIPTGLAIHIADPGLCATILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLV 117
           GL  + G+ + N  G ID+DY+G++ V + N        I  G+RIAQLV
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRG-NTTFTIQPGERIAQLV 120


>DUT_SHEPW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 76.3 bits (186), Expect = 2e-16
 Identities = 50/139 (35%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  + PLP  A  G AG+DL A TD    I PG   ++ TGIA+ +   ++  ++ PRS
Sbjct: 13  RIGTQFPLPAYATLGSAGMDLRAITDIALTIQPGETVLIPTGIAVHVADPSLAAIILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   E P  I  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRGSE-PFTIEIGDRLAQLVFVPVVQAEFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 132 LVDEFDSSDRGAGGFGHSG 150


>DUT_PSE14 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 76.3 bits (186), Expect = 2e-16
 Identities = 50/139 (35%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A    D V+ PG   ++ TG++I +   G   L+ PRS
Sbjct: 12  RIGNEFPLPAYATVGSAGLDLRAMLKEDTVLEPGQTLLIPTGLSIYIGDPGLAALILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   +    I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QTAFNIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 LVEAFDESQRGAGGFGHSG 149


>DUT_PSESM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 49/139 (35%), Positives = 71/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A    D ++ PG   ++ TG++I +   G   L+ PRS
Sbjct: 12  RIGNEFPLPAYATVGSAGLDLRAMLKEDTLLEPGQTLLIPTGLSIYIGDPGLAALILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   +    I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QTAFTIAVGERIAQLVLVPVVQARFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 LVEEFDESQRGTGGFGHSG 149


>DUT_PSEF5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 48/139 (34%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           R+  E PLP+ A  G AG+DL A    D ++ PG   ++ TG+++ +   G   L+ PRS
Sbjct: 12  RIGNEFPLPQYATPGSAGLDLRAMLKEDTLLEPGQTLLIPTGLSVYIGDPGLAALILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N   +    I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-QTAFNIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 VVEAFDESQRGAGGFGHSG 149


>DUT_NITMU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 64/144 (44%), Positives = 82/144 (56%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLV 63
           IKI+    +  LP  A  G AG+DL A  + V  I PG   ++ TGIAI L   G   LV
Sbjct: 6   IKILDSRLKDQLPAYATSGSAGLDLRACIEHVMTIQPGEAHLIPTGIAIHLSDPGLAALV 65

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSGL  + G+ + N  G ID+DY+G+I V   N   + P ++   +RIAQL       
Sbjct: 66  LPRSGLGHKHGIVMGNLVGLIDSDYQGQIFVSCWNRG-QAPFLLNPLERIAQLXXXXXXX 124

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      + RG  G+GSTGK
Sbjct: 125 XXXXXXDDFEQSERGANGFGSTGK 148


>DUT_KLEP7 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 47/140 (33%), Positives = 77/140 (55%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   ++ TG+AI +   ++  ++ PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLLPTGLAIHIADPSLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   ++  +I  G+RIAQ+V          
Sbjct: 73  GLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQSFIIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVESFDATDRGEGGFGHSGR 151


>DUT_KLEP3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 47/140 (33%), Positives = 77/140 (55%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ ++ PLP  A  G AG+DL A  D  +  APG   ++ TG+AI +   ++  ++ PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDDAVELAPGATTLLPTGLAIHIADPSLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   ++  +I  G+RIAQ+V          
Sbjct: 73  GLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQSFIIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVEEFDATDRGEGGFGHSGR 151


>DUT_ENT38 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 47/140 (33%), Positives = 75/140 (53%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+ ++ PLP  A  G AG+DL A  D  +A  PG   ++ TG+AI +   ++  ++ PRS
Sbjct: 13  RVGQQFPLPTYATSGSAGLDLRACLDEAVALAPGATTLIPTGLAIHVADPSLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G++ V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  T RG+ G+G +G+
Sbjct: 132 LVDDFDATDRGEGGFGHSGR 151


>DUT_DINSH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 46/107 (42%), Positives = 59/107 (55%), Gaps = 8/107 (7%)

Query: 13  DKELPLPKRAHRGDAGVDLHATTD-------AVIAPGHREIVGTGIAIALPLGTVGLVHP 65
           D+ +PLP  A  G AG DL A            I P  R IV TG+ +A+P G    + P
Sbjct: 14  DEAIPLPSYATVGAAGADLRANLPPEIRDQGVEIQPLCRVIVPTGLRVAIPAGYEMQIRP 73

Query: 66  RSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDR 112
           RSGLA + GLS+ N PGTID+DYRG + V L  +  E  + +  GDR
Sbjct: 74  RSGLALKHGLSLPNTPGTIDSDYRGPLGVLLTVIGTE-AVTLHHGDR 119


>DUT_DICNV RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score = 75.9 bits (185), Expect = 2e-16
 Identities = 55/151 (36%), Positives = 79/151 (52%), Gaps = 11/151 (7%)

Query: 6   PIKIV--RLDKELPLPKRAHRGDAGVDLHAT---TDAVIAPGHREIVGTGIA--IALPLG 58
           P KI+  RL  E+PLP  A  G A +D+ A       V+A     ++G+G+A  IA P  
Sbjct: 5   PYKILDPRLGGEIPLPTYATSGSAALDIRAVFAEESIVLAADECRLIGSGLAFHIADP-N 63

Query: 59  TVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
             G+V PRSGL  + G+ + N  G ID+DY+GE+K+ L N   + P  +T G+RIAQL+ 
Sbjct: 64  YCGIVLPRSGLGYKHGIVLGNLVGLIDSDYQGELKIPLWNRS-QTPYTVTLGERIAQLLF 122

Query: 119 Q--KXXXXXXXXXXXXXXTVRGDQGYGSTGK 147
                             + RG  G+G TG+
Sbjct: 123 LPIAQAQLFPVESFDQKQSTRGSGGFGHTGR 153


>DUT_XYLFT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 75.5 bits (184), Expect = 3e-16
 Identities = 65/148 (43%), Positives = 82/148 (55%), Gaps = 8/148 (5%)

Query: 6   PIKIVRLDKEL----PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGT 59
           P++I  LD  L    PLP  A    AG+DL A  DA   + PG  E++ TGIAI L   +
Sbjct: 7   PLQIKILDPRLGTVWPLPTYATEASAGLDLRAALDAPMTLVPGDAELLSTGIAIHLVDPS 66

Query: 60  V-GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           +  +V PRSGL  R G+ + N  G ID+DY+G + V + N   E    I  GDRIAQ   
Sbjct: 67  LCAVVLPRSGLGHRHGIVLGNGTGLIDSDYQGPLLVSVWNRGRE-AFTIEPGDRIAQXXX 125

Query: 119 QKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
                           + RG  G+G TG
Sbjct: 126 XXXXXXXXXXXDTFVESGRGAGGFGHTG 153


>DUT_XYLF2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 75.5 bits (184), Expect = 3e-16
 Identities = 65/148 (43%), Positives = 82/148 (55%), Gaps = 8/148 (5%)

Query: 6   PIKIVRLDKEL----PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGT 59
           P++I  LD  L    PLP  A    AG+DL A  DA   + PG  E++ TGIAI L   +
Sbjct: 7   PLQIKILDPRLGTVWPLPTYATEASAGLDLRAALDAPMTLVPGDAELLSTGIAIHLVDPS 66

Query: 60  V-GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           +  +V PRSGL  R G+ + N  G ID+DY+G + V + N   E    I  GDRIAQ   
Sbjct: 67  LCAVVLPRSGLGHRHGIVLGNGTGLIDSDYQGPLLVSVWNRGRE-AFTIEPGDRIAQXXX 125

Query: 119 QKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
                           + RG  G+G TG
Sbjct: 126 XXXXXXXXXXXDTFVESGRGAGGFGHTG 153


>DUT_SHESH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 75.5 bits (184), Expect = 3e-16
 Identities = 48/139 (34%), Positives = 72/139 (51%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHAT--TDAVIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  + PLP  A  G AG+DL A   T   +APG   ++ TGI+I +   ++  ++ PRS
Sbjct: 13  RIGSQFPLPAYATPGSAGMDLRAMLETSIQVAPGETILIPTGISIHVADSSLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V   N   E P  +  GDR+AQLV          
Sbjct: 73  GLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRGSE-PFTLEIGDRLAQLVFVPVVQAEFK 131

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG+ G+G +G
Sbjct: 132 LVDEFDNSSRGEGGFGHSG 150


>DUT_PSYCK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score = 75.5 bits (184), Expect = 3e-16
 Identities = 49/139 (35%), Positives = 71/139 (51%), Gaps = 5/139 (3%)

Query: 13  DKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRSGL 69
           DK   LP RA  G AG+DL A  D    I  G   ++GTG+A+ +      G++ PRSGL
Sbjct: 16  DKAFSLPTRATDGSAGIDLRACIDEPLTIKAGATHLIGTGLAVYIQDPNFAGMILPRSGL 75

Query: 70  AAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXX 129
             + G+ + N  G IDADY+GE+ V + N   E   ++T  +R+AQ V+           
Sbjct: 76  GHKHGIVLGNLVGLIDADYQGELMVSIWNRSQE-DFVLTPAERMAQYVVVPVARPEFEVV 134

Query: 130 XXXXXT-VRGDQGYGSTGK 147
                T  RG  G+G +G+
Sbjct: 135 TEFSDTSARGAGGFGHSGR 153


>DUT_ORFN2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 159

 Score = 75.5 bits (184), Expect = 3e-16
 Identities = 46/133 (34%), Positives = 65/133 (48%), Gaps = 3/133 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPR 66
           +++VRL +   +P R   G AG+DL +  D VI      +V T + I  P G  G + PR
Sbjct: 9   LQVVRLSQNATIPARGSPGAAGLDLCSAYDCVIPSHCSRVVFTDLLIKPPSGCYGRIAPR 68

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGLA +  + +    G ID DYRG + V L N        + +GDRIAQL+ ++      
Sbjct: 69  SGLAVKHFIDV--GAGVIDEDYRGNVGVVLFNFG-NSDFEVKKGDRIAQLICERISCPAV 125

Query: 127 XXXXXXXXTVRGD 139
                   T RGD
Sbjct: 126 QEVNCLDNTDRGD 138


>DUT_BURTA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 75.5 bits (184), Expect = 3e-16
 Identities = 50/133 (37%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LPK A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+GE+ +   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGELMISTWNRG-QTEFVLNPFERLAQLVIVPVVQATFNIVGDFAQ 134

Query: 135 TVRGDQGYGSTGK 147
           + RG  G+GSTG+
Sbjct: 135 SDRGAGGFGSTGR 147


>DUT_BURS3 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 75.5 bits (184), Expect = 3e-16
 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ +   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMISTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAE 134

Query: 135 TVRGDQGYGSTGK 147
           + RGD G+GSTG+
Sbjct: 135 SDRGDGGFGSTGR 147


>DUT_AZOVD RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 75.5 bits (184), Expect = 3e-16
 Identities = 49/139 (35%), Positives = 70/139 (50%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           RL  + PLP  A  G AG+DL A    +  + PG   ++ TG+AI +   G   LV PRS
Sbjct: 12  RLGSDYPLPAYATAGSAGLDLRAMLQEELTLEPGQTALIPTGLAIHIADPGLAALVLPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ +   N   +    I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMISCWNRG-QSTFRIAVGERIAQLVLVPVMQAHFQ 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 LVESFDESQRGAGGFGHSG 149


>DUT_PSEU2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 75.1 bits (183), Expect = 4e-16
 Identities = 49/139 (35%), Positives = 70/139 (50%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           R+  E PLP  A  G AG+DL A    D ++ PG   ++ TG++I +   G   L+ PRS
Sbjct: 12  RIGNEFPLPAYATTGSAGLDLRAMLKEDTLLEPGQTLLIPTGLSIYIGDPGLAALILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+GE+ V   N        I  G+RIAQLV+         
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGELMVSCWNRG-HTAFNIAVGERIAQLVLVPVVQAHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  + RG  G+G +G
Sbjct: 131 LVEAFDESQRGAGGFGHSG 149


>DUT_PECCP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 75.1 bits (183), Expect = 4e-16
 Identities = 48/147 (32%), Positives = 78/147 (53%), Gaps = 6/147 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVG 61
           +KIV  R+ ++ PLP  A  G AG+DL A  D  I    G   ++ TG+AI +   G   
Sbjct: 7   VKIVDPRVGQQFPLPTYATPGSAGLDLRACLDQAIELKAGETTLIPTGLAIHIADTGLAA 66

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           ++ PRSGL  + G+ + N  G ID+DY+G++ V + N   ++   +  G+RIAQ+V    
Sbjct: 67  VILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQTFTVEPGERIAQMVFVPV 125

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGKT 148
                        + RG+ G+G +G++
Sbjct: 126 VQAEFNLVEDFVSSERGEGGFGHSGRS 152


>DUT_ERWCT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 75.1 bits (183), Expect = 4e-16
 Identities = 48/147 (32%), Positives = 78/147 (53%), Gaps = 6/147 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVG 61
           +KIV  R+ ++ PLP  A  G AG+DL A  D  I    G   ++ TG+AI +   G   
Sbjct: 7   VKIVDPRVGQQFPLPTYATPGSAGLDLRACLDQAIELKAGETTLIPTGLAIHIADTGLAA 66

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           ++ PRSGL  + G+ + N  G ID+DY+G++ V + N   ++   +  G+RIAQ+V    
Sbjct: 67  VILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQTFTVEPGERIAQMVFVPV 125

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGKT 148
                        + RG+ G+G +G++
Sbjct: 126 VQAEFNLVEDFVGSERGEGGFGHSGRS 152


>DUT_BURVG RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 75.1 bits (183), Expect = 4e-16
 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMVSTWNRG-QSEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQ 134

Query: 135 TVRGDQGYGSTGK 147
           + RG+ G+GSTG+
Sbjct: 135 SERGEGGFGSTGR 147


>DUT_XANCP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 74.7 bits (182), Expect = 5e-16
 Identities = 55/151 (36%), Positives = 73/151 (48%), Gaps = 6/151 (3%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP 56
           MT    +K++  R     PLP  A    AG+DL A  +A   + PG   ++ +GIAI L 
Sbjct: 1   MTQSLQVKLLDPRFGDLWPLPAYATEASAGMDLRAALEAPMTLEPGDAALIPSGIAIHLD 60

Query: 57  LGTV-GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              V  ++ PRSGL  R G+ + N  G IDADY+G + +   N   E    I  GDRIAQ
Sbjct: 61  DPQVCAVILPRSGLGHRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQ 119

Query: 116 LVIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           LVI                + RG  G+G TG
Sbjct: 120 LVILPIVRVSLQVVDTFVDSARGAGGFGHTG 150


>DUT_XANCB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 74.7 bits (182), Expect = 5e-16
 Identities = 55/151 (36%), Positives = 73/151 (48%), Gaps = 6/151 (3%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP 56
           MT    +K++  R     PLP  A    AG+DL A  +A   + PG   ++ +GIAI L 
Sbjct: 1   MTQSLQVKLLDPRFGDLWPLPAYATEASAGMDLRAALEAPMTLEPGDAALIPSGIAIHLD 60

Query: 57  LGTV-GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              V  ++ PRSGL  R G+ + N  G IDADY+G + +   N   E    I  GDRIAQ
Sbjct: 61  DPQVCAVILPRSGLGHRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQ 119

Query: 116 LVIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           LVI                + RG  G+G TG
Sbjct: 120 LVILPIVRVSLQVVDTFVDSARGAGGFGHTG 150


>DUT_XANC8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 74.7 bits (182), Expect = 5e-16
 Identities = 55/151 (36%), Positives = 73/151 (48%), Gaps = 6/151 (3%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP 56
           MT    +K++  R     PLP  A    AG+DL A  +A   + PG   ++ +GIAI L 
Sbjct: 1   MTQSLQVKLLDPRFGDLWPLPAYATEASAGMDLRAALEAPMTLEPGDAALIPSGIAIHLD 60

Query: 57  LGTV-GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              V  ++ PRSGL  R G+ + N  G IDADY+G + +   N   E    I  GDRIAQ
Sbjct: 61  DPQVCAVILPRSGLGHRHGIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQ 119

Query: 116 LVIQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
           LVI                + RG  G+G TG
Sbjct: 120 LVILPIVRVSLQVVDTFVDSARGAGGFGHTG 150


>DUT_AERHH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 74.7 bits (182), Expect = 5e-16
 Identities = 50/123 (40%), Positives = 70/123 (56%), Gaps = 6/123 (4%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP 56
           MT    +KI+  R+  E PLP  A  G AG+DL A  DA   +APG   +V TG+AI + 
Sbjct: 1   MTTQIELKILDARIGTEYPLPAYATPGSAGMDLRALLDAPLTLAPGDTTLVPTGLAIHIQ 60

Query: 57  -LGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
             G    + PRSGL  + G+ + N  G ID+DY+G++ V + N   +    +  G+RIAQ
Sbjct: 61  DPGLCATILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRGNDN-FTMQPGERIAQ 119

Query: 116 LVI 118
           LVI
Sbjct: 120 LVI 122


>POL_FIVSD RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;           EC=3.4.23.-;  AltName:
           Full=Retropepsin;Contains:
          Length = 1124

 Score = 74.3 bits (181), Expect = 6e-16
 Identities = 45/121 (37%), Positives = 67/121 (55%), Gaps = 4/121 (3%)

Query: 26  DAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTID 85
           DAG DL A  +  + PG  +++ TG+ + LP G  GL+  +S + ++ GL ++   G ID
Sbjct: 725 DAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGHWGLIMGKSSIGSK-GLDVLG--GVID 781

Query: 86  ADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGYGST 145
             YRGEI V +INL  +K I +    +IAQL+I                + RG++GYGST
Sbjct: 782 EGYRGEIGVIMINLS-KKSITLLEQQKIAQLIILPHKHEALEQGKVVMDSERGEKGYGST 840

Query: 146 G 146
           G
Sbjct: 841 G 841


>DUT_BURCJ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 74.3 bits (181), Expect = 6e-16
 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDEFTE 134

Query: 135 TVRGDQGYGSTGK 147
           + RG+ G+GSTG+
Sbjct: 135 SDRGEGGFGSTGR 147


>DUT_BURCH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 74.3 bits (181), Expect = 6e-16
 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMVSTWNRG-QTAFVLNPFERLAQLVIVPVVQAQFNIVDEFTE 134

Query: 135 TVRGDQGYGSTGK 147
           + RG+ G+GSTG+
Sbjct: 135 SDRGEGGFGSTGR 147


>DUT_BURCC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 74.3 bits (181), Expect = 6e-16
 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMVSTWNRG-QTAFVLNPFERLAQLVIVPVVQAQFNIVDEFTE 134

Query: 135 TVRGDQGYGSTGK 147
           + RG+ G+GSTG+
Sbjct: 135 SDRGEGGFGSTGR 147


>DUT_BURCA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 74.3 bits (181), Expect = 6e-16
 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMVSTWNRG-QTAFVLNPFERLAQLVIVPVVQAQFNIVDEFTE 134

Query: 135 TVRGDQGYGSTGK 147
           + RG+ G+GSTG+
Sbjct: 135 SDRGEGGFGSTGR 147


>POL_FIVPE RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;  AltName: Full=Retropepsin;         
           EC=3.4.23.-;Contains:
          Length = 1124

 Score = 73.9 bits (180), Expect = 8e-16
 Identities = 48/129 (37%), Positives = 69/129 (53%), Gaps = 6/129 (4%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           L KR+   DAG DL A  +  + PG  +++ TG+ + LP G  GL+  +S + ++ GL +
Sbjct: 719 LDKRSE--DAGYDLLAAKEIHLLPGEVKVIPTGVKLMLPKGYWGLIIGKSSIGSK-GLDV 775

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVR 137
           +   G ID  YRGEI V +IN+   K I +    +IAQL+I                + R
Sbjct: 776 LG--GVIDEGYRGEIGVIMINVS-RKSITLMERQKIAQLIILPCKHEVLEQGKVVMDSER 832

Query: 138 GDQGYGSTG 146
           GD GYGSTG
Sbjct: 833 GDNGYGSTG 841


>DUT_WIGBR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 153

 Score = 73.9 bits (180), Expect = 8e-16
 Identities = 49/141 (34%), Positives = 74/141 (52%), Gaps = 5/141 (3%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALPLGTV-GLVHPRS 67
           R  KE  LPK    G +G+DL A  D  I   P    ++ TG++I +    + GL+ PRS
Sbjct: 13  RFGKEFFLPKYFTDGSSGMDLRACIDKEINLNPNETVLISTGVSIDISDQKISGLILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLV-IQKXXXXXX 126
           GL+ + G+ + N  G ID+DY+G I + ++N    K  +I+ GDRIAQ++ +        
Sbjct: 73  GLSHKYGIILSNTIGLIDSDYQGPIMISMLNRS-NKNFLISIGDRIAQIIFVPLIQIEWN 131

Query: 127 XXXXXXXXTVRGDQGYGSTGK 147
                   T R D G+G +GK
Sbjct: 132 IVNKFVKITNRKDMGFGHSGK 152


>DUT_JANMA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 73.9 bits (180), Expect = 8e-16
 Identities = 51/144 (35%), Positives = 73/144 (50%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLV 63
           +KI+    +  LP  A  G AG+DL A  DA   I PG   +V TG+AI L   G   ++
Sbjct: 6   VKILDPRMQEQLPAYATAGSAGLDLRACLDAPITIKPGETHLVPTGLAIHLADPGYAAMI 65

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSG+  + G+ + N  G ID+DY+G++ V   N   +    +   +R+AQLVI     
Sbjct: 66  LPRSGMGHKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFTLNPMERLAQLVIVPVLQ 124

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      + RG  G+GSTGK
Sbjct: 125 VGFNVVEEFDTSERGIGGFGSTGK 148


>DUT_BURA4 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 73.9 bits (180), Expect = 8e-16
 Identities = 48/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           +P  A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  MPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQ 134

Query: 135 TVRGDQGYGSTGK 147
           + RG+ G+GSTG+
Sbjct: 135 SERGEGGFGSTGR 147


>DUT_AERS4 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 73.9 bits (180), Expect = 8e-16
 Identities = 51/123 (41%), Positives = 70/123 (56%), Gaps = 6/123 (4%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALP 56
           MT    +KI+  R+  E PLP  A  G AG+DL A  DA I  APG   +V TG+AI + 
Sbjct: 1   MTTQIELKILDARIGTEYPLPAYATPGSAGMDLRALLDAPITLAPGDTILVPTGLAIHIQ 60

Query: 57  -LGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
             G    + PRSGL  + G+ + N  G ID+DY+G++ V + N   +    +  G+RIAQ
Sbjct: 61  DPGLCATILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNRGNDS-FTMQPGERIAQ 119

Query: 116 LVI 118
           LVI
Sbjct: 120 LVI 122


>DUT_XANOR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 73.6 bits (179), Expect = 1e-15
 Identities = 50/133 (37%), Positives = 66/133 (49%), Gaps = 4/133 (3%)

Query: 17  PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV-GLVHPRSGLAARE 73
           PLP  A    AG+DL A  +A   + PG   ++ +GIAI L    +  ++ PRSGL  R 
Sbjct: 22  PLPAHATESSAGMDLRAALEAPMTLQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRH 81

Query: 74  GLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXX 133
           G+ + N  G IDADY+G + +   N   E    I  GDRIAQLVI               
Sbjct: 82  GIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRAGLQVVDTFV 140

Query: 134 XTVRGDQGYGSTG 146
            + RG  G+G TG
Sbjct: 141 DSARGAGGFGHTG 153


>DUT_XANOP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 73.6 bits (179), Expect = 1e-15
 Identities = 50/133 (37%), Positives = 66/133 (49%), Gaps = 4/133 (3%)

Query: 17  PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV-GLVHPRSGLAARE 73
           PLP  A    AG+DL A  +A   + PG   ++ +GIAI L    +  ++ PRSGL  R 
Sbjct: 22  PLPAHATESSAGMDLRAALEAPMTLQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRH 81

Query: 74  GLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXX 133
           G+ + N  G IDADY+G + +   N   E    I  GDRIAQLVI               
Sbjct: 82  GIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRAGLQVVDTFV 140

Query: 134 XTVRGDQGYGSTG 146
            + RG  G+G TG
Sbjct: 141 DSARGAGGFGHTG 153


>DUT_BURCM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 73.6 bits (179), Expect = 1e-15
 Identities = 48/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           +P  A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  MPAYATTGSAGLDLRACLDAPVTLQPGETTLVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQ 134

Query: 135 TVRGDQGYGSTGK 147
           + RG+ G+GSTG+
Sbjct: 135 SDRGEGGFGSTGR 147


>DUT_RALPJ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 73.2 bits (178), Expect = 1e-15
 Identities = 50/144 (34%), Positives = 73/144 (50%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLV 63
           +KI+       LP+ A  G AG+DL A  DA   I PG   ++ TG+AI L   G   L+
Sbjct: 5   VKILDARLHEQLPQYATTGSAGLDLRACVDAPLTIEPGTTHLIPTGMAIHLADPGYAALI 64

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSG+  + G+ + N  G ID+DY+G++ V   N       ++   +R+AQLVI     
Sbjct: 65  LPRSGMGHKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-STAFVLNPMERLAQLVIVPVVQ 123

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      + RG  G+GSTG+
Sbjct: 124 AELNIVDDFAESERGAGGFGSTGR 147


>DUT_PSYA2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score = 73.2 bits (178), Expect = 1e-15
 Identities = 49/139 (35%), Positives = 70/139 (50%), Gaps = 5/139 (3%)

Query: 13  DKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRSGL 69
           DK   LP RA  G AG+DL A  D    I  G   ++GTG+AI +      G++ PRSGL
Sbjct: 16  DKAFSLPTRATDGSAGIDLRACIDEPLTIKAGTTHLIGTGLAIYIQDPNFAGMILPRSGL 75

Query: 70  AAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXX 129
             + G+ + N  G IDADY+GE+ V + N   E   ++   +R+AQ V+           
Sbjct: 76  GHKHGIVLGNLVGLIDADYQGELMVSIWNRSLE-DFVLNPAERMAQYVVVPVARPEFEVV 134

Query: 130 XXXXXT-VRGDQGYGSTGK 147
                T  RG  G+G +G+
Sbjct: 135 TEFSDTSARGAGGFGHSGR 153


>DUT_DECAR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 73.2 bits (178), Expect = 1e-15
 Identities = 51/137 (37%), Positives = 71/137 (51%), Gaps = 5/137 (3%)

Query: 14  KELPLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRSGLA 70
           +E P P  A  G AG+DL A  +A   + PG   +V TG+AI L   G   ++ PRSGL 
Sbjct: 14  RETP-PHYATPGSAGLDLRACIEAPLHVEPGQTTLVPTGMAIHLADPGLAAMILPRSGLG 72

Query: 71  AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXX 130
            + G+ + N  G ID+DY+GE+ V + N        +   DRIAQL+I            
Sbjct: 73  HKHGIVLGNLVGLIDSDYQGELMVSVWNRG-HASFTLNPLDRIAQLIIVPVLQVGFNIVD 131

Query: 131 XXXXTVRGDQGYGSTGK 147
               + RG+ G+GSTGK
Sbjct: 132 DFDASHRGEGGFGSTGK 148


>DUT_CAMPS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 73.2 bits (178), Expect = 1e-15
 Identities = 47/142 (33%), Positives = 69/142 (48%), Gaps = 4/142 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +P++ V+       P R     AG DL++     I PG R+++ T I++++P    G + 
Sbjct: 8   SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYYYTIPPGERQLIKTDISMSMPKFCYGRIA 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ +               YRG I V LIN + +    +  GDRIAQL+ Q+    
Sbjct: 68  PRSGLSLK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYP 123

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RGDQG+GSTG
Sbjct: 124 ELKEVQSLDSTDRGDQGFGSTG 145


>DUT_CAMPM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 147

 Score = 73.2 bits (178), Expect = 1e-15
 Identities = 47/142 (33%), Positives = 69/142 (48%), Gaps = 4/142 (2%)

Query: 5   APIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVH 64
           +P++ V+       P R     AG DL++     I PG R+++ T I++++P    G + 
Sbjct: 8   SPVRFVKETNRAKSPTRQSPYAAGYDLYSAYYYTIPPGERQLIKTDISMSMPKFCYGRIA 67

Query: 65  PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXX 124
           PRSGL+ +               YRG I V LIN + +    +  GDRIAQL+ Q+    
Sbjct: 68  PRSGLSLK---XXXXXXXXXXXXYRGNIGVILIN-NGKCTFNVNTGDRIAQLIYQRIYYP 123

Query: 125 XXXXXXXXXXTVRGDQGYGSTG 146
                     T RGDQG+GSTG
Sbjct: 124 ELKEVQSLDSTDRGDQGFGSTG 145


>DUT_BURPP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 73.2 bits (178), Expect = 1e-15
 Identities = 50/144 (34%), Positives = 72/144 (50%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIAL-PLGTVGLV 63
           +KI+       LP  A  G AG+DL A  D  +   PG   +V TG+AI +   G   L+
Sbjct: 5   LKILDARMRDQLPAYATTGSAGLDLRACLDEALTLKPGETALVPTGLAIHVGDAGYAALI 64

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSGL  + G+ + N  G ID+DY+G++ +   N   E   ++   +R+AQLVI     
Sbjct: 65  LPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISTWNRG-ETTFVLNPMERLAQLVIVPVVQ 123

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      + RG  G+GSTGK
Sbjct: 124 AEFNIVDDFETSDRGAGGFGSTGK 147


>DUT_BURP8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 73.2 bits (178), Expect = 1e-15
 Identities = 51/144 (35%), Positives = 72/144 (50%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLV 63
           IKI+       LP  A  G AG+DL A  DA   + PG   +V TG+AI L   G   L+
Sbjct: 5   IKILDPRMREQLPAYATTGSAGLDLRACLDAPLTLEPGQTVLVPTGLAIHLADPGYAALI 64

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSG+  + G+ + N  G ID+DY+G++ +   N        +   +R+AQLVI     
Sbjct: 65  LPRSGMGHKHGIVLGNLVGLIDSDYQGQLMISTWNRG-TTTFTLNPMERLAQLVIVPVVQ 123

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      + RG+ G+GSTGK
Sbjct: 124 ATFNIVDEFDTSERGEGGFGSTGK 147


>DUT_BPT5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 73.2 bits (178), Expect = 1e-15
 Identities = 52/137 (37%), Positives = 69/137 (50%), Gaps = 10/137 (7%)

Query: 18  LPKRAHRGDAGVDLHA---TTDAV----IAPGHREIVGTGIAIALPLGTVGLVHPRSGLA 70
           +PK      AG+DL A   T  A     IAPG   ++ TG+A+ +P G  GLV PRS L 
Sbjct: 12  MPKIGSEDAAGMDLRAFFGTNPAADLRAIAPGKSLMIDTGVAVEIPRGWFGLVVPRSSLG 71

Query: 71  AREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI-QKXXXXXXXXX 129
            R  L I N  G ID+DYRG IK+ L N   E    +   +R+ QLV+            
Sbjct: 72  KRH-LMIANTAGVIDSDYRGTIKMNLYNYGSEMQ-TLENFERLCQLVVLPHYSTHNFKIV 129

Query: 130 XXXXXTVRGDQGYGSTG 146
                T+RG+ G+GS+G
Sbjct: 130 DELEETIRGEGGFGSSG 146


>DUT_XANOM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 72.8 bits (177), Expect = 2e-15
 Identities = 50/133 (37%), Positives = 66/133 (49%), Gaps = 4/133 (3%)

Query: 17  PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV-GLVHPRSGLAARE 73
           PLP  A    AG+DL A  +A   + PG   ++ +GIAI L    +  ++ PRSGL  R 
Sbjct: 22  PLPAYATESSAGMDLRAALEAPMTLQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRH 81

Query: 74  GLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXX 133
           G+ + N  G IDADY+G + +   N   E    I  GDRIAQLVI               
Sbjct: 82  GIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRAGLQVVDTFV 140

Query: 134 XTVRGDQGYGSTG 146
            + RG  G+G TG
Sbjct: 141 DSARGAGGFGHTG 153


>DUT_XANC5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 72.8 bits (177), Expect = 2e-15
 Identities = 50/133 (37%), Positives = 66/133 (49%), Gaps = 4/133 (3%)

Query: 17  PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV-GLVHPRSGLAARE 73
           PLP  A    AG+DL A  +A   + PG   ++ +GIAI L    +  ++ PRSGL  R 
Sbjct: 22  PLPAYATESSAGMDLRAALEAPMTLQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRH 81

Query: 74  GLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXX 133
           G+ + N  G IDADY+G + +   N   E    I  GDRIAQLVI               
Sbjct: 82  GIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRMGLQVVDTFV 140

Query: 134 XTVRGDQGYGSTG 146
            + RG  G+G TG
Sbjct: 141 DSARGAGGFGHTG 153


>DUT_XANAC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 72.8 bits (177), Expect = 2e-15
 Identities = 50/133 (37%), Positives = 66/133 (49%), Gaps = 4/133 (3%)

Query: 17  PLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGTV-GLVHPRSGLAARE 73
           PLP  A    AG+DL A  +A   + PG   ++ +GIAI L    +  ++ PRSGL  R 
Sbjct: 22  PLPAYATESSAGMDLRAALEAPMTLQPGDAALIPSGIAIHLADPQLCAVILPRSGLGHRH 81

Query: 74  GLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXX 133
           G+ + N  G IDADY+G + +   N   E    I  GDRIAQLVI               
Sbjct: 82  GIVLGNGTGLIDADYQGPLLISTWNRGRE-AFTIEPGDRIAQLVILPIVRMGLQVVDTFV 140

Query: 134 XTVRGDQGYGSTG 146
            + RG  G+G TG
Sbjct: 141 DSARGAGGFGHTG 153


>DUT_RHOFD RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 72.8 bits (177), Expect = 2e-15
 Identities = 53/144 (36%), Positives = 72/144 (50%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGT-VGLV 63
           +KI+       LP  A  G AG+DL A  DA   + P   ++V TGIAI L       ++
Sbjct: 6   VKIIDPRMADQLPAYATPGSAGLDLRACLDAPLTLLPNAWQLVPTGIAIYLKDPKFAAMI 65

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSGL  + G+ + N  G ID+DY+G++ V   N   +    I   +RIAQLVI     
Sbjct: 66  LPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSAWNRS-DVAFTIEPMERIAQLVIVPVLQ 124

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      + RG+ GYGSTGK
Sbjct: 125 AQFNVVSEFPASARGEGGYGSTGK 148


>DUT_BORPA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 72.8 bits (177), Expect = 2e-15
 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIAL-PLGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A T+A  VI PG   +V TG+AI +       ++ PRSGL  + G
Sbjct: 17  LPAYATPGSAGLDLRACTEASLVIEPGQTVLVPTGLAIHIGDPRYAAMILPRSGLGHKHG 76

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   + P  +   +R+AQLVI                
Sbjct: 77  IVLGNLVGLIDSDYQGQLMVSTWNRGTQ-PFTLDPMERLAQLVIVPVQQVAFNVVEDFDA 135

Query: 135 TVRGDQGYGSTGK 147
           + RG  G+GSTG+
Sbjct: 136 SERGAGGFGSTGR 148


>DUT_BORBR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 72.8 bits (177), Expect = 2e-15
 Identities = 49/133 (36%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIAL-PLGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A T+A  VI PG   +V TG+AI +       ++ PRSGL  + G
Sbjct: 17  LPAYATPGSAGLDLRACTEASLVIEPGQTVLVPTGLAIHIGDPRYAAMILPRSGLGHKHG 76

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   + P  +   +R+AQLVI                
Sbjct: 77  IVLGNLVGLIDSDYQGQLMVSTWNRGTQ-PFTLDPMERLAQLVIVPVQQVAFNVVEDFDA 135

Query: 135 TVRGDQGYGSTGK 147
           + RG  G+GSTG+
Sbjct: 136 SERGAGGFGSTGR 148


>DUT_SODGM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 72.4 bits (176), Expect = 2e-15
 Identities = 46/140 (32%), Positives = 71/140 (50%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRS 67
           R+    PLP  A  G AG+DL A  D   V+APG   ++ TG+AI +       ++ PRS
Sbjct: 12  RICDRFPLPAYATTGSAGLDLRACIDEPMVLAPGETTLIPTGLAIHIADANLAAVILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V + N   +    I  G+R+AQ+V          
Sbjct: 72  GLGHKHGIVLGNLVGLIDSDYQGPLMVSVWNRG-QDIFTIEPGERMAQMVFVPVVQAEFN 130

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  + RG+ G+G +G+
Sbjct: 131 LVESFDTSERGEGGFGHSGR 150


>DUT_BURXL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 72.4 bits (176), Expect = 2e-15
 Identities = 50/144 (34%), Positives = 72/144 (50%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIAL-PLGTVGLV 63
           +KI+       LP  A  G AG+DL A  D    + PG   +V TG+AI +   G   L+
Sbjct: 5   LKILDARMRDQLPAYATTGSAGLDLRACLDEPLTLKPGETALVPTGLAIHVGDPGYAALI 64

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSGL  + G+ + N  G ID+DY+G++ +   N   E   ++   +R+AQLVI     
Sbjct: 65  LPRSGLGHKHGIVLGNLVGLIDSDYQGQLMISTWNRG-ETTFVLNPMERLAQLVIVPVVQ 123

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      + RG  G+GSTGK
Sbjct: 124 AEFNIVDDFETSERGAGGFGSTGK 147


>DUT_AZOSB RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 72.0 bits (175), Expect = 3e-15
 Identities = 49/132 (37%), Positives = 70/132 (53%), Gaps = 4/132 (3%)

Query: 19  PKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREGL 75
           P  A  G AG+DL A  DA  ++ PG   +V +G+AI L   G   +V PRSGL  + G+
Sbjct: 18  PAYASAGAAGLDLRACLDAPVLLHPGETTLVPSGLAIHLADPGLAAMVLPRSGLGHKHGI 77

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
            + N  G ID+DY+G++ V + N   +    I   +RIAQLV+                +
Sbjct: 78  VLGNLVGLIDSDYQGQVFVSVWNRGRD-VFTIQPMERIAQLVVVPVLQVGFNVVDDFAAS 136

Query: 136 VRGDQGYGSTGK 147
            RG+ G+GSTGK
Sbjct: 137 ERGEGGFGSTGK 148


>DUT_XYLFA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 155

 Score = 71.6 bits (174), Expect = 4e-15
 Identities = 63/148 (42%), Positives = 81/148 (54%), Gaps = 8/148 (5%)

Query: 6   PIKIVRLDKELP----LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGT 59
           P++I  LD  L     LP  A    AG+DL A  DA   + PG  E++ TG+AI L   +
Sbjct: 7   PLQIKILDPRLGTVWLLPTYATEASAGLDLRAALDAPMTLVPGDAELLSTGVAIHLVDPS 66

Query: 60  V-GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           +  +V PRSGL  R G+ + N  G ID+DY+G + V + N   E    I  GDRIAQ   
Sbjct: 67  LCAVVLPRSGLGHRHGIVLGNGTGLIDSDYQGPLLVSVWNRGRE-AFTIEPGDRIAQXXX 125

Query: 119 QKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
                           + RG  G+G TG
Sbjct: 126 XXXXXXXXXXXDTFVESGRGAGGFGHTG 153


>DUT_RALSO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 71.6 bits (174), Expect = 4e-15
 Identities = 46/133 (34%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP+ A  G AG+DL A  DA   + PG   ++ TG+AI L   G   L+ PRSG+  + G
Sbjct: 16  LPQYATPGSAGLDLRACLDAPLTLEPGSTHLIPTGMAIHLADPGYAALILPRSGMGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ +   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMISTWNRG-DTAFVLNPMERLAQLVIVPVVQAELNIVDAFAE 134

Query: 135 TVRGDQGYGSTGK 147
           + RG  G+GSTG+
Sbjct: 135 SERGAGGFGSTGR 147


>DUT_NITEU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 71.6 bits (174), Expect = 4e-15
 Identities = 55/146 (37%), Positives = 73/146 (50%), Gaps = 6/146 (4%)

Query: 7   IKIVRLDKELP--LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVG 61
           + I  LD  L    P  A  G AG+DL A  D    I PG   ++ +GIAI L   G   
Sbjct: 4   VDIKLLDPRLQDVFPGYATPGSAGLDLRACIDERMEIHPGETLLIPSGIAIHLADPGFAA 63

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           +V PRSGL  + G+ + N  G ID+DY+G+I V   N   +    +   +RIAQLVI   
Sbjct: 64  MVLPRSGLGHKHGIVLGNLVGLIDSDYQGQILVSCWNRG-QAGFTLDPMERIAQLVIVPV 122

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGK 147
                        + RG+QG+GSTGK
Sbjct: 123 VQAGFNVVENFQPSQRGEQGFGSTGK 148


>DUT_ERWT9 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 71.2 bits (173), Expect = 5e-15
 Identities = 46/140 (32%), Positives = 73/140 (52%), Gaps = 4/140 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPLGTVG-LVHPRS 67
           R+  + PLP  A  G AG+DL A  +   V+ PG   ++ TG+AI +    +  ++ PRS
Sbjct: 13  RVGTDFPLPTYATSGSAGLDLRACLNEATVLQPGATTLLPTGLAIHIADPQLAAVILPRS 72

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           GL  + G+ + N  G ID+DY+G + V + N   +    I  G+RIAQ+V          
Sbjct: 73  GLGHKHGVVLGNLVGLIDSDYQGPLMVSVWNRGQDS-FTIEPGERIAQMVFVPVVQAEFN 131

Query: 128 XXXXXXXTVRGDQGYGSTGK 147
                  +VRG+ G+G +G+
Sbjct: 132 LVNDFDASVRGEGGFGHSGR 151


>438L_IIV6 RecName: Full=Probable deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 296

 Score = 71.2 bits (173), Expect = 5e-15
 Identities = 49/147 (33%), Positives = 67/147 (45%), Gaps = 5/147 (3%)

Query: 2   TDLAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVG 61
           T +  IK   L +    PKR     AG+DL +  + ++     +++ T   I  P G  G
Sbjct: 151 TPILQIKFAALTEYAQKPKRGSEFSAGIDLRSAYEYLVPANGNKLIKTDWKIQYPDGYFG 210

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK- 120
            +  RSGL+    L +    G +DADYR  + V L NL P +   +  GDRIAQLV    
Sbjct: 211 KICSRSGLSLNHNLEV--GAGIVDADYREGVSVVLNNLSP-RDFHVAPGDRIAQLVCTPY 267

Query: 121 -XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                          TVRG  G+GSTG
Sbjct: 268 ITPEIVFCKPSDIPDTVRGKNGFGSTG 294


>DUT_METFK RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 70.9 bits (172), Expect = 7e-15
 Identities = 49/133 (36%), Positives = 69/133 (51%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A T+    +APG   ++ TG+AI L       L+ PRSGL  + G
Sbjct: 18  LPSYATPGSAGLDLRACTEHTQTLAPGETIMIPTGMAIHLADPHYAALILPRSGLGHKHG 77

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   E   ++   +RIAQLVI                
Sbjct: 78  IVLGNLVGLIDSDYQGQLLVSCWNRGKES-FILNPLERIAQLVIVPVMQANFNIVDDFQA 136

Query: 135 TVRGDQGYGSTGK 147
           + RG  G+GSTG+
Sbjct: 137 SERGTGGFGSTGR 149


>DUT_BURM1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 70.5 bits (171), Expect = 9e-15
 Identities = 48/133 (36%), Positives = 68/133 (51%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  DA   + PG   +V TG+AI L       L+ PRSGL  + G
Sbjct: 16  LPAYATAGSAGLDLRACLDAPLTLKPGDTALVPTGLAIHLADPNYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   +   ++   +R+AQLVI                
Sbjct: 76  IVLGNLVGLIDSDYQGQLMVSTWNRG-QTEFVLNPFERLAQLVIVPVVQAQFNIVDDFAQ 134

Query: 135 TVRGDQGYGSTGK 147
           + RG  G+GSTG+
Sbjct: 135 SERGAGGFGSTGR 147


>DUT_PSYWF RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score = 70.1 bits (170), Expect = 1e-14
 Identities = 53/139 (38%), Positives = 78/139 (56%), Gaps = 5/139 (3%)

Query: 13  DKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALP-LGTVGLVHPRSGL 69
           D   P+P RA  G AG+DL A  D    I  G  +++GTG+AI +      G++ PRSGL
Sbjct: 16  DANFPMPTRATDGSAGIDLRACIDEPITIKAGETKLIGTGMAIYIADPNYAGIILPRSGL 75

Query: 70  AAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ-LVIQKXXXXXXXX 128
             + G+ + N  G IDADY+GE+ V + N   +   ++   +R+AQ +            
Sbjct: 76  GHKHGIVLGNLVGLIDADYQGELMVSVWNRS-DTDFVLNPAERMAQYMXXXXXXXXXXXX 134

Query: 129 XXXXXXTVRGDQGYGSTGK 147
                 + RG  G+G +G+
Sbjct: 135 EEFNELSARGAGGFGHSGR 153


>DUT_NITEC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 69.7 bits (169), Expect = 2e-14
 Identities = 50/132 (37%), Positives = 68/132 (51%), Gaps = 4/132 (3%)

Query: 19  PKRAHRGDAGVDLHATTD--AVIAPGHREIVGTGIAIALPL-GTVGLVHPRSGLAAREGL 75
           P  A  G AG+DL A  D    I PG   ++ +GIAI L   G   +V PRSGL  + G+
Sbjct: 18  PGYATPGSAGLDLRACIDERTEIHPGETLLIPSGIAIHLANPGFAAVVLPRSGLGHKHGI 77

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
            + N  G ID+DY+G+I V   N   +    +   +RIAQLVI                +
Sbjct: 78  VLGNLVGLIDSDYQGQILVSCWNRG-QTTFALEPLERIAQLVIVPVIQASFNVVNDFQHS 136

Query: 136 VRGDQGYGSTGK 147
            RG++G+GSTGK
Sbjct: 137 QRGERGFGSTGK 148


>DUT_METPP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 68.9 bits (167), Expect = 3e-14
 Identities = 46/133 (34%), Positives = 69/133 (51%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIAL-PLGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  DA  ++ PG  +++ TG++I +   G   ++ PRSGL  + G
Sbjct: 17  LPAYATPGSAGLDLRACLDAPLLLEPGQTQLIPTGLSIHIGDPGLAAVILPRSGLGHKHG 76

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G + V   N        +   +RIAQLVI                
Sbjct: 77  IVLGNLVGLIDSDYQGPLMVSCWNRG-LAAFTVQPLERIAQLVIVPVVQASFRVVDDFGA 135

Query: 135 TVRGDQGYGSTGK 147
           + RG+ G+GSTG+
Sbjct: 136 SERGEGGFGSTGQ 148


>DUT_LEPCP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 68.9 bits (167), Expect = 3e-14
 Identities = 49/133 (36%), Positives = 67/133 (50%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  D    IAPG   ++ TGIAI +   G   ++ PRSGL  + G
Sbjct: 18  LPAYATPGAAGLDLRACIDLPLEIAPGQTTLIPTGIAIHIADPGLAAIILPRSGLGHKHG 77

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N        +   +RIAQLVI                
Sbjct: 78  IVLGNLVGLIDSDYQGQLMVSCWNRG-SVAYAVQPLERIAQLVIVPVVQAQFRQVDEFEA 136

Query: 135 TVRGDQGYGSTGK 147
           + RG  G+GSTG+
Sbjct: 137 SDRGVAGFGSTGR 149


>DUT_HAMD5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 68.9 bits (167), Expect = 3e-14
 Identities = 42/134 (31%), Positives = 68/134 (50%), Gaps = 4/134 (2%)

Query: 17  PLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGTVGLVHPRSGLAARE 73
           PLP     G AG+DL   T A   ++PG   ++ TG+A+ +       ++ PRSGL  + 
Sbjct: 18  PLPTYTTSGSAGLDLRVCTQAPQHLSPGETRLLPTGLAVHIADPHLAAMILPRSGLGHKN 77

Query: 74  GLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXX 133
           G+ + N  G ID+DY+GE+ + + N   +   +I  GDR+AQ+V                
Sbjct: 78  GIVLGNLVGLIDSDYQGELMLSVWNRS-QIDFLINPGDRLAQMVFVPVVQVELNIVSEFT 136

Query: 134 XTVRGDQGYGSTGK 147
            + RG  G+G +G+
Sbjct: 137 SSQRGSGGFGHSGR 150


>DUT_POLSQ RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 68.6 bits (166), Expect = 3e-14
 Identities = 46/134 (34%), Positives = 65/134 (48%), Gaps = 4/134 (2%)

Query: 18  LPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGT-VGLVHPRSGLAAREG 74
           LP     G AG+DL A  D  I   PG   +V TG+AI +        + PRSGL  + G
Sbjct: 17  LPSYGTPGSAGLDLRACIDEAIEIVPGQTVLVPTGLAIYVEDPRYAAFILPRSGLGHKHG 76

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N     P  +   +R+AQLV+                
Sbjct: 77  IVLGNLVGLIDSDYQGQLMVSTWNRG-SNPFKLEPMERLAQLVVMPIQQVELKVVEEFTE 135

Query: 135 TVRGDQGYGSTGKT 148
           + RG  G+GSTG+T
Sbjct: 136 SSRGAGGFGSTGRT 149


>DUT_HERAR RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 68.6 bits (166), Expect = 3e-14
 Identities = 46/144 (31%), Positives = 73/144 (50%), Gaps = 4/144 (2%)

Query: 7   IKIVRLDKELPLPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIALPLGT-VGLV 63
           +KI+    +  +P  A  G AG+DL A  +A   I PG   ++ TG+AI +       ++
Sbjct: 6   VKILDPRMQEQMPAYATSGSAGLDLRACIEAPITIKPGETHLIPTGLAIHIGNPAYAAVI 65

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
            PRSG+  + G+ + N  G ID+DY+G++ V   N   +   ++   +R+AQLVI     
Sbjct: 66  LPRSGMGHKHGIVLGNLVGLIDSDYQGQLMVSTWNRG-QAEFVLNPMERLAQLVIVPVLQ 124

Query: 124 XXXXXXXXXXXTVRGDQGYGSTGK 147
                      + RG  G+GSTGK
Sbjct: 125 VGFNIVDDFDSSERGAGGFGSTGK 148


>DUT_CHRVO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 68.6 bits (166), Expect = 3e-14
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 6/119 (5%)

Query: 5   APIKIVRLDKELP--LPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALP-LGT 59
           A I +  LD  L   LP  A  G AG+DL A T+    I PG  ++V TGIAI L   G 
Sbjct: 3   AVIDVKILDARLRDNLPAYATAGSAGLDLRAATEETMTIQPGETQLVPTGIAIHLSDPGL 62

Query: 60  VGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
             ++ PRSGL  + G+ + N  G ID+DY+G++ V + N   ++P  +   +RIAQ+VI
Sbjct: 63  AAMLLPRSGLGHKHGIVLGNLVGLIDSDYQGQMFVSVWNRG-QQPFRLEPMERIAQMVI 120


>DUT_BORA1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 68.6 bits (166), Expect = 3e-14
 Identities = 47/134 (35%), Positives = 68/134 (50%), Gaps = 4/134 (2%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A  D  I   PG   +V TG+AI +   G   ++ PRSGL  + G
Sbjct: 17  LPTYATPGSAGLDLRACIDKAITLEPGATTLVPTGLAIHVADPGYAAIILPRSGLGHKHG 76

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N   +    +   +R+AQLVI                
Sbjct: 77  IVLGNLVGLIDSDYQGQLMVSTWNRG-QTAFTLEPMERLAQLVIVPVQQVSFNVVDEFGA 135

Query: 135 TVRGDQGYGSTGKT 148
           + RG  G+GSTG++
Sbjct: 136 SERGAGGFGSTGRS 149


>DUT_BAUCH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 68.6 bits (166), Expect = 3e-14
 Identities = 59/146 (40%), Positives = 81/146 (55%), Gaps = 7/146 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVG 61
           IKI+  R+     LPK A  G AG+DL A  D  I+  PG   ++ TG+A+ +   G  G
Sbjct: 6   IKILDSRIGDCFKLPKYATPGSAGIDLRACIDNTISLEPGETNLISTGLAVHIADTGLAG 65

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           ++ PRSGL    G+ + N  G ID+DY+G I V L N   E    I   +RIA       
Sbjct: 66  IIIPRSGLG-HHGIVLGNLVGLIDSDYQGSIMVSLWNRGKE-IFTIQPNERIAXXXXXXX 123

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGK 147
                        + RG++G+G +G+
Sbjct: 124 XXXXXXXXDNFQKSKRGERGFGHSGR 149


>DUT_AZOSE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 68.2 bits (165), Expect = 4e-14
 Identities = 48/132 (36%), Positives = 67/132 (50%), Gaps = 4/132 (3%)

Query: 19  PKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREGL 75
           P  A  G AG+DL A  +A +   PG   ++ +G+AI L   G   +V PRSGL  + G+
Sbjct: 18  PAYATPGAAGLDLRACLNAPVTLHPGETTLIPSGLAIHLADPGLAAMVLPRSGLGHKHGI 77

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXT 135
            + N  G ID+DY+G+I V   N   E    +   +RIAQLV+                +
Sbjct: 78  VLGNLVGLIDSDYQGQIFVSAWNRGRE-TFTVQPMERIAQLVVVPVLQVGFNIVDEFPQS 136

Query: 136 VRGDQGYGSTGK 147
            RG  G+GSTGK
Sbjct: 137 DRGAAGFGSTGK 148


>DUT_ENCCU RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 144

 Score = 67.4 bits (163), Expect = 8e-14
 Identities = 45/143 (31%), Positives = 67/143 (46%), Gaps = 3/143 (2%)

Query: 4   LAPIKIVRLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLV 63
           ++ I++ +++    +PKR   G AG D+H+     I P  R+ V TG+A  +P   VGLV
Sbjct: 3   VSEIRVRKINPRAKIPKRQSEGAAGYDIHSVESGRIPPNGRKSVRTGLAWDVPQSVVGLV 62

Query: 64  HPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXX 123
             RSGLA R  + +V     +      E+ + L+N +  +        RIAQLV      
Sbjct: 63  FGRSGLALRNWIEVVET--CVHPGEDKELVITLVN-NGREVFEYEESSRIAQLVFVPVLS 119

Query: 124 XXXXXXXXXXXTVRGDQGYGSTG 146
                      T RG  G+GSTG
Sbjct: 120 CEIDLVESLDLTERGCLGFGSTG 142


>DUT_YERE8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 46/146 (31%), Positives = 69/146 (47%), Gaps = 6/146 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGL-- 62
           IKI+  R+  E PLP  A  G AG+DL A     +              A+ +G   L  
Sbjct: 6   IKILDPRVGNEFPLPTYATEGSAGLDLRACLSEAVDXXXXXXXXXXXXXAIHIGDSSLAA 65

Query: 63  -VHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
            + PRSGL  + G+ + N  G ID+DY+G++ V + N   ++P  I  G+RIAQ+V    
Sbjct: 66  VILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQPFTIEPGERIAQMVFVPV 124

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTGK 147
                        + RG  G+G +G+
Sbjct: 125 IQAEFNLVEDFDLSERGTGGFGHSGR 150


>DUT_BURPS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LPK A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + + N  G ID+DY+GE+ +   N   +    +   +R+AQLVI
Sbjct: 76  IVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI 118


>DUT_BURP6 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LPK A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + + N  G ID+DY+GE+ +   N   +    +   +R+AQLVI
Sbjct: 76  IVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI 118


>DUT_BURP1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LPK A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + + N  G ID+DY+GE+ +   N   +    +   +R+AQLVI
Sbjct: 76  IVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI 118


>DUT_BURP0 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LPK A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + + N  G ID+DY+GE+ +   N   +    +   +R+AQLVI
Sbjct: 76  IVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI 118


>DUT_BURMS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LPK A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + + N  G ID+DY+GE+ +   N   +    +   +R+AQLVI
Sbjct: 76  IVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI 118


>DUT_BURMA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LPK A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + + N  G ID+DY+GE+ +   N   +    +   +R+AQLVI
Sbjct: 76  IVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI 118


>DUT_BURM9 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LPK A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + + N  G ID+DY+GE+ +   N   +    +   +R+AQLVI
Sbjct: 76  IVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI 118


>DUT_BURM7 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 67.0 bits (162), Expect = 1e-13
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 4/104 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LPK A  G AG+DL A  DA +   PG   +V TG+AI L   G   L+ PRSGL  + G
Sbjct: 16  LPKYATTGSAGLDLRACLDAPVTLKPGDTALVPTGLAIHLADPGYAALILPRSGLGHKHG 75

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + + N  G ID+DY+GE+ +   N   +    +   +R+AQLVI
Sbjct: 76  IVLGNLVGLIDSDYQGELMISTWNRG-QTEFALNPFERLAQLVI 118


>DUT_LEGPH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 66.2 bits (160), Expect = 2e-13
 Identities = 45/122 (36%), Positives = 67/122 (54%), Gaps = 6/122 (4%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALP 56
           M  +  +KI+  R+   +PLP  A  G AG+DL    +    +AP    ++ TGIAI + 
Sbjct: 1   MHQVIQLKILDSRIGDTIPLPAYATDGSAGLDLRVCISEPMQVAPQQTVLLPTGIAIYIA 60

Query: 57  LGTVG-LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              +  ++ PRSGL  + G+ + N  G ID+DY+GE+K+   N   E    +  GDRIAQ
Sbjct: 61  DPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDYQGELKISCWNRSQEH-FTVNPGDRIAQ 119

Query: 116 LV 117
           LV
Sbjct: 120 LV 121


>DUT_LEGPC RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 66.2 bits (160), Expect = 2e-13
 Identities = 45/122 (36%), Positives = 67/122 (54%), Gaps = 6/122 (4%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALP 56
           M  +  +KI+  R+   +PLP  A  G AG+DL    +    +AP    ++ TGIAI + 
Sbjct: 1   MHQVIQLKILDSRIGDTIPLPAYATDGSAGLDLRVCISEPMQVAPQQAVLLPTGIAIYIA 60

Query: 57  LGTVG-LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              +  ++ PRSGL  + G+ + N  G ID+DY+GE+K+   N   E    +  GDRIAQ
Sbjct: 61  DPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDYQGELKISCWNRSQEH-FTVNPGDRIAQ 119

Query: 116 LV 117
           LV
Sbjct: 120 LV 121


>DUT_LEGPA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 66.2 bits (160), Expect = 2e-13
 Identities = 45/122 (36%), Positives = 67/122 (54%), Gaps = 6/122 (4%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALP 56
           M  +  +KI+  R+   +PLP  A  G AG+DL    +    +AP    ++ TGIAI + 
Sbjct: 1   MHQVIQLKILDSRIGDTIPLPAYATDGSAGLDLRVCISEPMQVAPQQTVLLPTGIAIYIA 60

Query: 57  LGTVG-LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              +  ++ PRSGL  + G+ + N  G ID+DY+GE+K+   N   E    +  GDRIAQ
Sbjct: 61  DPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDYQGELKISCWNRSQEH-FTVNPGDRIAQ 119

Query: 116 LV 117
           LV
Sbjct: 120 LV 121


>DUT_BUCAT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score = 65.5 bits (158), Expect = 3e-13
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 6/145 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA-PGHREI-VGTGIAIALPLGTV-G 61
           IKI+  R+     LP  A  G +G+DL A  D  +    H+ I + TGIAI +    +  
Sbjct: 6   IKILDSRMKNNFSLPSYATLGSSGLDLRACLDETVKLKAHKTILIPTGIAIYIANPNITA 65

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           L+ PRSGL  ++G+ + N  G ID+DY+G++ + L N   ++   +   DR+AQ++    
Sbjct: 66  LILPRSGLGHKKGIVLGNLVGLIDSDYQGQLMISLWNRS-DQDFYVNPHDRVAQIIFVPI 124

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTG 146
                        T R  +G+G +G
Sbjct: 125 IRPCFLLVKNFNETSRSKKGFGHSG 149


>DUT_BUCAI RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score = 65.5 bits (158), Expect = 3e-13
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 6/145 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA-PGHREI-VGTGIAIALPLGTV-G 61
           IKI+  R+     LP  A  G +G+DL A  D  +    H+ I + TGIAI +    +  
Sbjct: 6   IKILDSRMKNNFSLPSYATLGSSGLDLRACLDETVKLKAHKTILIPTGIAIYIANPNITA 65

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           L+ PRSGL  ++G+ + N  G ID+DY+G++ + L N   ++   +   DR+AQ++    
Sbjct: 66  LILPRSGLGHKKGIVLGNLVGLIDSDYQGQLMISLWNRS-DQDFYVNPHDRVAQIIFVPI 124

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTG 146
                        T R  +G+G +G
Sbjct: 125 IRPCFLLVKNFNETSRSKKGFGHSG 149


>DUT_BUCA5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 154

 Score = 65.5 bits (158), Expect = 3e-13
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 6/145 (4%)

Query: 7   IKIV--RLDKELPLPKRAHRGDAGVDLHATTDAVIA-PGHREI-VGTGIAIALPLGTV-G 61
           IKI+  R+     LP  A  G +G+DL A  D  +    H+ I + TGIAI +    +  
Sbjct: 6   IKILDSRMKNNFSLPSYATLGSSGLDLRACLDETVKLKAHKTILIPTGIAIYIANPNITA 65

Query: 62  LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKX 121
           L+ PRSGL  ++G+ + N  G ID+DY+G++ + L N   ++   +   DR+AQ++    
Sbjct: 66  LILPRSGLGHKKGIVLGNLVGLIDSDYQGQLMISLWNRS-DQDFYVNPHDRVAQIIFVPI 124

Query: 122 XXXXXXXXXXXXXTVRGDQGYGSTG 146
                        T R  +G+G +G
Sbjct: 125 IRPCFLLVKNFNETSRSKKGFGHSG 149


>DUT_BORPE RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 64.7 bits (156), Expect = 5e-13
 Identities = 42/104 (40%), Positives = 60/104 (57%), Gaps = 4/104 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDA--VIAPGHREIVGTGIAIAL-PLGTVGLVHPRSGLAAREG 74
           LP  A  G AG+DL A T+A  VI PG   +V TG+AI +       ++ PRSGL  + G
Sbjct: 17  LPAYATPGSAGLDLRACTEASLVIEPGQTVLVPTGLAIHIGDPRYAAMILPRSGLGHKHG 76

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           + + N  G ID+DY+G++ V   N   + P  +   +R+AQLVI
Sbjct: 77  IVLGNLVGLIDSDYQGQLMVSTWNRGTQ-PFTLDPMERLAQLVI 119


>DUT_BLOFL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 63.9 bits (154), Expect = 8e-13
 Identities = 46/132 (34%), Positives = 68/132 (51%), Gaps = 7/132 (5%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIA--PGHREIVGTGIAIALP-LGTVGLVHPRSGLAAREG 74
           LP+    G AG+DL A  +  ++  P    ++ TGIAI +  +   G++ PRSGL    G
Sbjct: 18  LPQHITPGSAGLDLLACIEKPVSILPKETRLIPTGIAIYIEDIEVAGIILPRSGLGHYYG 77

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLV---IQKXXXXXXXXXXX 131
           + + N  G ID+DY+GEI + L N    K I+   G RIAQL+   I +           
Sbjct: 78  IVLGNTIGLIDSDYQGEIMISLWNRGSNKFILYP-GKRIAQLLFISILRVKLSLVKSFDP 136

Query: 132 XXXTVRGDQGYG 143
              T+RG +G+G
Sbjct: 137 FMKTIRGVKGFG 148


>DUT_LEGPL RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 63.2 bits (152), Expect = 1e-12
 Identities = 44/122 (36%), Positives = 66/122 (54%), Gaps = 6/122 (4%)

Query: 1   MTDLAPIKIV--RLDKELPLPKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALP 56
           M  +  +KI+  R+   + LP  A  G AG+DL    +    +AP    ++ TGIAI + 
Sbjct: 1   MHQVIQLKILDSRIGDTISLPAYATDGSAGLDLRVCISEPMQVAPQQTVLLPTGIAIYIA 60

Query: 57  LGTVG-LVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQ 115
              +  ++ PRSGL  + G+ + N  G ID+DY+GE+K+   N   E    +  GDRIAQ
Sbjct: 61  DPKLAAVILPRSGLGHKNGIVLGNLVGLIDSDYQGELKISCWNRSQEH-FTVNPGDRIAQ 119

Query: 116 LV 117
           LV
Sbjct: 120 LV 121


>DUT_ENTS8 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 62.8 bits (151), Expect = 2e-12
 Identities = 44/141 (31%), Positives = 67/141 (47%), Gaps = 6/141 (4%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTG----IAIALPLGTVGLVHPR 66
           R+ ++ PLP  A  G AG+DL A  D  +               I IA P     ++ PR
Sbjct: 13  RVGEQFPLPTYATSGSAGLDLRACLDESVEXXXXXXXXXXXXXXIHIADP-SLAAVILPR 71

Query: 67  SGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXX 126
           SGL  + G+ + N  G ID+DY+G++ V + N   ++   I  G+RIAQ+V         
Sbjct: 72  SGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG-QQSFTIEPGERIAQMVFVPVVQAEF 130

Query: 127 XXXXXXXXTVRGDQGYGSTGK 147
                   T RG+ G+G +G+
Sbjct: 131 NLVEDFTATDRGEGGFGHSGR 151


>DUT_PSEPF RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 151

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 46/139 (33%), Positives = 68/139 (48%), Gaps = 4/139 (2%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIAL-PLGTVGLVHPRS 67
           R+  E PLP+ A  G AG+DL A    D VI PG   ++ TG+++ +       L+ PRS
Sbjct: 12  RIGTEFPLPQYATPGSAGLDLRAMLQEDIVIKPGETVLIPTGLSVYIGDPNLAALILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXX 127
           G+  + G+ + N  G ID+DY+G + V   N   +    +  G+R               
Sbjct: 72  GMGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRG-QTEFTMPVGERXXXXXXXXXXXXHFE 130

Query: 128 XXXXXXXTVRGDQGYGSTG 146
                  T RG  G+G +G
Sbjct: 131 MVEEFVETERGTGGFGHSG 149


>DUT_POLNS RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 62.0 bits (149), Expect = 3e-12
 Identities = 44/133 (33%), Positives = 63/133 (47%), Gaps = 4/133 (3%)

Query: 18  LPKRAHRGDAGVDLHATTDAVI--APGHREIVGTGIAIALPLGT-VGLVHPRSGLAAREG 74
           LP     G AG+DL A  D  I  APG   +V TG+AI +        + PRSGL  +  
Sbjct: 17  LPTYGTPGSAGLDLRACIDEAITIAPGQTVLVPTGLAIYVEDPRYAAFILPRSGLGHKHS 76

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXX 134
           + + N  G ID+DY+G++ V   N        +   +R+AQLV+                
Sbjct: 77  IVLGNLVGLIDSDYQGQLMVSTWNRG-STTFKLEPMERLAQLVVMPVQQVELKVVEEFTE 135

Query: 135 TVRGDQGYGSTGK 147
           + RG  G+GSTG+
Sbjct: 136 SSRGAGGFGSTGR 148


>POL_FIVT2 RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;           EC=3.4.23.-;  AltName:
           Full=Retropepsin;Contains:
          Length = 1124

 Score = 61.6 bits (148), Expect = 4e-12
 Identities = 47/130 (36%), Positives = 65/130 (50%), Gaps = 7/130 (5%)

Query: 18  LPKRAHRGDAGVDLHATTDAV-IAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLS 76
           L KR+   DAG DL A        PG   IV T   I LP G  GL+  +S + ++ G+ 
Sbjct: 718 LEKRSE--DAGYDLLAAAQETHFLPGEVRIVPTKTRIMLPKGHWGLIMGKSSIGSK-GVD 774

Query: 77  IVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTV 136
           ++   G ID  YRGE+ V +INL  +K I I    +IAQL+I                + 
Sbjct: 775 VLG--GVIDEGYRGELGVIMINL-TKKSITILEKQKIAQLIILPCRHEGLQQGEIQMNSE 831

Query: 137 RGDQGYGSTG 146
           RG++G+GS G
Sbjct: 832 RGEKGFGSAG 841


>POL_EIAVY RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;  AltName: Full=Retropepsin;         
           EC=3.4.23.-;Contains:
          Length = 1145

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 41/121 (33%), Positives = 62/121 (51%), Gaps = 4/121 (3%)

Query: 26  DAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTID 85
           DAG DL    D +I     +I+ T + I +P  + G V  +S +A ++GL ++N  G ID
Sbjct: 756 DAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSMA-KQGL-LING-GIID 812

Query: 86  ADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGYGST 145
             Y GEI+V   N+     I +  G + AQL+I +              + RGD+G+GST
Sbjct: 813 EGYTGEIQVICTNIGKSN-IKLIEGQKFAQLIILQHHSNSRQPWDENKISQRGDKGFGST 871

Query: 146 G 146
           G
Sbjct: 872 G 872


>POL_EIAVC RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;  AltName: Full=Retropepsin;         
           EC=3.4.23.-;Contains:
          Length = 1146

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 41/121 (33%), Positives = 62/121 (51%), Gaps = 4/121 (3%)

Query: 26  DAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTID 85
           DAG DL    D +I     +I+ T + I +P  + G V  +S +A ++GL ++N  G ID
Sbjct: 757 DAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSMA-KQGL-LING-GIID 813

Query: 86  ADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGYGST 145
             Y GEI+V   N+     I +  G + AQL+I +              + RGD+G+GST
Sbjct: 814 EGYTGEIQVICTNIGKSN-IKLIEGQKFAQLIILQHHSNSRQPWDENKISQRGDKGFGST 872

Query: 146 G 146
           G
Sbjct: 873 G 873


>POL_EIAV9 RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;  AltName: Full=Retropepsin;         
           EC=3.4.23.-;Contains:
          Length = 1146

 Score = 59.7 bits (143), Expect = 2e-11
 Identities = 41/121 (33%), Positives = 62/121 (51%), Gaps = 4/121 (3%)

Query: 26  DAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTID 85
           DAG DL    D +I     +I+ T + I +P  + G V  +S +A ++GL ++N  G ID
Sbjct: 757 DAGFDLCVPYDIMIPVSDTKIIPTDVKIQVPPNSFGWVTGKSSMA-KQGL-LING-GIID 813

Query: 86  ADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGDQGYGST 145
             Y GEI+V   N+     I +  G + AQL+I +              + RGD+G+GST
Sbjct: 814 EGYTGEIQVICTNIGKSN-IKLIEGQKFAQLIILQHHSNSRQPWDENKISQRGDKGFGST 872

Query: 146 G 146
           G
Sbjct: 873 G 873


>DUT_LARHH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 149

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 39/101 (38%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 19  PKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALPLGT-VGLVHPRSGLAAREGL 75
           P  A  G AG+DL A  DA   I PG   ++ TGIA+ L       ++ PRSGL  + G+
Sbjct: 18  PAYATPGSAGLDLRAAIDAETEIRPGETRLIPTGIALHLEDPRYAAMILPRSGLGHKHGI 77

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQL 116
            + N  G ID+DY+G++ V + N   E    +   DRIAQ+
Sbjct: 78  VLGNLVGLIDSDYQGQVFVSVWNRGHE-TFRLAPLDRIAQM 117


>DUT_BUCBP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 152

 Score = 58.2 bits (139), Expect = 5e-11
 Identities = 43/140 (30%), Positives = 68/140 (48%), Gaps = 5/140 (3%)

Query: 11  RLDKELPLPKRAHRGDAGVDLHATT--DAVIAPGHREIVGTGIAIALPLGTV-GLVHPRS 67
           R+  +  LP  A  G +G+DL A      ++ P    ++ TGIA+ +    +  ++ PRS
Sbjct: 12  RIGTQFSLPSYATSGSSGLDLRACIKDSIILLPNETVLIPTGIAVYIDDPYITAIILPRS 71

Query: 68  GLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLV-IQKXXXXXX 126
           GL   +G+ + N  G ID+DY+G++ V L N    +   +  G RIAQ+V I        
Sbjct: 72  GLGHVQGIVLGNLVGLIDSDYQGQVMVSLWNRG-SRNFSVKVGMRIAQIVFIPIIRPIFE 130

Query: 127 XXXXXXXXTVRGDQGYGSTG 146
                   T R  QG+G +G
Sbjct: 131 IVTNFVVDTERKVQGFGHSG 150


>POL_CAEVC RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;  AltName: Full=Retropepsin;         
           EC=3.4.23.-;Contains:
          Length = 1109

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 37/129 (28%), Positives = 64/129 (49%), Gaps = 6/129 (4%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           LPKR    DAG DL    +  I PG  + +   + + L      ++  +S +AA+    +
Sbjct: 705 LPKREE--DAGYDLICPEEVTIEPGQVKCIPIELRLNLKKSQWAMIATKSSMAAK---GV 759

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVR 137
               G ID+ Y+G+I+V + N + +  ++I +G + AQL++                T R
Sbjct: 760 FTQGGIIDSGYQGQIQVIMYNSN-KIAVVIPQGRKFAQLILMDKKHGKLEPWGESRKTER 818

Query: 138 GDQGYGSTG 146
           G++G+GSTG
Sbjct: 819 GEKGFGSTG 827


>DUT_FRAP2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 57.4 bits (137), Expect = 8e-11
 Identities = 47/146 (32%), Positives = 67/146 (45%), Gaps = 7/146 (4%)

Query: 7   IKIVRLDKEL--PLPKRAHRGDAGVDLHATTDAV--IAPGHREIVGTGIAIALPLGTVGL 62
           I++  L+KE+   +P+    G A VDL A       ++PG  +++GTG            
Sbjct: 3   IELKLLNKEIIKEVPEYGTEGSAAVDLRACLSEAEFLSPGECKLIGTGXXXXXXXXXXXX 62

Query: 63  VH-PRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQL-VIQK 120
              PRSGL  ++GL + N  G ID+DY+GE+ V   N   E  I I    R AQL V+  
Sbjct: 63  XXLPRSGLGHKKGLVLGNGTGLIDSDYQGELMVSCFNRSQE-VIEIEPMMRFAQLVVVPV 121

Query: 121 XXXXXXXXXXXXXXTVRGDQGYGSTG 146
                         T+R   G+G TG
Sbjct: 122 VQAKFDIVEEFSQRTIRSAGGFGHTG 147


>VPRT_SRV2 RecName: Full=Protease;         EC=3.4.23.-;
          Length = 314

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 46/126 (36%), Positives = 62/126 (49%), Gaps = 10/126 (7%)

Query: 21  RAHRGDAGVDLHATTDAVIAPG-HREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVN 79
           RA  G AG+DL +TT  V+ P    + + TG+   LP  T GL+  R G    +GL I  
Sbjct: 43  RASPGSAGLDLCSTTHTVLTPEMGPQTLATGVYGPLPPNTFGLILGR-GSTTVKGLQIY- 100

Query: 80  APGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGD 139
            PG ID DY GE K+    +     I I +G+RIAQLV+                  RGD
Sbjct: 101 -PGVIDNDYTGEFKIMARAI--SSIITIPQGERIAQLVL----LPLLRTAHKIQHPYRGD 153

Query: 140 QGYGST 145
           + +GS+
Sbjct: 154 KNFGSS 159


>VPRT_MPMV RecName: Full=Protease;         EC=3.4.23.-;
          Length = 314

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 42/120 (35%), Positives = 67/120 (55%), Gaps = 8/120 (6%)

Query: 2   TDLAPIKIVRLDKELPLPK--RAHRGDAGVDLHATTDAVIAPGHR-EIVGTGIAIALPLG 58
           T L   ++    ++ P+ K  RA  G AG+DL +T+  V+ P    + + TGI   LP  
Sbjct: 22  TSLWGSQLCSSQQKQPISKLTRATPGSAGLDLCSTSHTVLTPEMGPQALSTGIYGPLPPN 81

Query: 59  TVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           T GL+  RS +  + GL +   PG ID DY GEIK+    ++    + +++G+RIAQL++
Sbjct: 82  TFGLILGRSSITMK-GLQVY--PGVIDNDYTGEIKIMAKAVN--NIVTVSQGNRIAQLIL 136


>DUT_YMTV RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 143

 Score = 57.0 bits (136), Expect = 1e-10
 Identities = 39/129 (30%), Positives = 58/129 (44%), Gaps = 3/129 (2%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           +P R+ +  AG DL++  D ++ P  R +V T I +++P    G +  RSGL+     S 
Sbjct: 17  IPTRSSKKSAGYDLYSAYDYLVRPKSRVLVKTDICLSIPDECYGRIASRSGLSLNN--SX 74

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVR 137
                              IN +   P  I RGDRIAQ+V ++              T R
Sbjct: 75  XXXXXXXXXXXXXXXXXXFIN-NGNSPHYIKRGDRIAQIVFERLANVEIKEISNLDCTCR 133

Query: 138 GDQGYGSTG 146
           GD G+GS+G
Sbjct: 134 GDCGFGSSG 142


>VPRT_SRV1 RecName: Full=Protease;         EC=3.4.23.-;
          Length = 314

 Score = 56.6 bits (135), Expect = 1e-10
 Identities = 38/99 (38%), Positives = 57/99 (57%), Gaps = 6/99 (6%)

Query: 21  RAHRGDAGVDLHATTDAVIAPGHR-EIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVN 79
           RA  G AG+DL +T+  V+ P    + + TGI   LP  T GL+  RS +  + GL +  
Sbjct: 43  RATPGSAGLDLSSTSHTVLTPEMGPQALSTGIYGPLPPNTFGLILGRSSITIK-GLQVY- 100

Query: 80  APGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
            PG ID DY GEIK+    ++    + + +G+RIAQL++
Sbjct: 101 -PGVIDNDYTGEIKIMAKAVN--NIVTVPQGNRIAQLIL 136


>POL_OMVVS RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;           EC=3.4.23.-;  AltName:
           Full=Retropepsin;Contains:
          Length = 1086

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 40/129 (31%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           LPKRA   DAG DL    +  I  G    +   + I L      +V  +S  A++    +
Sbjct: 681 LPKRAE--DAGYDLICPQEVCIPAGQVRKIPINLRINLKEDQWAMVGTKSSFASK---GV 735

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVR 137
               G ID+ Y+G I+V + N + +K ++I +G + AQL++                T R
Sbjct: 736 FVQGGIIDSGYQGIIQVVVYNSN-DKEVIIPQGRKFAQLILMPLIHEDLEAWGETRRTER 794

Query: 138 GDQGYGSTG 146
           G+QG+GSTG
Sbjct: 795 GNQGFGSTG 803


>DUT_LACLA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 150

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 31/104 (29%), Positives = 55/104 (52%), Gaps = 7/104 (6%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           +PKR+    AG D+ A      APG  +++ TG+   +  G V  ++ RS    ++GL +
Sbjct: 19  IPKRSTEHSAGYDIEAAETVSFAPGEIKLIPTGLKAYMQAGEVLYMYDRSSNPRKKGLVL 78

Query: 78  VNAPGTIDADY------RGEIKVCLINLDPEKPIMITRGDRIAQ 115
           +N+ G ID DY       G + + + N   E+ ++I +G+R+ Q
Sbjct: 79  INSVGVIDKDYYNNPDNEGHMFMQMRNFTDEE-VVIEKGERVVQ 121


>DUT_ICHV1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 188

 Score = 55.1 bits (131), Expect = 4e-10
 Identities = 35/104 (33%), Positives = 53/104 (50%), Gaps = 8/104 (7%)

Query: 15  ELPLPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREG 74
           ++ +PK +  G AG DL    D     G    + TG+AIA+P G VG++ PRS  A    
Sbjct: 63  DVSIPKISSPGSAGFDLSVLEDREFIRGCHYRLPTGLAIAVPRGYVGIITPRSSQAKN-- 120

Query: 75  LSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
                + G ID+D+RG I + +  +       + +  RIAQLV+
Sbjct: 121 ---FVSTGIIDSDFRGHIHIMVSAI---ADFSVKKNQRIAQLVV 158


>VPRT_MMTVB RecName: Full=Protease;         EC=3.4.23.-;
          Length = 274

 Score = 52.4 bits (124), Expect = 3e-09
 Identities = 48/126 (38%), Positives = 71/126 (56%), Gaps = 10/126 (7%)

Query: 21  RAHRGDAGVDLHATTDAVIA-PGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVN 79
           R   G AG+DL +  D +++      +V T +   LP GT GL+  RS    ++GL ++ 
Sbjct: 39  RGTPGSAGLDLSSQKDLILSLEDGVSLVPTLVKGTLPEGTTGLIIGRSS-NYKKGLEVL- 96

Query: 80  APGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVRGD 139
            PG ID+D++GEIKV +     +  ++I +G+RIAQ                     RG 
Sbjct: 97  -PGVIDSDFQGEIKVMV--KAAKNAVIIHKGERIAQXXXXXXXXXXXXVIKEE----RGS 149

Query: 140 QGYGST 145
           +G+GST
Sbjct: 150 EGFGST 155


>POL_VILVK RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;           EC=3.4.23.-;  AltName:
           Full=Retropepsin;Contains:
          Length = 1101

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 38/129 (29%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           L KRA   DAG DL    +  I  G  + +   + I L      ++  +S  A +    +
Sbjct: 696 LQKRAE--DAGYDLICPQEISIPAGQVKRIAIDLKINLKKDQWAMIGTKSSFANK---GV 750

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVR 137
               G ID+ Y+G I+V + N +  K ++I +G + AQL++                T R
Sbjct: 751 FVQGGIIDSGYQGTIQVVIYNSN-NKEVVIPQGRKFAQLILMPLIHEELEPWGETRKTER 809

Query: 138 GDQGYGSTG 146
           G+QG+GSTG
Sbjct: 810 GEQGFGSTG 818


>POL_VILV2 RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;  AltName: Full=Retropepsin;         
           EC=3.4.23.-;Contains:
          Length = 1105

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 38/129 (29%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           L KRA   DAG DL    +  I  G  + +   + I L      ++  +S  A +    +
Sbjct: 700 LQKRAE--DAGYDLICPQEISIPAGQVKRIAIDLKINLKKDQWAMIGTKSSFANK---GV 754

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVR 137
               G ID+ Y+G I+V + N +  K ++I +G + AQL++                T R
Sbjct: 755 FVQGGIIDSGYQGTIQVVIYNSN-NKEVVIPQGRKFAQLILMPLIHEELKPWGETRKTER 813

Query: 138 GDQGYGSTG 146
           G+QG+GSTG
Sbjct: 814 GEQGFGSTG 822


>POL_VILV1 RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;  AltName: Full=Retropepsin;         
           EC=3.4.23.-;Contains:
          Length = 1105

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 38/129 (29%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           L KRA   DAG DL    +  I  G  + +   + I L      ++  +S  A +    +
Sbjct: 700 LQKRAE--DAGYDLICPQEISIPAGQVKRIAIDLKINLKKDQWAMIGTKSSFANK---GV 754

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVR 137
               G ID+ Y+G I+V + N +  K ++I +G + AQL++                T R
Sbjct: 755 FVQGGIIDSGYQGTIQVVIYNSN-NKEVVIPQGRKFAQLILMPLIHEELEPWGETRKTER 813

Query: 138 GDQGYGSTG 146
           G+QG+GSTG
Sbjct: 814 GEQGFGSTG 822


>POL_VILV RecName: Full=Pol polyprotein;Contains:  RecName:
           Full=Protease;           EC=3.4.23.-;  AltName:
           Full=Retropepsin;Contains:
          Length = 1105

 Score = 51.6 bits (122), Expect = 4e-09
 Identities = 38/129 (29%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 18  LPKRAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSI 77
           L KRA   DAG DL    +  I  G  + +   + I L      ++  +S  A +    +
Sbjct: 700 LQKRAE--DAGYDLICPQEISIPAGQVKRIAIDLKINLKKDQWAMIGTKSSFANK---GV 754

Query: 78  VNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQKXXXXXXXXXXXXXXTVR 137
               G ID+ Y+G I+V + N +  K ++I +G + AQL++                T R
Sbjct: 755 FVQGGIIDSGYQGTIQVVIYNSN-NKEVVIPQGRKFAQLILMPLIHEELEPWGETRKTER 813

Query: 138 GDQGYGSTG 146
           G+QG+GSTG
Sbjct: 814 GEQGFGSTG 822


>DUT_FRATW RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 43/136 (31%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 19  PKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREGL 75
           P  A  G A +DL A  +    +  G  ++V TG               PRSGL  ++GL
Sbjct: 17  PGYATEGSAAIDLRACISESIYLKSGECKLVATGXXXXXXXXXXXXXXLPRSGLGHKKGL 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPE----KPIMITRGDRIAQLVI-QKXXXXXXXXXX 130
            + N  G ID+DY+GE+ V   N   E    +P+M     R AQLVI             
Sbjct: 77  VLGNGTGLIDSDYQGELMVSCFNRSQETIEIEPLM-----RFAQLVIVPVVQANFEIVED 131

Query: 131 XXXXTVRGDQGYGSTG 146
               +VR   G+G TG
Sbjct: 132 FSQQSVRATGGFGHTG 147


>DUT_FRATT RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 43/136 (31%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 19  PKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREGL 75
           P  A  G A +DL A  +    +  G  ++V TG               PRSGL  ++GL
Sbjct: 17  PGYATEGSAAIDLRACISESIYLKSGECKLVATGXXXXXXXXXXXXXXLPRSGLGHKKGL 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPE----KPIMITRGDRIAQLVI-QKXXXXXXXXXX 130
            + N  G ID+DY+GE+ V   N   E    +P+M     R AQLVI             
Sbjct: 77  VLGNGTGLIDSDYQGELMVSCFNRSQETIEIEPLM-----RFAQLVIVPVVQANFEIVED 131

Query: 131 XXXXTVRGDQGYGSTG 146
               +VR   G+G TG
Sbjct: 132 FSQQSVRATGGFGHTG 147


>DUT_FRATN RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 43/136 (31%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 19  PKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREGL 75
           P  A  G A +DL A  +    +  G  ++V TG               PRSGL  ++GL
Sbjct: 17  PGYATEGSAAIDLRACISESIYLKSGECKLVATGXXXXXXXXXXXXXXLPRSGLGHKKGL 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPE----KPIMITRGDRIAQLVI-QKXXXXXXXXXX 130
            + N  G ID+DY+GE+ V   N   E    +P+M     R AQLVI             
Sbjct: 77  VLGNGTGLIDSDYQGELMVSCFNRSQETIEIEPLM-----RFAQLVIVPVVQANFEIVED 131

Query: 131 XXXXTVRGDQGYGSTG 146
               +VR   G+G TG
Sbjct: 132 FSQQSVRATGGFGHTG 147


>DUT_FRATM RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 43/136 (31%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 19  PKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREGL 75
           P  A  G A +DL A  +    +  G  ++V TG               PRSGL  ++GL
Sbjct: 17  PGYATEGSAAIDLRACISESIYLKSGECKLVATGXXXXXXXXXXXXXXLPRSGLGHKKGL 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPE----KPIMITRGDRIAQLVI-QKXXXXXXXXXX 130
            + N  G ID+DY+GE+ V   N   E    +P+M     R AQLVI             
Sbjct: 77  VLGNGTGLIDSDYQGELMVSCFNRSQETIEIEPLM-----RFAQLVIVPVVQANFEIVED 131

Query: 131 XXXXTVRGDQGYGSTG 146
               +VR   G+G TG
Sbjct: 132 FSQQSVRATGGFGHTG 147


>DUT_FRAT1 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 43/136 (31%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 19  PKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREGL 75
           P  A  G A +DL A  +    +  G  ++V TG               PRSGL  ++GL
Sbjct: 17  PGYATEGSAAIDLRACISESIYLKSGECKLVATGXXXXXXXXXXXXXXLPRSGLGHKKGL 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPE----KPIMITRGDRIAQLVI-QKXXXXXXXXXX 130
            + N  G ID+DY+GE+ V   N   E    +P+M     R AQLVI             
Sbjct: 77  VLGNGTGLIDSDYQGELMVSCFNRSQETIEIEPLM-----RFAQLVIVPVVQANFEIVED 131

Query: 131 XXXXTVRGDQGYGSTG 146
               +VR   G+G TG
Sbjct: 132 FSQQSVRATGGFGHTG 147


>DUT_FRATO RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 48.9 bits (115), Expect = 3e-08
 Identities = 42/136 (30%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 19  PKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREGL 75
           P  A  G A +DL A  +    +  G  +++ TG               PRSGL  ++GL
Sbjct: 17  PGYATEGSAAIDLRACISESIYLKSGECKLIATGXXXXXXXXXXXXXXLPRSGLGHKKGL 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPE----KPIMITRGDRIAQLVI-QKXXXXXXXXXX 130
            + N  G ID+DY+GE+ V   N   E    +P+M     R AQLVI             
Sbjct: 77  VLGNGTGLIDSDYQGELMVSCFNRSQETIEIEPLM-----RFAQLVIVPVVQANFEIVED 131

Query: 131 XXXXTVRGDQGYGSTG 146
               +VR   G+G TG
Sbjct: 132 FSQQSVRATGGFGHTG 147


>DUT_FRATH RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 48.9 bits (115), Expect = 3e-08
 Identities = 42/136 (30%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 19  PKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREGL 75
           P  A  G A +DL A  +    +  G  +++ TG               PRSGL  ++GL
Sbjct: 17  PGYATEGSAAIDLRACISESIYLKSGECKLIATGXXXXXXXXXXXXXXLPRSGLGHKKGL 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPE----KPIMITRGDRIAQLVI-QKXXXXXXXXXX 130
            + N  G ID+DY+GE+ V   N   E    +P+M     R AQLVI             
Sbjct: 77  VLGNGTGLIDSDYQGELMVSCFNRSQETIEIEPLM-----RFAQLVIVPVVQANFEIVED 131

Query: 131 XXXXTVRGDQGYGSTG 146
               +VR   G+G TG
Sbjct: 132 FSQQSVRATGGFGHTG 147


>DUT_FRATF RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 148

 Score = 48.9 bits (115), Expect = 3e-08
 Identities = 42/136 (30%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 19  PKRAHRGDAGVDLHA--TTDAVIAPGHREIVGTGIAIALPLGTVGLVH-PRSGLAAREGL 75
           P  A  G A +DL A  +    +  G  +++ TG               PRSGL  ++GL
Sbjct: 17  PGYATEGSAAIDLRACISESIYLKSGECKLIATGXXXXXXXXXXXXXXLPRSGLGHKKGL 76

Query: 76  SIVNAPGTIDADYRGEIKVCLINLDPE----KPIMITRGDRIAQLVI-QKXXXXXXXXXX 130
            + N  G ID+DY+GE+ V   N   E    +P+M     R AQLVI             
Sbjct: 77  VLGNGTGLIDSDYQGELMVSCFNRSQETIEIEPLM-----RFAQLVIVPVVQANFEIVED 131

Query: 131 XXXXTVRGDQGYGSTG 146
               +VR   G+G TG
Sbjct: 132 FSQQSVRATGGFGHTG 147


>DUT_BUCAP RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 159

 Score = 47.8 bits (112), Expect = 6e-08
 Identities = 45/149 (30%), Positives = 65/149 (43%), Gaps = 10/149 (6%)

Query: 7   IKIVRLDKELP------LPKRAHRGDAGVDLHATTDAVIAPGHREI--VGTGIAIALPLG 58
           IKI  LD  +       LP+ A  G +G+DL A+    I+   +E+  V TGIAI +   
Sbjct: 10  IKIRILDSNIKKNSSFFLPQYATPGSSGLDLRASIKKKISLPSKEVILVPTGIAIHIDNP 69

Query: 59  TV-GLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLV 117
            +  LV PRS                 D+DY+GE+ + L N   +    I   DRIAQ++
Sbjct: 70  YITALVLPRSXXXXXXXXXXXXXXXXXDSDYQGELMISLWNRS-KNIFFINPYDRIAQMI 128

Query: 118 IQKXXXXXXXXXXXXXXTVRGDQGYGSTG 146
                            TVR  +G+G +G
Sbjct: 129 FVPIIRPTFSIVDDFEETVRFGKGFGHSG 157


>VPRT_JSRV RecName: Full=Bifunctional protease/dUTPase;Includes:
           RecName: Full=Aspartic protease;         
           EC=3.4.23.-;Includes:  RecName: Full=Deoxyuridine
           5'-triphosphate nucleotidohydrolase;
          Length = 326

 Score = 47.0 bits (110), Expect = 1e-07
 Identities = 35/98 (35%), Positives = 47/98 (47%), Gaps = 4/98 (4%)

Query: 21  RAHRGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNA 80
           RA RG AG+DL AT+  V+ P                            A+ +G+ I   
Sbjct: 55  RATRGSAGLDLCATSYTVLTPEMGVQTLAXXXXXXXXXXXXXXXXXRSSASLKGILI--H 112

Query: 81  PGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           PG ID+DY GEIK+  +   P K I+I  G RIAQL++
Sbjct: 113 PGVIDSDYTGEIKI--LASAPNKIIVINAGQRIAQLLL 148


>POK4_HUMAN RecName: Full=HERV-K_6q14.1 provirus ancestral Gag-Pol
           polyprotein;AltName: Full=HERV-K109 Gag-Pol
           protein;AltName: Full=HERV-K(C6) Gag-Pol protein;
          Length = 1117

 Score = 44.3 bits (103), Expect = 7e-07
 Identities = 33/91 (36%), Positives = 50/91 (54%), Gaps = 7/91 (7%)

Query: 29  VDLHATTDAVIAPGHR-EIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDAD 87
           VDL       + PG   + + TG+   LP GTVGL+  RS L  + G+ I  +   +D+D
Sbjct: 667 VDLCTIQAVSLLPGEPPQKIPTGVYGPLPEGTVGLILGRSSLNLK-GVQIHTS--VVDSD 723

Query: 88  YRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
           Y+GEI++    +    P   + GDRIAQL++
Sbjct: 724 YKGEIQLV---ISSSVPWSASPGDRIAQLLL 751


>DUTP_ASFB7 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 165

 Score = 41.6 bits (96), Expect = 5e-06
 Identities = 43/135 (31%), Positives = 62/135 (45%), Gaps = 13/135 (9%)

Query: 24  RGDAGVDLHATTDAVIAPGHREIVGTGIAIALP-LG-TVGL-VHPRSGLAAREGLSIV-N 79
           R D GVD++  +D V+ PG   IV   I +A   +G   G  +  RS +   E L I+ N
Sbjct: 27  RKDLGVDVYCCSDLVLQPG-LNIVRLHIKVACEHMGKKCGFKIMARSSMCTHERLLILAN 85

Query: 80  APGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-------XXXXXXXXXXXX 132
             G ID  Y GE+ + +INL  + P+ I   + + QLV Q                    
Sbjct: 86  GIGLIDPGYVGELMLKIINLG-DTPVQIWAKECLVQLVAQGDHVPDHINILKRNQIFPLF 144

Query: 133 XXTVRGDQGYGSTGK 147
             T RG+  +GSTG+
Sbjct: 145 APTPRGEGRFGSTGE 159


>DUTP_ASFK5 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 165

 Score = 41.2 bits (95), Expect = 6e-06
 Identities = 41/135 (30%), Positives = 60/135 (44%), Gaps = 13/135 (9%)

Query: 24  RGDAGVDLHATTDAVIAPGHREIVGTGIAIALPLGTVGL---VHPRSGLAAREGLSIV-N 79
           R D GVD++  +D V+ PG   IV   I +A           +  RS +   E L I+ N
Sbjct: 27  RQDLGVDVYCCSDLVLQPG-LNIVRLHIKVACEHRGKKCGFKIMARSSMCTHERLLILAN 85

Query: 80  APGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-------XXXXXXXXXXXX 132
           + G ID  Y GE+ + +INL  + P+ I   + + QLV Q                    
Sbjct: 86  SIGLIDPGYVGELMLKIINLG-DTPVQIWAKECLVQLVAQGDHVPDHINILKRNQIFPLF 144

Query: 133 XXTVRGDQGYGSTGK 147
             T RG+  +GSTG+
Sbjct: 145 APTPRGEGRFGSTGE 159


>DUTP_ASFWA RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 165

 Score = 40.8 bits (94), Expect = 8e-06
 Identities = 43/135 (31%), Positives = 62/135 (45%), Gaps = 13/135 (9%)

Query: 24  RGDAGVDLHATTDAVIAPGHREIVGTGIAIALP-LG-TVGL-VHPRSGLAAREGLSIV-N 79
           R D GVD++  +D V+ PG   IV   I +A   +G   G  +  RS +   E L I+ N
Sbjct: 27  RKDLGVDVYCCSDLVLQPG-LNIVRLHIKVACEHMGKKCGFKIMARSSMCTYERLLILAN 85

Query: 80  APGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-------XXXXXXXXXXXX 132
             G ID  Y GE+ + +INL  + P+ I   + + QLV Q                    
Sbjct: 86  GIGLIDPGYVGELMLKIINLG-DTPVQIWAKECLVQLVAQGDHVPDHINILKRNQIFPLF 144

Query: 133 XXTVRGDQGYGSTGK 147
             T RG+  +GSTG+
Sbjct: 145 APTPRGEGRFGSTGE 159


>DUTP_ASFP4 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 165

 Score = 40.8 bits (94), Expect = 8e-06
 Identities = 43/135 (31%), Positives = 62/135 (45%), Gaps = 13/135 (9%)

Query: 24  RGDAGVDLHATTDAVIAPGHREIVGTGIAIALP-LG-TVGL-VHPRSGLAAREGLSIV-N 79
           R D GVD++  +D V+ PG   IV   I +A   +G   G  +  RS +   E L I+ N
Sbjct: 27  RKDLGVDVYCCSDLVLQPG-LNIVRLHIKVACEHMGKKCGFKIMARSSMCTYERLLILAN 85

Query: 80  APGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-------XXXXXXXXXXXX 132
             G ID  Y GE+ + +INL  + P+ I   + + QLV Q                    
Sbjct: 86  GIGLIDPGYVGELMLKIINLG-DTPVQIWAKECLVQLVAQGDHVPDHINILKRNQIFPLF 144

Query: 133 XXTVRGDQGYGSTGK 147
             T RG+  +GSTG+
Sbjct: 145 APTPRGEGRFGSTGE 159


>DCD_METMJ RecName: Full=Probable deoxycytidine triphosphate
           deaminase;         Short=dCTP deaminase;       
           EC=3.5.4.13;
          Length = 187

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)

Query: 38  VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLI 97
           V+APG   +  T  AI LP   V  +  +S +A R G+ +    G IDA +RG I + + 
Sbjct: 71  VLAPGRFLLAETLEAIELPDDIVASIEGKSSIA-RLGVELHQTGGWIDAGFRGTITLEMC 129

Query: 98  NLDPEKPIMITRGDRIAQLVIQK 120
           N++  +P+ +  G  I QLV  +
Sbjct: 130 NVN-SRPVKVYAGMPIGQLVFYR 151


>DCD_AQUAE RecName: Full=Deoxycytidine triphosphate deaminase;      
             Short=dCTP deaminase;         EC=3.5.4.13;
          Length = 180

 Score = 40.4 bits (93), Expect = 1e-05
 Identities = 29/68 (42%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 53  IALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDR 112
           I+LP      V  RS L  R GL I NA G +DA + G+I + L N + ++PI + RG R
Sbjct: 83  ISLPPYVTAFVEGRSSLG-RLGLFIENA-GWVDAGFEGQITLELFNAN-DRPIRLYRGMR 139

Query: 113 IAQLVIQK 120
           I QLV  +
Sbjct: 140 ICQLVFAR 147


>DUTP_ASFM2 RecName: Full=Deoxyuridine 5'-triphosphate
           nucleotidohydrolase;         Short=dUTPase;       
           EC=3.6.1.23;AltName: Full=dUTP pyrophosphatase;
          Length = 162

 Score = 40.0 bits (92), Expect = 1e-05
 Identities = 42/135 (31%), Positives = 62/135 (45%), Gaps = 13/135 (9%)

Query: 24  RGDAGVDLHATTDAVIAPGHREIVGTGIAIALP-LGT-VGL-VHPRSGLAAREGLSIV-N 79
           R D GVD++  ++ V+ PG   I+   I +A   +G   G  +  RS +   E L I+ N
Sbjct: 27  RKDLGVDVYCCSNLVLQPG-LNIIPLHIKVACEHMGKKCGFKIMARSSMCTHERLLILAN 85

Query: 80  APGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVIQK-------XXXXXXXXXXXX 132
             G ID  Y GE+ + +INL  + P+ I   + + QLV Q                    
Sbjct: 86  GIGLIDPGYVGELMLKIINLG-DIPVQIWAKECLVQLVAQGDHVPDHINILKRNEIFPLF 144

Query: 133 XXTVRGDQGYGSTGK 147
             T RG+  +GSTGK
Sbjct: 145 APTPRGEGRFGSTGK 159


>DCD_THEAC RecName: Full=Probable deoxycytidine triphosphate
           deaminase;         Short=dCTP deaminase;       
           EC=3.5.4.13;
          Length = 166

 Score = 37.4 bits (85), Expect = 9e-05
 Identities = 24/75 (32%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 46  IVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPI 105
           +V T   + +P   VG++  RS  A +    I  + G IDA Y G + +   N      +
Sbjct: 58  LVSTIEILKIPDDVVGMIWTRSSFARK---GIFGSFGAIDAGYHGNLTLSFFNAG--SAV 112

Query: 106 MITRGDRIAQLVIQK 120
            + RG+RIAQ+V  K
Sbjct: 113 NLRRGERIAQIVFVK 127


>DCD_METB6 RecName: Full=Probable deoxycytidine triphosphate
           deaminase;         Short=dCTP deaminase;       
           EC=3.5.4.13;
          Length = 183

 Score = 37.4 bits (85), Expect = 9e-05
 Identities = 25/79 (31%), Positives = 42/79 (53%), Gaps = 2/79 (2%)

Query: 39  IAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLIN 98
           + PG   +  T   I+LP   V  +  +S +A R G+++    G IDA +RG I + + N
Sbjct: 72  LLPGQFVLAETLECISLPDNIVATIEGKSSIA-RLGVTLHQTGGWIDAGFRGSITLEMAN 130

Query: 99  LDPEKPIMITRGDRIAQLV 117
           ++  +P+ +  G  I QLV
Sbjct: 131 VN-ARPVRVYAGMPIGQLV 148


>GAG_IPMA RecName: Full=Retrovirus-related Gag polyprotein;Contains:
            RecName: Full=Protease;           EC=3.4.23.-;
          Length = 827

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 33/107 (30%), Positives = 50/107 (46%), Gaps = 21/107 (19%)

Query: 19  PKRAHRGDAGVDLHATTDAVIAPGHR-EIVGTGIAIALPLGTVGLVHPR------SGLAA 71
           P++ H+    VDL A +D ++ P    + V      +LPLGT+GL+  R       GL  
Sbjct: 551 PRKTHK----VDLRAASDFLLMPQMSIQPVPVEPIPSLPLGTMGLILGRGSASTLQGLVV 606

Query: 72  REGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITRGDRIAQLVI 118
              L IVN P           K  ++   P+    I++GDRI QL++
Sbjct: 607 HPELWIVNIPQ----------KYQVLCSSPKGVFSISKGDRIPQLLL 643


>VPRT_SMRVH RecName: Full=Protease;         EC=3.4.23.-;
          Length = 323

 Score = 35.4 bits (80), Expect = 3e-04
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 5/69 (7%)

Query: 50  GIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLINLDPEKPIMITR 109
           GI   LP  T GL+     L ++ G+ ++  PG +D D+ GEI + L     +  + I +
Sbjct: 78  GIYGPLPPQTFGLILAEPALPSK-GIQVL--PGILDNDFEGEIHIILST--TKDLVTIPK 132

Query: 110 GDRIAQLVI 118
           G R+AQ+VI
Sbjct: 133 GTRLAQIVI 141


>DCD_AERPE RecName: Full=Probable deoxycytidine triphosphate
           deaminase;         Short=dCTP deaminase;       
           EC=3.5.4.13;
          Length = 178

 Score = 34.3 bits (77), Expect = 7e-04
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 7/86 (8%)

Query: 36  DAVIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGT-IDADYRGEIKV 94
           + ++ PG   ++ T   I LP    GLV+ RS   AR G+ I   P T +DA + G++ +
Sbjct: 69  EIIVGPGEHMLLHTQEYIRLPGYVAGLVNLRS-TWARTGIYI---PATVVDAGFEGQLTI 124

Query: 95  CLINLDPEKPIMITRGDRIAQLVIQK 120
            ++      P+ +  GDR   LV+ K
Sbjct: 125 EVVG--SGFPVKLYPGDRFLHLVLVK 148


>DCD_METTH RecName: Full=Probable deoxycytidine triphosphate
           deaminase;         Short=dCTP deaminase;       
           EC=3.5.4.13;
          Length = 197

 Score = 33.9 bits (76), Expect = 0.001
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 38  VIAPGHREIVGTGIAIALPLGTVGLVHPRSGLAAREGLSIVNAPGTIDADYRGEIKVCLI 97
           +I PG   +  T   IALP   V  V  RS +  R G+++    G ID  + G I + + 
Sbjct: 77  IIHPGEFALATTHEYIALPEDLVARVEGRSSI-GRLGITMHVTAGYIDPGFHGRITLEIS 135

Query: 98  NLDPEKPIMITRGDRIAQLVIQ 119
           N+  + P+ +    R+ Q+V +
Sbjct: 136 NIG-KMPVALYPRQRVCQIVFE 156


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.319    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,277,070,326
Number of extensions: 368634819
Number of successful extensions: 996681
Number of sequences better than 1.0e-03: 24630
Number of HSP's gapped: 955226
Number of HSP's successfully gapped: 32005
Length of query: 112
Length of database: 100,000
Length adjustment: 0
Effective length of query: 112
Effective length of database: 100,000
Effective search space: 11200000
Effective search space used: 11200000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)