BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAF55467.1 cglu2 BAF55467.1 GIB00498CH01 "hypothetical protein"
         (282 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

IOLE_BACC3 RecName: Full=Inosose dehydratase;         EC=4.2.1.4...    36   4e-04
IOLE_BACAH RecName: Full=Inosose dehydratase;         EC=4.2.1.4...    36   4e-04

>IOLE_BACC3 RecName: Full=Inosose dehydratase;       
           EC=4.2.1.44;AltName: Full=2-keto-myo-inositol
           dehydratase;         Short=2KMI dehydratase;
          Length = 298

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 63/285 (22%), Positives = 119/285 (41%), Gaps = 31/285 (10%)

Query: 13  DQVAELGMYPVLEK-LKELNIASVEVSQIPMN-EENTAALERGISELGIEVGALSVAFGP 70
           D + ELG     E+ + E+ +A    S++      NT  L++ +    +E+ +   +   
Sbjct: 19  DDMPELGAENTFEQCISEMALAGFNGSEVGNKYPRNTVVLKKSLELRNLEIASAWFSTFL 78

Query: 71  SAAPGVDSLENDFDKIVADCKRLGVKYTRI--------GMMPFQAMTSKEA--TETWAAQ 120
           +  P  +++E +F K       +G K   +        G+M      +K     E W   
Sbjct: 79  TTKPLEETVE-EFIKHRDFLHDMGAKVIVVSEQGHSIQGLMDVPLFKNKPVFTEEEWNKL 137

Query: 121 VEP--YAARLAVE-GITLCYHNHH-VDLHKFGN-ERIFDIVRRVAPSLFFEVDLHWVQRG 175
            +   +  +LA E G+ + YH+H    +      E++ DI      SL F+   H V   
Sbjct: 138 ADGLHHLGKLAQEKGLHIVYHHHMGTGVQTTAEIEKLMDITDSALVSLLFDTG-HLVF-S 195

Query: 176 GMAPLDMLKEYAGVCKLIHVKDFRVTELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQG 235
           G  PL +LK+Y    K +H+KD R     +E +++    +    + + V    F   G G
Sbjct: 196 GEEPLYILKKYLPRIKHVHLKDIR-----QEVVDIVKENEL--SFLQAVKNGAFTVPGDG 248

Query: 236 NMNWPELLPASKAAGAEYFFI---EQDMTYGRDPFDCIKDSREYL 277
            + + E+      +  + +F+   EQD     +PF+    +RE++
Sbjct: 249 VIEFDEVFTILANSDYQGWFVVEAEQDPALA-NPFEYALKAREFI 292


>IOLE_BACAH RecName: Full=Inosose dehydratase;       
           EC=4.2.1.44;AltName: Full=2-keto-myo-inositol
           dehydratase;         Short=2KMI dehydratase;
          Length = 298

 Score = 36.2 bits (82), Expect = 4e-04
 Identities = 63/285 (22%), Positives = 119/285 (41%), Gaps = 31/285 (10%)

Query: 13  DQVAELGMYPVLEK-LKELNIASVEVSQIPMN-EENTAALERGISELGIEVGALSVAFGP 70
           D + ELG     E+ + E+ +A    S++      NT  L++ +    +E+ +   +   
Sbjct: 19  DDMPELGAENTFEQCISEMALAGFNGSEVGNKYPRNTVVLKKSLELRNLEIASAWFSTFL 78

Query: 71  SAAPGVDSLENDFDKIVADCKRLGVKYTRI--------GMMPFQAMTSKEA--TETWAAQ 120
           +  P  +++E +F K       +G K   +        G+M      +K     E W   
Sbjct: 79  TTKPLEETVE-EFIKHRDFLHDMGAKVIVVSEQGHSIQGLMDVPLFKNKPVFTEEEWNKL 137

Query: 121 VEP--YAARLAVE-GITLCYHNHH-VDLHKFGN-ERIFDIVRRVAPSLFFEVDLHWVQRG 175
            +   +  +LA E G+ + YH+H    +      E++ DI      SL F+   H V   
Sbjct: 138 ADGLHHLGKLAQEKGLHIVYHHHMGTGVQTTAEIEKLMDITDSALVSLLFDTG-HLVF-S 195

Query: 176 GMAPLDMLKEYAGVCKLIHVKDFRVTELPEEAMELFTAGDFMKGYEKFVNIVEFAEVGQG 235
           G  PL +LK+Y    K +H+KD R     +E +++    +    + + V    F   G G
Sbjct: 196 GEEPLYILKKYLPRIKHVHLKDIR-----QEVVDIVKENEL--SFLQAVKNGAFTVPGDG 248

Query: 236 NMNWPELLPASKAAGAEYFFI---EQDMTYGRDPFDCIKDSREYL 277
            + + E+      +  + +F+   EQD     +PF+    +RE++
Sbjct: 249 VIEFDEVFTILANSDYQGWFVVEAEQDPALA-NPFEYALKAREFI 292


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.323    0.139    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 9,690,134,649
Number of extensions: 392427566
Number of successful extensions: 962160
Number of sequences better than 1.0e-03: 18074
Number of HSP's gapped: 940184
Number of HSP's successfully gapped: 21406
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)