BLASTP 2.2.16 [Mar-25-2007]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BAF55698.1 cglu2 BAF55698.1 GIB00498CH01 "hypothetical protein"
         (266 letters)

Database: sws57.9x 
           510,076 sequences; 179,409,320 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Y480_MYCTU RecName: Full=UPF0012 hydrolase Rv0480c/MT0498;      ...   183   1e-48
NIT2_RAT RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;       139   4e-35
NIT2_DANRE RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;     138   6e-35
NIT2_MOUSE RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;     135   3e-34
YAUB_SCHPO RecName: Full=UPF0012 hydrolase C26A3.11;         EC=...   134   7e-34
NIT2_BOVIN RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;     131   6e-33
NIT2_HUMAN RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;     130   1e-32
NIT2_PONAB RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;     126   2e-31
NIT2B_XENLA RecName: Full=Nitrilase homolog 2-B;         EC=3.5....   126   2e-31
NIT2_XENTR RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;     124   7e-31
NIT2A_XENLA RecName: Full=Nitrilase homolog 2-A;         EC=3.5....   123   2e-30
NIT2_DICDI RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;     110   1e-26
NIT1_DICDI RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;     109   3e-26
YBEM_ECOLI RecName: Full=Putative UPF0012 hydrolase ybeM;       ...   107   2e-25
YBEM_ECO57 RecName: Full=UPF0012 hydrolase ybeM;         EC=3.5....   107   2e-25
Y601_SYNY3 RecName: Full=UPF0012 hydrolase sll0601;         EC=3...   102   4e-24
NIT1_MOUSE RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;      99   4e-23
NIT3_YEAST RecName: Full=Probable hydrolase NIT3;         EC=3.5...    98   7e-23
NIT1_BOVIN RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;      98   9e-23
NIT1_HUMAN RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;      96   4e-22
NIT1_RAT RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;        94   2e-21
NFT1_DROME RecName: Full=Nitrilase and fragile histidine triad f...    89   4e-20
NIT2_YEAST RecName: Full=Probable hydrolase NIT2;         EC=3.5...    89   6e-20
NFT1_CAEEL RecName: Full=Nitrilase and fragile histidine triad f...    89   6e-20
NIT2_SCHPO RecName: Full=Probable hydrolase nit2;         EC=3.5...    85   8e-19
AGUB_SOLTU RecName: Full=N-carbamoylputrescine amidase;         ...    85   8e-19
AGUB_SOLLC RecName: Full=N-carbamoylputrescine amidase;         ...    84   2e-18
YCU9_SCHPO RecName: Full=Probable nitrilase C965.09;         EC=...    81   1e-17
MTNU_BACSU RecName: Full=UPF0012 hydrolase mtnU;         EC=3.5....    79   3e-17
YAG5_STAAU RecName: Full=UPF0012 hydrolase in agr operon;       ...    78   8e-17
AGUB_ARATH RecName: Full=N-carbamoylputrescine amidase;         ...    76   4e-16
YAG5_STALU RecName: Full=UPF0012 hydrolase in agr operon;AltName...    72   7e-15
DCAS_AGRSK RecName: Full=N-carbamoyl-D-amino acid hydrolase;    ...    68   8e-14
DCAS_RHIRD RecName: Full=N-carbamoyl-D-amino acid hydrolase;    ...    67   2e-13
AGUB_ORYSJ RecName: Full=N-carbamoylputrescine amidase;         ...    62   4e-12
YAFV_ECOLI RecName: Full=UPF0012 hydrolase yafV;         EC=3.5....    57   2e-10
YPQQ_PSEFL RecName: Full=UPF0012 hydrolase in pqqF 5'region;    ...    54   2e-09
NADE_XYLFT RecName: Full=Probable glutamine-dependent NAD(+) syn...    52   5e-09
NADE_XYLFA RecName: Full=Probable glutamine-dependent NAD(+) syn...    52   5e-09
NRL3_ARATH RecName: Full=Nitrilase 3;         EC=3.5.5.1;              47   3e-07
YHCX_BACSU RecName: Full=UPF0012 hydrolase yhcX;         EC=3.5....    46   3e-07
VNN1_MOUSE RecName: Full=Pantetheinase;         EC=3.5.1.92;AltN...    45   6e-07
NADE2_THEMA RecName: Full=Probable glutamine-dependent NAD(+) sy...    45   6e-07
VNN2_HUMAN RecName: Full=Vascular non-inflammatory molecule 2;  ...    43   3e-06
VNN1_BOVIN RecName: Full=Pantetheinase;         EC=3.5.1.92;AltN...    39   5e-05
VNN1_CANFA RecName: Full=Pantetheinase;         EC=3.5.1.92;AltN...    37   2e-04
AMIE_BURCH RecName: Full=Aliphatic amidase;         EC=3.5.1.4;A...    37   2e-04
AMIE_BURCC RecName: Full=Aliphatic amidase;         EC=3.5.1.4;A...    37   2e-04
AMIE_BURCA RecName: Full=Aliphatic amidase;         EC=3.5.1.4;A...    37   2e-04
BTD_TAKRU RecName: Full=Biotinidase;         Short=Biotinase;   ...    37   3e-04
AROB_SHESA RecName: Full=3-dehydroquinate synthase;         EC=4...    35   6e-04
AMIE_NOCFA RecName: Full=Aliphatic amidase;         EC=3.5.1.4;A...    35   6e-04
AROB_SHESW RecName: Full=3-dehydroquinate synthase;         EC=4...    35   0.001
AMIE_VARPS RecName: Full=Aliphatic amidase;         EC=3.5.1.4;A...    35   0.001

>Y480_MYCTU RecName: Full=UPF0012 hydrolase Rv0480c/MT0498;       
           EC=3.5.-.-;
          Length = 340

 Score =  183 bits (465), Expect = 1e-48
 Identities = 111/258 (43%), Positives = 145/258 (56%), Gaps = 24/258 (9%)

Query: 1   MRIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDG 60
           MRIAL QI + +D   N  L+   A +AA  GA+++VFPEAT    G   L   AE +DG
Sbjct: 61  MRIALAQIRSGTDPAANLQLVGKYAGEAATAGAQLVVFPEATMCRLGVP-LRQVAEPVDG 119

Query: 61  EFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG----YNKI 116
            ++  V+ +A E G+ ++AGMFTP            RV NT++ +G G        Y+KI
Sbjct: 120 PWANGVRRIATEAGITVIAGMFTPTGD--------GRVTNTLIAAGPGTPNQPDAHYHKI 171

Query: 117 HTYDAFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTS 176
           H YDAFG+ ES                       CYDIRFP  + +LAR  AQ+I V  S
Sbjct: 172 HLYDAFGFTESRXXXXXXXXXXXXXXXXXXXXXXCYDIRFPALYTELARRGAQLIAVCAS 231

Query: 177 WQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNG-------PTGIGHSMV 229
           W  GPGKLEQW LL RARALDS S++ A GQA    +  D R G       PTG+G S+V
Sbjct: 232 WGSGPGKLEQWTLLARARALDSMSYVAAAGQA----DPGDARTGVGASSAAPTGVGGSLV 287

Query: 230 ANPHGQVIVSAGYEPEML 247
           A+P G+V+VSAG +P++L
Sbjct: 288 ASPLGEVVVSAGTQPQLL 305


>NIT2_RAT RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
          Length = 276

 Score =  139 bits (349), Expect = 4e-35
 Identities = 85/272 (31%), Positives = 136/272 (50%), Gaps = 22/272 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           R+AL+Q+  +S K DN         +AA+QGA ++  PE  +  +GT      AE++ GE
Sbjct: 5   RLALIQLQVSSIKSDNITRACSLVREAAKQGANIVSLPECFNSPYGTNYFPEYAEKIPGE 64

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
            +  + E+A E  + ++ G     D          ++ NT  + G    L   + KIH +
Sbjct: 65  STKKLSEVAKENSIYLIGGSIPEEDD--------GKLYNTCAVFGPDGNLLVKHRKIHLF 116

Query: 120 D-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES T+ PGD    F+    + G+  CYD+RF E  +  AR   Q+++ P
Sbjct: 117 DIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYARRGCQLLVYP 176

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL RARA+D+  ++     A      RD++      GHS V +P G
Sbjct: 177 GAFNMTTGP-AHWELLQRARAVDNQVYVATASPA------RDEKASYVAWGHSTVVDPWG 229

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPVL 266
           QV+  AG E  +L  DID+  LS+IR+ +P+L
Sbjct: 230 QVLTKAGTEETILYSDIDLKKLSEIRQQIPIL 261


>NIT2_DANRE RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
          Length = 277

 Score =  138 bits (347), Expect = 6e-35
 Identities = 86/271 (31%), Positives = 137/271 (50%), Gaps = 22/271 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           R+A++Q+  +  K DN    +   ++AA QGA+V+V PE  +  +GTG     AE++ GE
Sbjct: 5   RLAVVQLHVSKIKADNLGRAQTLVKEAAGQGAKVVVLPECFNSPYGTGFFKEYAEKIPGE 64

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
            +  + E A + G+ +V G     D          ++ NT  + G    L   + KIH +
Sbjct: 65  STQVLSETAKKCGIYLVGGSIPEEDG--------GKLYNTCSVFGPDGTLLVTHRKIHLF 116

Query: 120 D-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES+T+ PG  L +FE    K GV  CYDIRF E  +  A+   Q+++ P
Sbjct: 117 DIDVPGKIRFQESETLSPGKSLSMFETPYCKVGVGICYDIRFAELAQIYAKKGCQLLVYP 176

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL R RA+D+  ++     A      RD+       GHS V NP G
Sbjct: 177 GAFNMTTGP-AHWELLQRGRAVDNQVYVATASPA------RDETASYVAWGHSSVINPWG 229

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
           +VI  AG E  ++  DID+  L+ +R+ +P+
Sbjct: 230 EVISKAGSEESVVYADIDLQYLADVRQQIPI 260


>NIT2_MOUSE RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
          Length = 276

 Score =  135 bits (341), Expect = 3e-34
 Identities = 84/272 (30%), Positives = 136/272 (50%), Gaps = 22/272 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           R+AL+Q+  +S K DN         +AA+QGA ++  PE  +  +GT      AE++ GE
Sbjct: 5   RLALIQLQVSSIKSDNLTRACSLVREAAKQGANIVSLPECFNSPYGTTYFPDYAEKIPGE 64

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
            +  + E+A E  + ++ G           E+   ++ NT  + G    L   + KIH +
Sbjct: 65  STQKLSEVAKESSIYLIGGSIP--------EEDAGKLYNTCSVFGPDGSLLVKHRKIHLF 116

Query: 120 D-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES T+ PGD    F+    K G+  CYD+RF E  +  A+   Q+++ P
Sbjct: 117 DIDVPGKITFQESKTLSPGDSFSTFDTPYCKVGLGICYDMRFAELAQIYAQRGCQLLVYP 176

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL RARA+D+  ++     A      RD +      GHS V +P G
Sbjct: 177 GAFNLTTGP-AHWELLQRARAVDNQVYVATASPA------RDDKASYVAWGHSTVVDPWG 229

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPVL 266
           QV+  AG E  +L  DID+  L++IR+ +P+L
Sbjct: 230 QVLTKAGTEETILYSDIDLKKLAEIRQQIPIL 261


>YAUB_SCHPO RecName: Full=UPF0012 hydrolase C26A3.11;       
           EC=3.5.-.-;
          Length = 322

 Score =  134 bits (338), Expect = 7e-34
 Identities = 85/273 (31%), Positives = 137/273 (50%), Gaps = 24/273 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           RI L+Q++   DK +N  L R    +AA+ G+ V+V PE  +  +GTG  +  AE ++  
Sbjct: 45  RIGLVQLANTKDKSENLQLARLKVLEAAKNGSNVIVLPEIFNSPYGTGYFNQYAEPIEES 104

Query: 62  FST--AVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLI--SGAGLHQGYNKIH 117
             +  A+  +A +    +  G           E+   ++ NT ++      L   + KIH
Sbjct: 105 SPSYQALSSMAKDTKTYLFGGSIP--------ERKDGKLYNTAMVFDPSGKLIAVHRKIH 156

Query: 118 TYD-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVIL 172
            +D        +RESD++ PGD + + + +  KFG+  CYDIRFPE     ARN   V++
Sbjct: 157 LFDIDIPGGVSFRESDSLSPGDAMTMVDTEYGKFGLGICYDIRFPELAMIAARNGCSVMI 216

Query: 173 VPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANP 232
            P ++    G L  W+LL RARA+D+  ++  C  A      RD        GHS V +P
Sbjct: 217 YPGAFNLSTGPL-HWELLARARAVDNEMFVACCAPA------RDMNADYHSWGHSTVVDP 269

Query: 233 HGQVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
            G+VI +   +P ++  DID S +S  R ++P+
Sbjct: 270 FGKVIATTDEKPSIVYADIDPSVMSTARNSVPI 302


>NIT2_BOVIN RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
          Length = 276

 Score =  131 bits (330), Expect = 6e-33
 Identities = 78/271 (28%), Positives = 138/271 (50%), Gaps = 22/271 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           R+AL+Q+  +S K +N         +A++QGA+++  PE  +  +GT      AE++ G+
Sbjct: 5   RLALIQLQVSSIKSENLTRACGLIREASKQGAQIVSLPECFNSPYGTKYFPDYAEKIPGD 64

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
            +  + E+A E  + ++ G           EK   ++ NT  + G    L   + K+H +
Sbjct: 65  STQKLSEVAKECSMYVIGGSIP--------EKDAGKLYNTCAVFGPDGTLLVKHRKLHLF 116

Query: 120 D-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES+T+ PGD   +F+    + G+  CYDIRF E  +  A+   Q+++ P
Sbjct: 117 DIDVPGKITFQESETLSPGDSFSLFDTPYCRVGLGICYDIRFAELAQIYAQRGCQLLVYP 176

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL R RA+D+  ++     A      RD++      GHS V NP G
Sbjct: 177 GAFNLTTGP-AHWELLQRGRAVDNQVYVATASPA------RDEKASYVAWGHSTVVNPWG 229

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
           +V+  AG E  ++  DID+  L++IR+ +P+
Sbjct: 230 EVLAKAGTEETIVYADIDLKKLAEIRQQIPI 260


>NIT2_HUMAN RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
          Length = 276

 Score =  130 bits (328), Expect = 1e-32
 Identities = 81/271 (29%), Positives = 134/271 (49%), Gaps = 22/271 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           R+AL+Q+  +S K DN         +AA QGA+++  PE  +  +G       AE++ GE
Sbjct: 5   RLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEKIPGE 64

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
            +  + E+A E  + ++ G           E+   ++ NT  + G    L   Y KIH +
Sbjct: 65  STQKLSEVAKECSIYLIGGSIP--------EEDAGKLYNTCAVFGPDGTLLAKYRKIHLF 116

Query: 120 D-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES T+ PGD    F+    + G+  CYD+RF E  +  A+   Q+++ P
Sbjct: 117 DIDVPGKITFQESKTLSPGDSFSTFDTPYCRVGLGICYDMRFAELAQIYAQRGCQLLVYP 176

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL R+RA+D+  ++     A      RD +      GHS V NP G
Sbjct: 177 GAFNLTTGP-AHWELLQRSRAVDNQVYVATASPA------RDDKASYVAWGHSTVVNPWG 229

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
           +V+  AG E  ++  DID+  L++IR+ +PV
Sbjct: 230 EVLAKAGTEEAIVYSDIDLKKLAEIRQQIPV 260


>NIT2_PONAB RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
          Length = 275

 Score =  126 bits (317), Expect = 2e-31
 Identities = 81/271 (29%), Positives = 133/271 (49%), Gaps = 23/271 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           R+AL+Q+  +S   DN         +AA QGA+++  PE  +  +GT      AE++ GE
Sbjct: 5   RLALIQLQISSINSDNVTRACSFIREAATQGAKIVSLPECFNSPYGTKYFPEYAEKIPGE 64

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
            +  + E+A E  + ++ G           E+   ++ NT  + G    L   Y KIH +
Sbjct: 65  STQKLSEVAKECSIYLIGGSIP--------EEDAGKLYNTCAVFGPDGTLLAKYRKIHLF 116

Query: 120 D-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES T+ PGD    F+    + G+  CYD+RF E  +  A+   Q+++ P
Sbjct: 117 DIDVPGKITFQESKTLSPGDSFCTFDT-YCRVGLGICYDMRFAELAQIYAQRGCQLLVYP 175

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL R RA+D+  ++     A      RD +      GHS V NP G
Sbjct: 176 GAFNLTTGP-AHWELLQRGRAVDNQVYVATASPA------RDDKASYVAWGHSTVVNPWG 228

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
           +V+  AG E  ++  DID+  L++IR+ +PV
Sbjct: 229 EVLAKAGTEEAIVYSDIDLKKLAEIRQQIPV 259


>NIT2B_XENLA RecName: Full=Nitrilase homolog 2-B;       
           EC=3.5.-.-;
          Length = 276

 Score =  126 bits (316), Expect = 2e-31
 Identities = 79/263 (30%), Positives = 131/263 (49%), Gaps = 22/263 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           R++L+Q   +  K DN        ++AA++GA+++  PE  +  +GT      AE++ GE
Sbjct: 5   RLSLVQFLVSPVKSDNLNKACKLIKEAAQKGAQIVALPECFNSPYGTKYFPEYAEKIPGE 64

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
            +  + ++A E G+ ++ G     D+         +  NT  + G    L   + KIH +
Sbjct: 65  STELLSQVAKECGIYLIGGSIPEEDS--------GKFYNTCAVFGPDGTLLVKHRKIHLF 116

Query: 120 D-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES+T+ PGD   VF+    K GV  CYD+RF E  +  A    Q+++ P
Sbjct: 117 DIDVPGKIRFQESETLSPGDSFSVFDTPYCKVGVGICYDMRFAELAQIYANKGCQLLVYP 176

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL RARALD+  ++     A      RD++      GHS V +P G
Sbjct: 177 GAFNMTTGP-AHWELLQRARALDNQVYVATASPA------RDEKASYVAWGHSTVVSPWG 229

Query: 235 QVIVSAGYEPEMLIVDIDVSDLS 257
           +VI  AG+E  ++  DID+  L+
Sbjct: 230 EVIAKAGFEETVISADIDLQYLA 252


>NIT2_XENTR RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
          Length = 276

 Score =  124 bits (312), Expect = 7e-31
 Identities = 78/263 (29%), Positives = 132/263 (50%), Gaps = 22/263 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           R++L+Q   +  K +N        ++AA++GA+++  PE  +  +GT      AE++ GE
Sbjct: 5   RLSLVQFLVSPVKSENLNRACKLIKEAAQKGAQIVALPECFNSPYGTKYFPEYAEKIPGE 64

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
            +  + ++A E G+ ++ G     D+         ++ NT  + G    L   + KIH +
Sbjct: 65  STERLSQVAKECGIYLIGGSIPEEDS--------GKLYNTCAVFGPDGTLLVKHRKIHLF 116

Query: 120 D-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES+T+ PGD   VFE    K GV  CYDIRF E  +  ++   Q+++ P
Sbjct: 117 DIDVPGKIRFQESETLSPGDSFSVFETPYCKVGVGICYDIRFAELAQLYSKKGCQLLVYP 176

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL RARALD+  ++     A      RD++      GHS + +P G
Sbjct: 177 GAFNMTTGP-AHWELLQRARALDNQVYVATASPA------RDEKASYVAWGHSTIVSPWG 229

Query: 235 QVIVSAGYEPEMLIVDIDVSDLS 257
           +VI  AG E  ++  DID+  L+
Sbjct: 230 EVIAKAGSEETVISADIDLEYLA 252


>NIT2A_XENLA RecName: Full=Nitrilase homolog 2-A;       
           EC=3.5.-.-;
          Length = 276

 Score =  123 bits (308), Expect = 2e-30
 Identities = 77/263 (29%), Positives = 131/263 (49%), Gaps = 22/263 (8%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           +++L+Q   +  K DN        ++AA++GA+++  PE  +  +GT      AE++ GE
Sbjct: 5   KLSLVQFLVSPVKSDNLNRACKLIKEAAQKGAQIVALPECFNSPYGTTYFPEYAEKIPGE 64

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
            +  + ++A E G+ ++ G           E+   ++ NT  + G    L   + KIH +
Sbjct: 65  STELLSQVAKECGIYLIGGSIP--------EEDCGKLYNTCAVFGPDGTLLVKHRKIHLF 116

Query: 120 D-----AFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES+T+ PGD   VF+    K GV  CYDIRF E  +  A    Q+++ P
Sbjct: 117 DIDVPGKIRFQESETLSPGDSFSVFDTPYCKVGVGICYDIRFAELAQIYANKGCQLLVYP 176

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL RARALD+  ++     A      RD++      GHS + +P G
Sbjct: 177 GAFNMTTGP-AHWELLQRARALDNQVYVATASPA------RDEKASYVAWGHSTIVSPWG 229

Query: 235 QVIVSAGYEPEMLIVDIDVSDLS 257
           +V+  AG E  +L  +ID+  L+
Sbjct: 230 EVVAKAGSEETVLSAEIDLQYLA 252


>NIT2_DICDI RecName: Full=Nitrilase homolog 2;         EC=3.5.-.-;
          Length = 328

 Score =  110 bits (275), Expect = 1e-26
 Identities = 72/271 (26%), Positives = 127/271 (46%), Gaps = 20/271 (7%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGE 61
           + A +Q+    +K +N        ++AA+ GA+++  PE  +  + T   +  +E  DGE
Sbjct: 54  KFAGIQLLCGDNKEENVQNAIKHIDEAAKNGAKLISLPECFNSPYSTSTFEKYSETEDGE 113

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISG--AGLHQGYNKIHTY 119
               + E A    + +V G     D      K   ++ NT  I      + + + KIH +
Sbjct: 114 TVKKLSEAAKRNQIFLVGGSIPEID------KATGKIYNTCFIFNDKGEVVKKHRKIHLF 167

Query: 120 DA-----FGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           D        ++ES+T+ PGD   V ++   K GVA CYDIRFPE     ++  A+ ++ P
Sbjct: 168 DIDVPNKIRFKESETLTPGDSFSVVDIGYCKIGVAICYDIRFPELAMLYSKMGAKFLIYP 227

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
            ++    G    W+LL R RA+D+  ++ A   AR P             GHS + N  G
Sbjct: 228 GAFNMVTGP-AHWELLQRGRAVDNQVFVAAISPARNPSSTYQ------AWGHSTIVNSWG 280

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
            ++ +      ++  DID++ L++ R ++P+
Sbjct: 281 TILATTDEHQSIIYSDIDLNTLNETRSSIPI 311


>NIT1_DICDI RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
          Length = 291

 Score =  109 bits (272), Expect = 3e-26
 Identities = 89/282 (31%), Positives = 142/282 (50%), Gaps = 33/282 (11%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQ-SFGTGRLDTQ--AEEL 58
           RI L QI++ ++K DNF   ++  EKA E    +   PE  +  S G  + +++  AE L
Sbjct: 14  RIGLGQITSTNNKEDNFRKCKEMIEKAVENKVNLFCLPECFAFISGGIHQFESRDNAEYL 73

Query: 59  D--GEFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVN----NTVLI--SGAGLH 110
           D  G      K+LA +  + +  G F         EK +   N    NT LI  S   + 
Sbjct: 74  DQKGGIIERYKDLAKQNNIWLSLGGFH--------EKILDDPNDMIYNTHLIIDSNGVIV 125

Query: 111 QGYNKIHTYDA------FGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLA 164
             Y K+H +D           ES  VK G++LVV +    K G++ CYD+RFPE +  L 
Sbjct: 126 CEYRKMHLFDVDIPSKGVKMNESKVVKGGNDLVVCDSPVGKLGLSICYDLRFPELYLSLR 185

Query: 165 RNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI 224
           R DAQ++LVP+++    G+   W+ L +ARA+++ ++++A  Q        D  +  +  
Sbjct: 186 RMDAQILLVPSAFMKSTGE-AHWKPLLQARAIENQTYVIAAAQT------GDHHSKRSSY 238

Query: 225 GHSMVANPHGQVIVSAGYE-PEMLIVDIDVSDLSKIREALPV 265
           GHSM+ +P G+V+        ++  VDID+  +S  RE +PV
Sbjct: 239 GHSMIIDPWGKVLHDLPDNLNDIAFVDIDLDYISTCRENIPV 280


>YBEM_ECOLI RecName: Full=Putative UPF0012 hydrolase ybeM;       
           EC=3.5.-.-;
          Length = 262

 Score =  107 bits (266), Expect = 2e-25
 Identities = 57/169 (33%), Positives = 89/169 (52%), Gaps = 12/169 (7%)

Query: 99  NNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELV-VFEVDDIKFGVATCYDIRFP 157
           N  V +    +   Y K+H YDAF  +ES  V  G+E+  + EV+ +K G+ TCYD+RFP
Sbjct: 94  NMLVALQAGNIVARYAKLHLYDAFAIQESRRVDAGNEIAPLLEVEGMKVGLMTCYDLRFP 153

Query: 158 EQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDK 217
           E         A+++++P +W  GP K   W  L  ARALD+T ++VA G+          
Sbjct: 154 EXXXXXXXXGAEILVLPAAWVRGPLKEHHWSTLLAARALDTTCYMVAAGEC--------- 204

Query: 218 RNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPVL 266
             G   IG S + +P G  I +A   P +++ ++    + ++R  LPVL
Sbjct: 205 --GNKNIGQSRIIDPFGVTIAAASEMPALIMAEVTPERVRQVRAQLPVL 251


>YBEM_ECO57 RecName: Full=UPF0012 hydrolase ybeM;       
           EC=3.5.-.-;
          Length = 262

 Score =  107 bits (266), Expect = 2e-25
 Identities = 57/169 (33%), Positives = 89/169 (52%), Gaps = 12/169 (7%)

Query: 99  NNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELV-VFEVDDIKFGVATCYDIRFP 157
           N  V +    +   Y K+H YDAF  +ES  V  G+E+  + EV+ +K G+ TCYD+RFP
Sbjct: 94  NMLVALQAGNIVARYAKLHLYDAFAIQESRRVDAGNEIAPLLEVEGMKVGLMTCYDLRFP 153

Query: 158 EQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDK 217
           E         A+++++P +W  GP K   W  L  ARALD+T ++VA G+          
Sbjct: 154 EXXXXXXXXGAEILVLPAAWVRGPLKEHHWSTLLAARALDTTCYMVAAGEC--------- 204

Query: 218 RNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPVL 266
             G   IG S + +P G  I +A   P +++ ++    + ++R  LPVL
Sbjct: 205 --GNKNIGQSRIIDPFGVTIAAASEMPALIMAEVTPERVRQVRAQLPVL 251


>Y601_SYNY3 RecName: Full=UPF0012 hydrolase sll0601;       
           EC=3.5.-.-;
          Length = 272

 Score =  102 bits (254), Expect = 4e-24
 Identities = 79/275 (28%), Positives = 135/275 (49%), Gaps = 27/275 (9%)

Query: 4   ALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFS 63
           A LQ+++  +  +N     +  + A  QGA ++  PE    +F     +T+  E     +
Sbjct: 7   AALQMTSRPNLTENLQEAEELIDLAVRQGAELVGLPE----NFAFLGNETEKLEQATAIA 62

Query: 64  TAVKE----LADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG-YNKIHT 118
           TA ++    +A    V I+AG F      + G+      N   LI+  G     Y+K+H 
Sbjct: 63  TATEKFLQTMAQRFQVTILAGGFPFPVAGEAGKA----YNTATLIAPNGQELARYHKVHL 118

Query: 119 YDAF-----GYRESDTVKPGDELV-VFEVDDI-KFGVATCYDIRFPEQFKDLARNDAQVI 171
           +D        Y ES TV  G +   V+  D     G++ CYD+RFPE ++ L+R  A V+
Sbjct: 119 FDVNVPDGNTYWESATVMAGQKYPPVYHSDSFGNLGLSICYDVRFPELYRYLSRQGADVL 178

Query: 172 LVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVAN 231
            VP ++    GK + WQ+L +ARA+++T +++A  Q     E R         GH+M+ +
Sbjct: 179 FVPAAFTAYTGK-DHWQVLLQARAIENTCYVIAPAQTGCHYERRHTH------GHAMIID 231

Query: 232 PHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPVL 266
           P G ++  AG +P + I +I+   L ++R+ +P L
Sbjct: 232 PWGVILADAGEKPGLAIAEINPDRLKQVRQQMPSL 266


>NIT1_MOUSE RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
          Length = 323

 Score = 99.0 bits (245), Expect = 4e-23
 Identities = 79/271 (29%), Positives = 128/271 (47%), Gaps = 17/271 (6%)

Query: 3   IALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQ-SFGTGRLDTQAEELDGE 61
           +A+ Q+++  +K +NF    +  ++AA  GA +   PEA    +         +E L+G+
Sbjct: 45  VAVCQVTSTPNKQENFKTCAELVQEAARLGACLAFLPEAFDFIARNPAETLLLSEPLNGD 104

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAG-LHQGYNKIHTYD 120
                 +LA E G+ +  G F   +  Q  E+     N  VL++  G +   Y K H  D
Sbjct: 105 LLGQYSQLARECGIWLSLGGFH--ERGQDWEQNQKIYNCHVLLNSKGSVVASYRKTHLCD 162

Query: 121 AF-----GYRESDTVKPGDELVV-FEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
                    RES+  KPG  L    +    K G+A CYD+RFPE    LA+  A+++   
Sbjct: 163 VEIPGQGPMRESNYTKPGGTLEPPVKTPAGKVGLAICYDMRFPELSLKLAQAGAEILTYS 222

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
           +++    G    W++L RARA++S  +++A  Q     E R         GHSMV +P G
Sbjct: 223 SAFGSVTGPAH-WEVLLRARAIESQCYVIAAAQCGRHHETR------ASYGHSMVVDPWG 275

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
            V+      P + +  ID+  L ++R+ LPV
Sbjct: 276 TVVARCSEGPGLCLARIDLHFLQQMRQHLPV 306


>NIT3_YEAST RecName: Full=Probable hydrolase NIT3;       
           EC=3.5.-.-;
          Length = 291

 Score = 98.2 bits (243), Expect = 7e-23
 Identities = 74/278 (26%), Positives = 134/278 (48%), Gaps = 25/278 (8%)

Query: 1   MRIALLQISTNS-DKMDNFALLRDAAEKAAEQ--GARVLVFPEATSQSFGTGRLDTQAEE 57
           +++AL+Q+S +S DKM N        E+A ++    +++V PE  +  + T +    +E 
Sbjct: 11  IKVALVQLSGSSPDKMANLQRAATFIERAMKEQPDTKLVVLPECFNSPYSTDQFRKYSEV 70

Query: 58  LDG-EFSTAVK---ELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAG-LHQG 112
           ++  E ST+V+    LA++  +++V G     D      KT    N +++ +  G L   
Sbjct: 71  INPKEPSTSVQFLSNLANKFKIILVGGTIPELDP-----KTDKIYNTSIIFNEDGKLIDK 125

Query: 113 YNKIHTYDA-----FGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARND 167
           + K+H +D        + ES+T+ PG++    +    KFGV  CYD+RFPE     AR  
Sbjct: 126 HRKVHLFDVDIPNGISFHESETLSPGEKSTTIDTKYGKFGVGICYDMRFPELAMLSARKG 185

Query: 168 AQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHS 227
           A  ++ P+++    G L  W LL R+RA+D+  +++ C  A      R+ ++     GHS
Sbjct: 186 AFAMIYPSAFNTVTGPL-HWHLLARSRAVDNQVYVMLCSPA------RNLQSSYHAYGHS 238

Query: 228 MVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
           +V +P                  +D   +   R+A+P+
Sbjct: 239 IVVDPRXXXXXXXXXXXXXXXXXLDPEVIESFRQAVPL 276


>NIT1_BOVIN RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
          Length = 328

 Score = 97.8 bits (242), Expect = 9e-23
 Identities = 82/274 (29%), Positives = 127/274 (46%), Gaps = 23/274 (8%)

Query: 3   IALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEA----TSQSFGTGRLDTQAEEL 58
           +A+ Q+++  DK  NF    +   +AA  GA +   PEA          T RL   +E L
Sbjct: 50  VAVCQVTSTPDKEQNFKTCAELIREAARLGACLAFLPEAFDFIARDPEETRRL---SEPL 106

Query: 59  DGEFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAG-LHQGYNKIH 117
            G       +LA E G+ +  G F   +  Q  E+T    N  V+++  G +   Y K H
Sbjct: 107 SGNLLEEYTQLARECGLWLSLGGFH--ERGQDWEQTQKIYNCHVIMNNMGSVVATYRKTH 164

Query: 118 TYDAF-----GYRESDTVKPGDELVV-FEVDDIKFGVATCYDIRFPEQFKDLARNDAQVI 171
             D         RES++  PG  L         K G+A CYD+RFPE    L +  A+++
Sbjct: 165 LCDVEIPGQGPMRESNSTIPGPSLESPISTPAGKIGLAICYDMRFPELSLALVQAGAEIL 224

Query: 172 LVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVAN 231
             P+++    G    W++L RARA+++  ++VA  Q     E R         GHSMV +
Sbjct: 225 TYPSAFGSVTGPAH-WEVLLRARAIETQCYVVAAAQCGRHHEKR------ASYGHSMVVD 277

Query: 232 PHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
           P G V+      P + +  ID++ L ++R+ LPV
Sbjct: 278 PWGTVVARCSEGPGLCLARIDLNYLQQLRKQLPV 311


>NIT1_HUMAN RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
          Length = 327

 Score = 95.9 bits (237), Expect = 4e-22
 Identities = 81/272 (29%), Positives = 126/272 (46%), Gaps = 19/272 (6%)

Query: 3   IALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQ--AEELDG 60
           +A+ Q+++  DK  NF    +   +AA  GA +   PEA          +T   +E L G
Sbjct: 49  VAVCQVTSTPDKQQNFKTCAELVREAARLGACLAFLPEAFD-FIARDPAETLHLSEPLGG 107

Query: 61  EFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAG-LHQGYNKIHTY 119
           +      +LA E G+ +  G F   +  Q  E+T    N  VL++  G +   Y K H  
Sbjct: 108 KLLEEYTQLARECGLWLSLGGFH--ERGQDWEQTQKIYNCHVLLNSKGAVVATYRKTHLC 165

Query: 120 DAF-----GYRESDTVKPGDELVV-FEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILV 173
           D          ES++  PG  L         K G+A CYD+RFPE    LA+  A+++  
Sbjct: 166 DVEIPGQGPMCESNSTMPGPSLESPVSTPAGKIGLAVCYDMRFPELSLALAQAGAEILTY 225

Query: 174 PTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPH 233
           P+++    G    W++L RARA+++  ++VA  Q     E R         GHSMV +P 
Sbjct: 226 PSAFGSITGP-AHWEVLLRARAIETQCYVVAAAQCGRHHEKR------ASYGHSMVVDPW 278

Query: 234 GQVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
           G V+      P + +  ID++ L ++R  LPV
Sbjct: 279 GTVVARCSEGPGLCLARIDLNYLRQLRRHLPV 310


>NIT1_RAT RecName: Full=Nitrilase homolog 1;         EC=3.5.-.-;
          Length = 292

 Score = 93.6 bits (231), Expect = 2e-21
 Identities = 77/271 (28%), Positives = 123/271 (45%), Gaps = 17/271 (6%)

Query: 3   IALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQ-SFGTGRLDTQAEELDGE 61
           +A+ Q+++  +K +NF    +  ++A   GA +   PEA    +                
Sbjct: 14  VAVCQVTSTPNKQENFKTCAELVQEATRLGACLAFLPEAFDFIARNPAETXXXXXXXXXX 73

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAG-LHQGYNKIHTYD 120
                 +LA E G+ +  G F   +  Q  E+T    N  VL++  G +   Y K H  D
Sbjct: 74  XXXQYSQLARECGIWLSLGGFH--ERGQDWEQTQKIYNCHVLLNSKGSVVASYRKTHLCD 131

Query: 121 AF-----GYRESDTVKPGDELVV-FEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
                    RES+   PG  L    +    K G+A CYD+RFPE    LA+  A+++  P
Sbjct: 132 VEIPGQGPMRESNYTMPGYALEPPVKTPAGKVGLAICYDMRFPELSLKLAQAGAEILTYP 191

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
           +++    G    W++L RARA++S  +++A  Q     E R         GHSMV +P G
Sbjct: 192 SAFGSVTGPAH-WEVLLRARAIESQCYVIAAAQCGRHHETR------ASYGHSMVVDPWG 244

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
            V+ S    P + +  ID+  L ++R+ LPV
Sbjct: 245 TVVASCSEGPGLCLARIDLHFLQQMRQHLPV 275


>NFT1_DROME RecName: Full=Nitrilase and fragile histidine triad
           fusion protein NitFhit;AltName: Full=NFT-1
           protein;Includes:  RecName:
           Full=Bis(5'-adenosyl)-triphosphatase;
          Length = 460

 Score = 89.0 bits (219), Expect = 4e-20
 Identities = 82/273 (30%), Positives = 129/273 (47%), Gaps = 28/273 (10%)

Query: 3   IALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDT--QAEELDG 60
           IA+ Q+ + SDK  N + + +  ++A  Q A +L  PE      G  R  T   +E LDG
Sbjct: 35  IAVGQMRSTSDKAANLSQVIELVDRAKSQNACMLFLPECCD-FVGESRTQTIELSEGLDG 93

Query: 61  EFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAG-LHQGYNKIHTY 119
           E     +ELA    + I  G        +R ++ I   N  VL++  G L   Y K+H +
Sbjct: 94  ELMAQYRELAKCNKIWISLG-----GVHERNDQKI--FNAHVLLNEKGELAAVYRKLHMF 146

Query: 120 DA----FGYRESDTVKPG---DELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVIL 172
           D        RESDTV PG   +  V   V  I  G+  CYD+RF E    L +  A ++ 
Sbjct: 147 DVTTKEVRLRESDTVTPGYCLERPVSTPVGQI--GLQICYDLRFAEPAVLLRKLGANLLT 204

Query: 173 VPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANP 232
            P+++    GK   W++L RARA+++  ++VA  Q     + R         GHSM+ +P
Sbjct: 205 YPSAFTYATGK-AHWEILLRARAIETQCFVVAAAQIGWHNQKRQ------SWGHSMIVSP 257

Query: 233 HGQVIVSAG-YEPEMLIVDIDVSDLSKIREALP 264
            G V+      E ++   ++D+S L  + + +P
Sbjct: 258 WGNVLADCSEQELDIGTAEVDLSVLQSLYQTMP 290


>NIT2_YEAST RecName: Full=Probable hydrolase NIT2;       
           EC=3.5.-.-;
          Length = 307

 Score = 88.6 bits (218), Expect = 6e-20
 Identities = 81/295 (27%), Positives = 141/295 (47%), Gaps = 35/295 (11%)

Query: 2   RIALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEAT---SQSFGTGRLDTQAE-- 56
           R+A+ Q+ +++D   N  ++++   +A ++ A V+  PEA+   SQ+    R   Q    
Sbjct: 7   RVAVAQLCSSADLTKNLKVVKELISEAIQKKADVVFLPEASDYLSQNPLHSRYLAQKSPK 66

Query: 57  ---ELDGEFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVL-ISGAG-LHQ 111
              +L    +  V++ +  + V I   +      +  G     RV N +L I   G + Q
Sbjct: 67  FIRQLQSSITDLVRDNSRNIDVSIGVHLPPSEQDLLEGN---DRVRNVLLYIDHEGKILQ 123

Query: 112 GYNKIHTYDAFG-----YRESDTVKPGDELV-VFEVDDIKFGVATCYDIRFPEQFKDLAR 165
            Y K+H +D         +ES +V+PG  +  + E    K G A CYDIRFPE    L  
Sbjct: 124 EYQKLHLFDVDVPNGPILKESKSVQPGKAIPDIIESPLGKLGSAICYDIRFPEFSLKLRS 183

Query: 166 NDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARL-----PE-------E 213
             A+++  P+++    G+   W+LL RARA+D+  +++  GQ  +     PE        
Sbjct: 184 MGAEILCFPSAFTIKTGE-AHWELLGRARAVDTQCYVLMPGQVGMHDLSDPEWEKQSHMS 242

Query: 214 LRDKRNGPTGIGHSMVANPHGQVIVSAG---YEPEMLIVDIDVSDLSKIREALPV 265
             +K +     GHSMV +P G++I  A      P++++ D+D   L +IR  +P+
Sbjct: 243 ALEKSSRRESWGHSMVIDPWGKIIAHADPSTVGPQLILADLDRELLQEIRNKMPL 297


>NFT1_CAEEL RecName: Full=Nitrilase and fragile histidine triad
           fusion protein NitFhit;Includes:  RecName:
           Full=Bis(5'-adenosyl)-triphosphatase;
          Length = 440

 Score = 88.6 bits (218), Expect = 6e-20
 Identities = 72/271 (26%), Positives = 121/271 (44%), Gaps = 19/271 (7%)

Query: 3   IALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQ-SFGTGRLDTQAEELDGE 61
           IA+ Q+++++D   NF   ++  E+A E+   ++  PE               A   D E
Sbjct: 17  IAVCQMTSDNDLEKNFQAAKNMIERAGEKKCEMVFLPECFDFIGLNKNEQIDLAMATDCE 76

Query: 62  FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG-YNKIHTYD 120
           +    +ELA +  + +  G     D            N  ++I   G+ +  YNK+H +D
Sbjct: 77  YMEKYRELARKHNIWLSLGGLHHKDPSDAAHPW----NTHLIIDSDGVTRAEYNKLHLFD 132

Query: 121 A-----FGYRESDTVKPGDELVVFEVDDI-KFGVATCYDIRFPEQFKDLARNDAQVILVP 174
                     ES+  K G E++      I + G++ CYD+RFPE      +  AQ++  P
Sbjct: 133 LEIPGKVRLMESEFSKAGTEMIPPVDTPIGRLGLSICYDVRFPELSLWNRKRGAQLLSFP 192

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
           +++    G L  W+ L RARA+++  ++VA  Q       R         GHSMV +P G
Sbjct: 193 SAFTLNTG-LAHWETLLRARAIENQCYVVAAAQTGAHNPKRQS------YGHSMVVDPWG 245

Query: 235 QVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
            V+       +M   +ID+S +  +RE  PV
Sbjct: 246 AVVAQCSERVDMCFAEIDLSYVDTLREMQPV 276


>NIT2_SCHPO RecName: Full=Probable hydrolase nit2;       
           EC=3.5.-.-;
          Length = 276

 Score = 84.7 bits (208), Expect = 8e-19
 Identities = 79/283 (27%), Positives = 131/283 (46%), Gaps = 40/283 (14%)

Query: 4   ALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELD---- 59
           A+ Q++++   + N A+ ++   +AA +GA+ + FPEA+   F     D   E  +    
Sbjct: 5   AVAQLNSSGSILKNLAICKELISQAAAKGAKCIFFPEASD--FIAHNSDEAIELTNHPDC 62

Query: 60  GEFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLH-------QG 112
            +F   V+E A +  + +   +  P           S+V N +L S   +          
Sbjct: 63  SKFIRDVRESATKHSIFVNICVHEP-----------SKVKNKLLNSSLFIEPLHGEIISR 111

Query: 113 YNKIHTYDAF-----GYRESDTVKPGDELVVFEVDDI-KFGVATCYDIRFPEQFKDLARN 166
           Y+K H +D         +ES+T   G+ ++      + K G A C+DIRFPEQ   L   
Sbjct: 112 YSKAHLFDVEIKNGPTLKESNTTLRGEAILPPCKTPLGKVGSAICFDIRFPEQAIKLRNM 171

Query: 167 DAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGH 226
            A +I  P+++ +  G    W++L RARALDS  +++A  Q     E R         GH
Sbjct: 172 GAHIITYPSAFTEKTG-AAHWEVLLRARALDSQCYVIAPAQGGKHNEKR------ASYGH 224

Query: 227 SMVANPHGQVIV--SAGYEPEMLI-VDIDVSDLSKIREALPVL 266
           SM+ +P G VI   S    P  LI  D+D++ +  +R  +P+L
Sbjct: 225 SMIVDPWGTVIAQYSDISSPNGLIFADLDLNLVDHVRTYIPLL 267


>AGUB_SOLTU RecName: Full=N-carbamoylputrescine amidase;       
           EC=3.5.1.53;
          Length = 300

 Score = 84.7 bits (208), Expect = 8e-19
 Identities = 78/276 (28%), Positives = 121/276 (43%), Gaps = 33/276 (11%)

Query: 3   IALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEE----- 57
           +A LQ +   D   N A        A ++GA +++  E      G      Q EE     
Sbjct: 10  VAALQFACTDDVSTNVATAERLVRAAHQKGANIILIQELFE---GYYFCQAQKEEFFHRA 66

Query: 58  ---LDGEFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG-Y 113
              L       ++ LA ELGVVI    F  A+         +  N+  +I   G   G Y
Sbjct: 67  KPYLGHPTIVRMQNLAKELGVVIPVSFFEEANN--------AHYNSVAIIDADGTDLGLY 118

Query: 114 NKIHTYDAFGYRESDTVKPGDE-LVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVIL 172
            K H  D  GY+E     PGD    VF+    K GVA C+D  FPE  + +A   A+V+ 
Sbjct: 119 RKSHIPDGPGYQEKFYFNPGDTGFKVFQTKYAKIGVAICWDQWFPEAARAMALQGAEVLF 178

Query: 173 VPTS-----WQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI--- 224
            PT+       DG    + W+ + +  A  +   +VA    R+ +E+ +  +G + I   
Sbjct: 179 YPTAIGSEPQDDGLDSRDHWRRVMQGHAGANVVPLVASN--RIGKEIIETEHGNSEITFY 236

Query: 225 GHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIR 260
           G+S +A P G+++ +AG + E ++V     DL KI+
Sbjct: 237 GYSFIAGPTGELVAAAGDKEEAVLV--AQFDLDKIK 270


>AGUB_SOLLC RecName: Full=N-carbamoylputrescine amidase;       
           EC=3.5.1.53;
          Length = 300

 Score = 83.6 bits (205), Expect = 2e-18
 Identities = 77/276 (27%), Positives = 120/276 (43%), Gaps = 33/276 (11%)

Query: 3   IALLQISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEF 62
           +A LQ +   D   N A        A ++GA +++  E      G      Q EE     
Sbjct: 10  VAALQFACTDDVSTNVATAERLVRAAHQKGANIILIQELFE---GYYFCQAQKEEFFHRA 66

Query: 63  S--------TAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG-Y 113
                      ++ LA ELGVVI    F  A+         +  N+  +I   G   G Y
Sbjct: 67  KPYPGHPTIVRMQNLAKELGVVIPVSFFEEANN--------AHYNSVAIIDADGTDLGLY 118

Query: 114 NKIHTYDAFGYRESDTVKPGDE-LVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVIL 172
            K H  D  GY+E     PGD    VF+    K GVA C+D  FPE  + +A   A+V+ 
Sbjct: 119 RKSHIPDGPGYQEKYYFNPGDTGFKVFQTKYAKIGVAICWDQWFPEAARAMALQGAEVLF 178

Query: 173 VPTS-----WQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI--- 224
            PT+       DG    + W+ + +  A  +   +VA    R+ +E+ +  +G + I   
Sbjct: 179 YPTAIGSEPQDDGLDSRDHWRRVMQGHAGANVVPLVASN--RIGKEIIETEHGNSEITFY 236

Query: 225 GHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIR 260
           G+S +A P G+++ +AG + E ++V     DL KI+
Sbjct: 237 GYSFIAGPTGELVAAAGDKEEAVLV--AQFDLDKIK 270


>YCU9_SCHPO RecName: Full=Probable nitrilase C965.09;       
           EC=3.5.-.-;
          Length = 272

 Score = 80.9 bits (198), Expect = 1e-17
 Identities = 65/233 (27%), Positives = 109/233 (46%), Gaps = 26/233 (11%)

Query: 35  VLVFPEATSQSFGTGRLDTQAEELDGE---FSTAVKELADELGVVIVAGMFTPADTVQRG 91
           +++FPE  +  +  G   TQ  E+ GE   F T +  LA +  V I+ G        ++ 
Sbjct: 40  LILFPELITSGYECGNTFTQIAEIAGEGPSFKT-MSNLAAKYHVNIIYGF------PEKE 92

Query: 92  EKTISRVNNTVLI--SGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVA 149
           EK  + + N+ +       L   Y K+H +D     E    K G +  +FE    K GV 
Sbjct: 93  EKQSNIIYNSCIYITENGNLGGVYRKVHLFDT----ERKHFKKGSDFPIFETSFGKLGVM 148

Query: 150 TCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQAR 209
            C+D  FPE  +  A N A +++V T+W++     + W L+ +ARA ++   +VA  +  
Sbjct: 149 ICWDTAFPEVARIHALNGADLLVVATNWENPYS--DDWDLVTKARAFENCIPLVAANRVG 206

Query: 210 LPEELRDKRNGPTGIGHSMVANPHGQVIVSAGYEPEMLI-VDIDVSDLSKIRE 261
             E+L       +  GHS +  P G+VI +   E E +I   +D+ D   +R+
Sbjct: 207 TDEKL-------SFFGHSKIIGPTGKVIKALDEEKEGVISYTVDLDDAKPLRK 252


>MTNU_BACSU RecName: Full=UPF0012 hydrolase mtnU;       
           EC=3.5.-.-;
          Length = 259

 Score = 79.3 bits (194), Expect = 3e-17
 Identities = 62/235 (26%), Positives = 102/235 (43%), Gaps = 21/235 (8%)

Query: 33  ARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVKELADELGVVIVAGMFTPADTVQRGE 92
           A VLV PE  +  +                 + +K+ A + GV IVAG            
Sbjct: 35  ADVLVLPELWTTGYXXXXXXXXXXXXGRSAQSWLKKTAKKHGVHIVAGSVAVRKN----- 89

Query: 93  KTISRVNNTVLISG--AGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVAT 150
              S V NT+ I+     + + Y K H +      E   +  G E   FE+D +K     
Sbjct: 90  ---SDVYNTMYIADKEGQIIKEYRKAHLFQLMD--EHLYLSAGSEDGYFELDGVKSSGLI 144

Query: 151 CYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARL 210
           CYDIRFPE  +      A V+ +   W     +L+ W+ L  ARA+++  ++ AC     
Sbjct: 145 CYDIRFPEWIRKHTTKGANVLFISAEWP--LPRLDHWKSLLIARAIENQCFVAACN---- 198

Query: 211 PEELRDKRNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
                         GHS++ +P G+V+   G E  ++  +ID+ + +++RE++PV
Sbjct: 199 ---CTGSNPDNEFAGHSLIIDPWGRVLAEGGREEGIVRAEIDLQESAEVRESIPV 250


>YAG5_STAAU RecName: Full=UPF0012 hydrolase in agr operon;       
           EC=3.5.-.-;AltName: Full=ORF 5;
          Length = 261

 Score = 78.2 bits (191), Expect = 8e-17
 Identities = 66/276 (23%), Positives = 125/276 (45%), Gaps = 36/276 (13%)

Query: 1   MRIALLQIS-TNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELD 59
           M++ + Q+     D   N   +    EK       V+V PE  +  +    L+ +A+   
Sbjct: 1   MKVQIYQLPIVFGDSSKNETQITQWFEKNMNAEVDVVVLPEMWNNGYDLEHLNEKADNNL 60

Query: 60  GEFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGA-------GLHQG 112
           G+  + +K LA++  V IVAG             ++S + N  + + A        L   
Sbjct: 61  GQSFSFIKHLAEKYKVDIVAG-------------SVSNIRNNQIFNTAFSVNKSGQLINE 107

Query: 113 YNKIHTYDAFGYRESDTVKPGDELVV-FEVDDIKFGVAT-CYDIRFPEQFKDLARNDAQV 170
           Y+K+H       RE + +  G+ +   F++ D  +     CYD+RFPE  +  AR+ A++
Sbjct: 108 YDKVHLVPML--REHEFLTAGEYVAEPFQLSDGTYVTQLICYDLRFPELLRYPARSGAKI 165

Query: 171 ILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI-GHSMV 229
                 W     +L+ W  L +ARA+++  +++               +G T   GHS+V
Sbjct: 166 AFYVAQWP--MSRLQHWHSLLKARAIENNMFVIGTNSTGF--------DGNTEYAGHSIV 215

Query: 230 ANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
            NP+G ++       ++L VD++++++ + RE +PV
Sbjct: 216 INPNGDLVGELNESADILTVDLNLNEVEQQRENIPV 251


>AGUB_ARATH RecName: Full=N-carbamoylputrescine amidase;       
           EC=3.5.1.53;AltName: Full=Nitrilase-like protein 1;
          Length = 326

 Score = 75.9 bits (185), Expect = 4e-16
 Identities = 59/201 (29%), Positives = 96/201 (47%), Gaps = 23/201 (11%)

Query: 66  VKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG-YNKIHTYDAFGY 124
           +++LA ELGVVI    F  A+T        +  N+  +I   G   G Y K H  D  GY
Sbjct: 107 MQKLAKELGVVIPVSFFEEANT--------AHYNSIAIIDADGTDLGIYRKSHIPDGPGY 158

Query: 125 RESDTVKPGDE-LVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTS-----WQ 178
           +E     PGD    VF+    K GVA C+D  FPE  + +    A+++  PT+       
Sbjct: 159 QEKFYFNPGDTGFKVFQTKFAKIGVAICWDQWFPEAARAMVLQGAEILFYPTAIGSEPQD 218

Query: 179 DGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI---GHSMVANPHGQ 235
            G    + W+ + +  A  +   +VA    R+ +E+ +  +GP+ I   G S +A P G+
Sbjct: 219 QGLDSRDHWRRVMQGHAGANVVPLVASN--RIGKEIIETEHGPSQITFYGTSFIAGPTGE 276

Query: 236 VIVSAGYEPEMLIV---DIDV 253
           ++  A  + E ++V   D+D+
Sbjct: 277 IVAEADDKSEAVLVAQFDLDM 297


>YAG5_STALU RecName: Full=UPF0012 hydrolase in agr operon;AltName:
           Full=ORF 5;Flags: Fragment;
          Length = 234

 Score = 71.6 bits (174), Expect = 7e-15
 Identities = 62/236 (26%), Positives = 106/236 (44%), Gaps = 25/236 (10%)

Query: 35  VLVFPEATSQSFGTGRLDTQAEELDGEFSTA-VKELADELGVVIVAGMFTPADTVQRGEK 93
           V++ PE  +  +   +L+ +A+  D E ST  +K LA +  V I+AG  +         K
Sbjct: 9   VVILPEMWNNGYALEQLEEKAD-FDLERSTDFIKNLALQYQVDIIAGSVS--------NK 59

Query: 94  TISRVNNTVLI---SGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVAT 150
               + NT      +G  ++Q Y+K+H           T            + +K     
Sbjct: 60  HHDHIFNTAFAIDKTGKVINQ-YDKMHLVPMLDEPAFLTAGKNVPETFKLSNGVKVTQMI 118

Query: 151 CYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARL 210
           CYD+RFPE  +  AR+ A +      W     +L  WQ+L +ARA+++  +++ C     
Sbjct: 119 CYDLRFPELLRYPARSGATIAFYVAQWPSA--RLNHWQVLLKARAIENNMYVIGCNGCGY 176

Query: 211 PEELRDKRNGPTGI-GHSMVANPHGQVIVSAGYEPEMLIVDIDVSDLSKIREALPV 265
                   +G T   GHS+  NP+G++I       + L V ID+  + + R+A+PV
Sbjct: 177 --------DGKTQYAGHSVAINPNGEIIQELSTTEKELTVTIDIDAVEQQRKAIPV 224


>DCAS_AGRSK RecName: Full=N-carbamoyl-D-amino acid hydrolase;       
            EC=3.5.1.77;AltName: Full=D-N-alpha-carbamilase;
          Length = 304

 Score = 68.2 bits (165), Expect = 8e-14
 Identities = 73/268 (27%), Positives = 115/268 (42%), Gaps = 38/268 (14%)

Query: 21  LRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVK--------ELADE 72
           L D   KAA +GA  +VFPE    +F      T   ELD  + T +         E A E
Sbjct: 28  LLDMLTKAASRGANFIVFPELALTTFFPRWHFTDEAELDSFYETEMPGPVVRPLFEKAAE 87

Query: 73  LGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG-YNKIH--------TYDAFG 123
           LG+    G    A+ V  G     R N ++L+  +G   G Y KIH         Y  F 
Sbjct: 88  LGIGFNLGY---AELVVEGGVK-RRFNTSILVDKSGKIVGKYRKIHLPGHKEYEAYRPFQ 143

Query: 124 YRESDTVKPGD-ELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVIL----VPTSWQ 178
           + E    +PGD    V++VD  K G+  C D R+PE ++ +    A++I      PT   
Sbjct: 144 HLEKRYFEPGDLGFPVYDVDAAKMGMFICNDRRWPEAWRVMGLRGAEIICGGYNTPTHNP 203

Query: 179 DGP--GKLEQWQ--LLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
             P    L  +   L  +A +  + +W  A G+  + E           +GHS +  P G
Sbjct: 204 PVPQHDHLTSFHHLLSMQAGSYQNGAWSAAAGKVGMEENC-------MLLGHSCIVAPTG 256

Query: 235 QVI-VSAGYEPEMLIVDIDVSDLSKIRE 261
           +++ ++   E E++   +D+    ++RE
Sbjct: 257 EIVALTTTLEDEVITAAVDLDRCRELRE 284


>DCAS_RHIRD RecName: Full=N-carbamoyl-D-amino acid hydrolase;       
            EC=3.5.1.77;AltName: Full=D-N-alpha-carbamilase;
          Length = 304

 Score = 66.6 bits (161), Expect = 2e-13
 Identities = 72/268 (26%), Positives = 114/268 (42%), Gaps = 38/268 (14%)

Query: 21  LRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEELDGEFSTAVK--------ELADE 72
           L D    AA +G   +VFPE    +F      T   ELD  + T +         E A E
Sbjct: 28  LLDMLTNAASRGVNFIVFPELALTTFFPRWHFTDEAELDSFYETEMPGPVVRPLFETAAE 87

Query: 73  LGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG-YNKIH--------TYDAFG 123
           LG+    G    A+ V  G     R N ++L+  +G   G Y KIH         Y  F 
Sbjct: 88  LGIGFNLGY---AELVVEGGVK-RRFNTSILVDKSGKIVGKYRKIHLPGHKEYEAYRPFQ 143

Query: 124 YRESDTVKPGD-ELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVIL----VPTSWQ 178
           + E    +PGD    V++VD  K G+  C D R+PE ++ +    A++I      PT   
Sbjct: 144 HLEKRYFEPGDLGFPVYDVDAAKMGMFICNDRRWPETWRVMGLKGAEIICGGYNTPTHNP 203

Query: 179 DGP--GKLEQWQ--LLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
             P    L  +   L  +A +  + +W  A G+  + E       G   +GHS +  P G
Sbjct: 204 PVPQHDHLTSFHHLLSMQAGSYQNGAWSAAAGKVGMEE-------GCMLLGHSCIVAPTG 256

Query: 235 QVI-VSAGYEPEMLIVDIDVSDLSKIRE 261
           +++ ++   E E++   +D+    ++RE
Sbjct: 257 EIVALTTTLEDEVITAAVDLDRCRELRE 284


>AGUB_ORYSJ RecName: Full=N-carbamoylputrescine amidase;       
           EC=3.5.1.53;
          Length = 301

 Score = 62.4 bits (150), Expect = 4e-12
 Identities = 54/205 (26%), Positives = 90/205 (43%), Gaps = 21/205 (10%)

Query: 67  KELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG-YNKIHTYDAFGYR 125
           ++LA EL VVI    F  A+         +  N+  +I   G   G Y K H  D  GY+
Sbjct: 82  QKLAKELEVVIPVSFFEEANN--------AHYNSVAIIDADGTDLGLYRKSHIPDGPGYQ 133

Query: 126 ESDTVKPGDE-LVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGP--- 181
           E     PGD     F+      GV  C+D  FPE  + +    A+++  PT+    P   
Sbjct: 134 EKFYFNPGDTGFKAFKTKYATIGVGICWDQWFPECARAMVLQGAEILFYPTAIGSEPQDN 193

Query: 182 --GKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI---GHSMVANPHGQV 236
                E W+ + +  A  +   +VA    R+  E  +  +G + I   G+S +A P G++
Sbjct: 194 NLDSREHWKRVMQGHAGANLVPLVASN--RIGRETVETEHGESTITFFGNSFIAGPTGEI 251

Query: 237 IVSAGYEPE-MLIVDIDVSDLSKIR 260
           +  A  + E +L+ + D+ ++   R
Sbjct: 252 VKLANDKDEDVLVAEFDLDEIKSTR 276


>YAFV_ECOLI RecName: Full=UPF0012 hydrolase yafV;       
           EC=3.5.-.-;
          Length = 256

 Score = 57.0 bits (136), Expect = 2e-10
 Identities = 46/168 (27%), Positives = 77/168 (45%), Gaps = 13/168 (7%)

Query: 98  VNNTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFP 157
           VN  +L+   G    Y+K H +      E    K G+  V+ E    +     CYD+RFP
Sbjct: 90  VNRFLLVEPGGTVHFYDKRHLFRMAD--EHLHYKAGNARVIVEWRGWRILPLVCYDLRFP 147

Query: 158 EQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDK 217
              ++L  ND  + L   +W   P  L  WQ L  ARA+++ +++  C +      +   
Sbjct: 148 VWSRNL--NDYDLALYVANW-PAPRSL-HWQALLTARAIENQAYVAGCNR------VGSD 197

Query: 218 RNGPTGIGHSMVANPHGQVIVSA-GYEPEMLIVDIDVSDLSKIREALP 264
            NG    G S V NP G++I +A  ++   +  ++ ++ L + RE  P
Sbjct: 198 GNGCHYRGDSRVINPQGEIIATADAHQATRIDAELSMAALREYREKFP 245


>YPQQ_PSEFL RecName: Full=UPF0012 hydrolase in pqqF 5'region;       
            EC=3.5.-.-;AltName: Full=ORF2;
          Length = 285

 Score = 53.9 bits (128), Expect = 2e-09
 Identities = 70/258 (27%), Positives = 101/258 (39%), Gaps = 28/258 (10%)

Query: 1   MRIALLQISTNS-DKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTG--RLDTQAEE 57
           MR+AL Q      D   N   L   A +A +  A +LV PE     +  G   +   AE 
Sbjct: 22  MRVALYQCPPRPLDVAGNLQRLHQVAMEATD--ADLLVLPEMFLSGYNIGLEAVGALAEA 79

Query: 58  LDGEFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTV-LISGAGLHQ-GYNK 115
            DG                 + G   P  +V        ++ N V LI   G     Y K
Sbjct: 80  QDGPSXXXXXXXXXXXXXXXLYGY--PERSVD------GQIYNAVQLIDAQGQRLCNYRK 131

Query: 116 IHTYDAFGYRESDTVKPG-DELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
            H    FG  +      G D+  + E+D  K G   CYDI FPE  + LA   A++ILVP
Sbjct: 132 THL---FGDLDHSMFSAGEDDFPLVELDGWKLGFLICYDIEFPENARRLALAGAELILVP 188

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPHG 234
           T+       +    +  RARA ++  ++         E++R         G S +A P G
Sbjct: 189 TANMIPYDFVADVTI--RARAFENQCYVAYANYCGHEEQIR-------YCGQSSIAAPDG 239

Query: 235 QVIVSAGYEPEMLIVDID 252
             I  AG +  ++I  +D
Sbjct: 240 SRIALAGLDEALIIGTLD 257


>NADE_XYLFT RecName: Full=Probable glutamine-dependent NAD(+)
           synthetase;         EC=6.3.5.1;AltName: Full=NAD(+)
           synthase [glutamine-hydrolysing];
          Length = 545

 Score = 52.4 bits (124), Expect = 5e-09
 Identities = 69/265 (26%), Positives = 110/265 (41%), Gaps = 40/265 (15%)

Query: 1   MRIALLQ-------ISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDT 53
           +RIA+ Q       ++ N++++   AL+  A +   E GA V++FPE     +    L  
Sbjct: 5   LRIAMAQFDFPVGAVAQNAERI--IALIEQARD---EHGADVVMFPELALSGYPPEDLLL 59

Query: 54  QAEELDGEFSTAVKELADEL-GVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG 112
           +   L      A++ +A    G+V V G    A +V          N   ++    + Q 
Sbjct: 60  RPGFL-AHCQVAIERIAAATHGIVAVVGWPQSAGSVV--------YNVASVLCDGQVEQT 110

Query: 113 YNK--IHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQV 170
           Y K  +  Y  F  R    V P     VF+V  +  GV  C D+ F E   D     A++
Sbjct: 111 YRKRELPNYAVFDERRYFEVDPNGSRCVFKVKGVPVGVLICEDLWFSEPLADTVCGGAEL 170

Query: 171 ILVPTSWQDGPGKLEQWQLLPRARALDSTSWI----VACGQARLPEELRDKRNGPTGIGH 226
           +LVP +     GK  Q   L   RA ++ + I    V  GQ  L  +           G 
Sbjct: 171 VLVPNASPYERGKHAQRDALLAERARETGAAIAYLNVVGGQDALVFD-----------GA 219

Query: 227 SMVANPHGQV-IVSAGYEPEMLIVD 250
           S+V + HG+V   +A +  + L+VD
Sbjct: 220 SVVVDGHGRVHPAAAAFSDQWLVVD 244


>NADE_XYLFA RecName: Full=Probable glutamine-dependent NAD(+)
           synthetase;         EC=6.3.5.1;AltName: Full=NAD(+)
           synthase [glutamine-hydrolysing];
          Length = 545

 Score = 52.4 bits (124), Expect = 5e-09
 Identities = 69/265 (26%), Positives = 110/265 (41%), Gaps = 40/265 (15%)

Query: 1   MRIALLQ-------ISTNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDT 53
           +RIA+ Q       ++ N++++   AL+  A +   E GA V++FPE     +    L  
Sbjct: 5   LRIAMAQFDFPVGAVAQNAERI--IALIEQARD---EHGADVVMFPELALSGYPPEDLLL 59

Query: 54  QAEELDGEFSTAVKELADEL-GVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQG 112
           +   L      A++ +A    G+V V G    A +V          N   ++    + Q 
Sbjct: 60  RPGFL-AHCQVAIERIAAATHGIVAVVGWPQSAGSVV--------YNVASVLCDGQVEQT 110

Query: 113 YNK--IHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQV 170
           Y K  +  Y  F  R    V P     VF+V  +  GV  C D+ F E   D     A++
Sbjct: 111 YRKRELPNYAVFDERRYFEVDPNGSRCVFKVKGVPVGVLICEDLWFSEPLADTVCGGAEL 170

Query: 171 ILVPTSWQDGPGKLEQWQLLPRARALDSTSWI----VACGQARLPEELRDKRNGPTGIGH 226
           +LVP +     GK  Q   L   RA ++ + I    V  GQ  L  +           G 
Sbjct: 171 VLVPNASPYERGKHAQRDALLAERARETGAAIAYLNVVGGQDALVFD-----------GA 219

Query: 227 SMVANPHGQV-IVSAGYEPEMLIVD 250
           S+V + HG+V   +A +  + L+VD
Sbjct: 220 SVVVDGHGRVHPAAAAFSDQWLVVD 244


>NRL3_ARATH RecName: Full=Nitrilase 3;         EC=3.5.5.1;
          Length = 346

 Score = 46.6 bits (109), Expect = 3e-07
 Identities = 71/295 (24%), Positives = 121/295 (41%), Gaps = 50/295 (16%)

Query: 1   MRIALLQISTNSDKMDNFALLRDAAEK----AAEQGARVLVFPEATSQSFGTGRLDTQAE 56
           +R+ ++Q ST  +  D  A L D AEK    AA +GA++++FPEA    +  G     A 
Sbjct: 25  VRVTIVQSSTVYN--DTPATL-DKAEKFIVEAASKGAKLVLFPEAFIGGYPRGFRFGLAV 81

Query: 57  ELDGEFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKI 116
            +  E      E  DE      + +  P   V+R  +   + NN  L+ GA    GY   
Sbjct: 82  GVHNE------EGRDEFRNYHASAIKVPGPEVERLAELAGK-NNVHLVMGAIEKDGYTLY 134

Query: 117 HTYDAFGYR-----ESDTVKP------------GDELVVFEVDDIKFGVATCYDIRFPEQ 159
            T   F  +     +   V P            G  + V++    K G A C++ R P  
Sbjct: 135 CTALFFSPQGQFLGKHRKVMPTSLERCIWGQGDGSTIPVYDTPIGKIGAAICWENRMPLY 194

Query: 160 FKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIVA----CGQARLPEE-- 213
              L     ++   PT+         +WQ      A++   ++++    C +   PE   
Sbjct: 195 RTALYAKGIEIYCAPTADYS-----LEWQASMIHIAVEGGCFVLSAHQFCKRREFPEHPD 249

Query: 214 ------LRDKRNGPT-GIGHSMVANPHGQVIVSAGYEPEMLI-VDIDVSDLSKIR 260
                 +  K + PT   G S++ +P G+V+    YE E L+  D+D+ D+++ +
Sbjct: 250 YLFNDIVDTKEHDPTVSGGGSVIISPLGKVLAGPNYESEGLVTADLDLGDIARAK 304


>YHCX_BACSU RecName: Full=UPF0012 hydrolase yhcX;       
           EC=3.5.-.-;
          Length = 513

 Score = 46.2 bits (108), Expect = 3e-07
 Identities = 38/136 (27%), Positives = 66/136 (48%), Gaps = 5/136 (3%)

Query: 130 VKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQL 189
           +  GD++ VF+ D  K  +  CYDI FPE  +  A   A++I  P   +D  G L + + 
Sbjct: 358 ISAGDQVRVFDTDCGKIAIQICYDIEFPELARIAADKGAKIIFTPFCTEDRQGYL-RVRY 416

Query: 190 LPRARALDSTSWIVACGQ-ARLPE-ELRDKRNGPTGI-GHSMVANPHGQVIVSAGYEPEM 246
             +ARA+++  + V  G    LP+ E  D +   +GI   S        ++       EM
Sbjct: 417 CSQARAVENQIYTVISGTVGNLPQTENMDIQYAQSGIFAPSDFEFARDGIVGETNPNIEM 476

Query: 247 LIV-DIDVSDLSKIRE 261
           +++ D+D+  L + R+
Sbjct: 477 VVIGDVDLEILRRQRQ 492


>VNN1_MOUSE RecName: Full=Pantetheinase;       
           EC=3.5.1.92;AltName: Full=Pantetheine hydrolase;AltName:
           Full=Vascular non-inflammatory molecule 1;
          Length = 512

 Score = 45.4 bits (106), Expect = 6e-07
 Identities = 62/234 (26%), Positives = 87/234 (37%), Gaps = 36/234 (15%)

Query: 17  NFALLRDAAEKAAEQGARVLVFPE--ATSQSFGTGRLDTQAEELDGEF------------ 62
           N  LL  A   AA+QGA ++V PE       F    +    EE+                
Sbjct: 58  NLDLLEGAIVSAAKQGAHIIVTPEDGIYGVRFTRDTIYPYLEEIPDPQVNWIPCDNPKRF 117

Query: 63  -STAVKE----LADELGVVIVAGMFT--PADTVQRGEKTISRV--NNTVLISGAGLHQGY 113
            ST V+E    LA    + +VA M    P +T         R   N  V+    G  +  
Sbjct: 118 GSTPVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQG--KLV 175

Query: 114 NKIHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARN-DAQVIL 172
            + H  + F   +   V    E V F+    KFGV TC+DI F +    L        IL
Sbjct: 176 ARYHKQNIFMGEDQFNVPMEPEFVTFDTPFGKFGVFTCFDILFHDPAVTLVTEFQVDTIL 235

Query: 173 VPTSWQDGPGKLEQWQLLPRARALD-STSWIVACGQARLPEELRDKRNGPTGIG 225
            PT+W D         +LP   A++  ++W +  G   L   L +     TG G
Sbjct: 236 FPTAWMD---------VLPHLAAIEFHSAWAMGMGVNFLAANLHNPSRRMTGSG 280


>NADE2_THEMA RecName: Full=Probable glutamine-dependent NAD(+)
           synthetase;         EC=6.3.5.1;AltName: Full=NAD(+)
           synthase [glutamine-hydrolyzing];
          Length = 576

 Score = 45.4 bits (106), Expect = 6e-07
 Identities = 64/263 (24%), Positives = 109/263 (41%), Gaps = 26/263 (9%)

Query: 1   MRIALLQIS-TNSDKMDNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRLDTQAEEL- 58
           +R+ L Q++ T  D   N     +A   A ++G+ +LVFPE     +    L  +   L 
Sbjct: 4   LRVTLAQLNPTLGDFEGNLKKAIEALRVAEDRGSDLLVFPELFLPGYPPEDLMLRLSFLR 63

Query: 59  -DGEFSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAGLHQGYNKIH 117
            + ++     +    LGV ++ G F  +D            N   ++    +   Y KI 
Sbjct: 64  ENRKYLQKFAQHTRNLGVTVLMG-FIDSDE--------DAYNAAAVVKDGEILGVYRKIS 114

Query: 118 TYDAFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFP-EQFKDLARNDAQVILVPTS 176
             +   + E    KPG+EL+V ++ +IK GV  C DI  P E    L+  +   ++   S
Sbjct: 115 LPNYGVFDERRYFKPGEELLVVKIGNIKVGVTICEDIWNPVEPSASLSLGEGVHLIANLS 174

Query: 177 ---WQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGIGHSMVANPH 233
              +  G   L +  L    +A D    +  C      +EL          G SMV +  
Sbjct: 175 ASPYHVGKPVLRKDYL--SMKAYDYHVAMAYCNMVGGQDEL-------VFDGGSMVVDAS 225

Query: 234 GQVI-VSAGYEPEMLIVDIDVSD 255
           G+VI     +E E++ VD+D+ +
Sbjct: 226 GEVINYGKLFEEEIITVDLDLDE 248


>VNN2_HUMAN RecName: Full=Vascular non-inflammatory molecule 2;     
              Short=Vanin-2;AltName: Full=Glycosylphosphatidyl
           inositol-anchored protein GPI-80;
          Length = 520

 Score = 43.1 bits (100), Expect = 3e-06
 Identities = 63/273 (23%), Positives = 107/273 (39%), Gaps = 45/273 (16%)

Query: 16  DNFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRL----------DTQAEELDGE---- 61
           +N  +L  A ++AAEQGAR++V PE     +   R           D Q   +  +    
Sbjct: 56  ENIDILETAIKQAAEQGARIIVTPEDALYGWKFTRETVFPYLEDIPDPQVNWIPCQDPHR 115

Query: 62  -----FSTAVKELADELGVVIVAGMFTPADTVQRGEKT----ISRVNNTVLISGAG-LHQ 111
                    +  LA +  + ++A +        R          + N  V+ +  G L  
Sbjct: 116 FGHTPVQARLSCLAKDNSIYVLANLGDKKPCNSRDSTCPPNGYFQYNTNVVYNTEGKLVA 175

Query: 112 GYNKIHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARN-DAQV 170
            Y+K H Y    +   +  KP  ELV F     +FG+ TC+DI F +    L ++     
Sbjct: 176 RYHKYHLYSEPQFNVPE--KP--ELVTFNTAFGRFGIFTCFDIFFYDPGVTLVKDFHVDT 231

Query: 171 ILVPTSWQDGPGKLEQWQLLPRARALD-STSWIVACGQARLPEELRDKRNGPTGIGHSMV 229
           IL PT+W +         +LP   A++  ++W +  G   L           TG G   +
Sbjct: 232 ILFPTAWMN---------VLPLLTAIEFHSAWAMGMGVNLLVANTHHVSLNMTGSG---I 279

Query: 230 ANPHGQVIVSAGYEPE---MLIVDIDVSDLSKI 259
             P+G  +     + E   +L+ ++D   LS +
Sbjct: 280 YAPNGPKVYHYDMKTELGKLLLSEVDSHPLSSL 312


>VNN1_BOVIN RecName: Full=Pantetheinase;       
           EC=3.5.1.92;AltName: Full=Pantetheine hydrolase;AltName:
           Full=Vascular non-inflammatory molecule 1;
          Length = 510

 Score = 38.9 bits (89), Expect = 5e-05
 Identities = 61/261 (23%), Positives = 95/261 (36%), Gaps = 36/261 (13%)

Query: 17  NFALLRDAAEKAAEQGARVLVFPEATSQSFGTGRL----------DTQAEEL-----DGE 61
           N  LL  A   A++QGA ++V PE     F   R           D Q   +     D  
Sbjct: 57  NLDLLEGAVTSASKQGAHIIVTPEDGIYGFNFTRESIYPYLEDIPDPQVNWIPCNNPDRF 116

Query: 62  FSTAVKE----LADELGVVIVAGMFTP----ADTVQRGEKTISRVNNTVLISGAGLHQGY 113
             T V++    LA +  + IVA +       A   Q       + N  V+    G  +  
Sbjct: 117 GHTPVQQRLSCLAKDNSIYIVANIGDKKSCNASDPQCPPDGRYQYNTDVVFDSKG--KLV 174

Query: 114 NKIHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARND-AQVIL 172
            + H  + F   +        E+V F     KFG+ TC+DI F +    L R+     IL
Sbjct: 175 ARYHKQNLFLNEDQFNAPKEPEVVTFNTTFGKFGIFTCFDILFHDPAVTLVRDSHVDTIL 234

Query: 173 VPTSWQDGPGKLEQWQLLPRARALD-STSWIVACGQARLPEELRDKRNGPTGIGHSMVAN 231
            PT+W +         +LP   A++  ++W +      L   L       TG G     +
Sbjct: 235 FPTAWMN---------VLPHLSAIEFHSAWAMGMRVNFLASNLHYPLKKMTGSGIYAPDS 285

Query: 232 PHGQVIVSAGYEPEMLIVDID 252
           P          E ++L+  +D
Sbjct: 286 PRAFHYDMKTEEGKLLLAQLD 306


>VNN1_CANFA RecName: Full=Pantetheinase;       
           EC=3.5.1.92;AltName: Full=Pantetheine hydrolase;AltName:
           Full=Vascular non-inflammatory molecule 1;
          Length = 514

 Score = 37.4 bits (85), Expect = 2e-04
 Identities = 28/113 (24%), Positives = 47/113 (41%), Gaps = 11/113 (9%)

Query: 115 KIHTYDAFGYRESDTVKPGDELVVFEVDDIKFGVATCYDIRFPEQFKDLARN-DAQVILV 173
           + H ++ F       V    E+V F+    +FGV TC+DI F +    L ++     I+ 
Sbjct: 176 RYHKHNLFMGENQFNVPKKPEIVTFDTIFGRFGVFTCFDILFYDPAVTLVKDFHVDTIVF 235

Query: 174 PTSWQDGPGKLEQWQLLPRARALD-STSWIVACGQARLPEELRDKRNGPTGIG 225
           PT+W +         +LP   A+   ++W +  G   L   +       TG G
Sbjct: 236 PTAWMN---------VLPHLSAIQFHSAWAMGMGVNFLASNIHHPSKRMTGSG 279


>AMIE_BURCH RecName: Full=Aliphatic amidase;       
           EC=3.5.1.4;AltName: Full=Acylamide amidohydrolase;
          Length = 341

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 67/272 (24%), Positives = 114/272 (41%), Gaps = 45/272 (16%)

Query: 7   QISTNSDKMDNFALLRD--AAEKAAEQGARVLVFPEATSQSFGTGRLDT--QAEELDGE- 61
           ++ T ++ +DN   + D     K    G  ++VFPE ++      R +    A  + GE 
Sbjct: 24  RLHTKAEVLDNARRIADMVVGMKQGLPGMDLVVFPEYSTHGIMYDRQEMFDTASTIPGEE 83

Query: 62  ---FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRV--NNTVLISGAG-LHQGYNK 115
              F+ A ++ A+  GV  + G        +R E    +V  N  VLI   G + Q Y K
Sbjct: 84  TDIFAAACRK-ANVWGVFSITG--------ERHEAHPHKVPYNTLVLIDNRGEIVQKYRK 134

Query: 116 IHTYDAFGYRESDTVKPGDELVVFE-VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           I  +        +   PGD   V +    +K  +  C D  +PE ++D A N A++I+  
Sbjct: 135 IMPWTPI-----EGWYPGDRTYVTDGPKGLKISLIICDDGNYPEIWRDCAMNGAELIVRC 189

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI----GHSMVA 230
             +   P K EQ  ++ +A A  + +++                 G  G+    GHS + 
Sbjct: 190 QGYM-YPAK-EQQVMVAKAMAWMNNTYVAVA-----------NATGWDGVYSYFGHSAIV 236

Query: 231 NPHGQVIVSAGYEPEMLIVDIDVSDLSKIREA 262
              G+ +   G E EM +   ++S L  IR+A
Sbjct: 237 GFDGRTLGECG-EEEMGVQYAELS-LGMIRDA 266


>AMIE_BURCC RecName: Full=Aliphatic amidase;       
           EC=3.5.1.4;AltName: Full=Acylamide amidohydrolase;
          Length = 341

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 67/272 (24%), Positives = 114/272 (41%), Gaps = 45/272 (16%)

Query: 7   QISTNSDKMDNFALLRD--AAEKAAEQGARVLVFPEATSQSFGTGRLDT--QAEELDGE- 61
           ++ T ++ +DN   + D     K    G  ++VFPE ++      R +    A  + GE 
Sbjct: 24  RLHTKAEVLDNARRIADMVVGMKQGLPGMDLVVFPEYSTHGIMYDRQEMFDTASTIPGEE 83

Query: 62  ---FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRV--NNTVLISGAG-LHQGYNK 115
              F+ A ++ A+  GV  + G        +R E    +V  N  VLI   G + Q Y K
Sbjct: 84  TDIFAAACRK-ANVWGVFSITG--------ERHEAHPHKVPYNTLVLIDNRGEIVQKYRK 134

Query: 116 IHTYDAFGYRESDTVKPGDELVVFE-VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           I  +        +   PGD   V +    +K  +  C D  +PE ++D A N A++I+  
Sbjct: 135 IMPWTPI-----EGWYPGDRTYVTDGPKGLKISLIICDDGNYPEIWRDCAMNGAELIVRC 189

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI----GHSMVA 230
             +   P K EQ  ++ +A A  + +++                 G  G+    GHS + 
Sbjct: 190 QGYM-YPAK-EQQVMVAKAMAWMNNTYVAVA-----------NATGWDGVYSYFGHSAIV 236

Query: 231 NPHGQVIVSAGYEPEMLIVDIDVSDLSKIREA 262
              G+ +   G E EM +   ++S L  IR+A
Sbjct: 237 GFDGRTLGECG-EEEMGVQYAELS-LGMIRDA 266


>AMIE_BURCA RecName: Full=Aliphatic amidase;       
           EC=3.5.1.4;AltName: Full=Acylamide amidohydrolase;
          Length = 341

 Score = 37.0 bits (84), Expect = 2e-04
 Identities = 67/272 (24%), Positives = 114/272 (41%), Gaps = 45/272 (16%)

Query: 7   QISTNSDKMDNFALLRD--AAEKAAEQGARVLVFPEATSQSFGTGRLDT--QAEELDGE- 61
           ++ T ++ +DN   + D     K    G  ++VFPE ++      R +    A  + GE 
Sbjct: 24  RLHTKAEVLDNARRIADMVVGMKQGLPGMDLVVFPEYSTHGIMYDRQEMFDTASTIPGEE 83

Query: 62  ---FSTAVKELADELGVVIVAGMFTPADTVQRGEKTISRV--NNTVLISGAG-LHQGYNK 115
              F+ A ++ A+  GV  + G        +R E    +V  N  VLI   G + Q Y K
Sbjct: 84  TDIFAAACRK-ANVWGVFSITG--------ERHEAHPHKVPYNTLVLIDNRGEIVQKYRK 134

Query: 116 IHTYDAFGYRESDTVKPGDELVVFE-VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVP 174
           I  +        +   PGD   V +    +K  +  C D  +PE ++D A N A++I+  
Sbjct: 135 IMPWTPI-----EGWYPGDRTYVTDGPKGLKISLIICDDGNYPEIWRDCAMNGAELIVRC 189

Query: 175 TSWQDGPGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI----GHSMVA 230
             +   P K EQ  ++ +A A  + +++                 G  G+    GHS + 
Sbjct: 190 QGYM-YPAK-EQQVMVAKAMAWMNNTYVAVA-----------NATGWDGVYSYFGHSAIV 236

Query: 231 NPHGQVIVSAGYEPEMLIVDIDVSDLSKIREA 262
              G+ +   G E EM +   ++S L  IR+A
Sbjct: 237 GFDGRTLGECG-EEEMGVQYAELS-LGMIRDA 266


>BTD_TAKRU RecName: Full=Biotinidase;         Short=Biotinase;      
             EC=3.5.1.12;Flags: Precursor;
          Length = 504

 Score = 36.6 bits (83), Expect = 3e-04
 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 5/81 (6%)

Query: 100 NTVLISGAGLHQGYNKIHTYDAFGYRESDTVKPGDELVVFEVDDI-KFGVATCYDIRFPE 158
           N V  S   L   Y+K + Y    +  +    P  E+V F+     KFG+ TC+DI F E
Sbjct: 166 NVVFRSDGLLVARYHKYNLY----FEAAFDAPPEPEIVTFDTPFAGKFGLITCFDILFQE 221

Query: 159 QFKDLARNDAQVILVPTSWQD 179
               L     + I+ P +W +
Sbjct: 222 PTVILVEKGVRQIIFPAAWMN 242


>AROB_SHESA RecName: Full=3-dehydroquinate synthase;       
           EC=4.2.3.4;
          Length = 359

 Score = 35.4 bits (80), Expect = 6e-04
 Identities = 37/142 (26%), Positives = 62/142 (43%), Gaps = 14/142 (9%)

Query: 127 SDTVKPGDELVVFEVDDI--KFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKL 184
           ++TV P   L + ++ D    FG  T   +   EQFKDL   D+   +     Q   G+ 
Sbjct: 43  NETVAP---LYLKQIQDTMASFGEVTSVILPDGEQFKDLTHLDS---IFTALLQRNYGRD 96

Query: 185 EQWQLLPRARALDSTSWIVACGQA-----RLPEELRDKRNGPTGIGHSMVANPHGQVIVS 239
                L      D T +  AC Q      ++P  L  + +   G G + V +P G+ ++ 
Sbjct: 97  SVLVALGGGVIGDMTGFAAACYQRGVDFIQIPTTLLSQVDSSVG-GKTAVNHPLGKNMIG 155

Query: 240 AGYEPEMLIVDIDVSDLSKIRE 261
           A Y+P+++I+D +       RE
Sbjct: 156 AFYQPQIVIIDTECLQTLPARE 177


>AMIE_NOCFA RecName: Full=Aliphatic amidase;       
           EC=3.5.1.4;AltName: Full=Acylamide amidohydrolase;
          Length = 345

 Score = 35.4 bits (80), Expect = 6e-04
 Identities = 42/172 (24%), Positives = 70/172 (40%), Gaps = 14/172 (8%)

Query: 7   QISTNSDKMDNFALLRD--AAEKAAEQGARVLVFPEATSQS--FGTGRLDTQAEELDGEF 62
           ++ T ++ +DN   + D     K+   G  ++VFPE ++Q   +    +   A  + GE 
Sbjct: 24  RLHTKAEVLDNCRRIADMLVGMKSGLPGMDLVVFPEYSTQGIMYDEQEMYDTAATVPGEE 83

Query: 63  STAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAG-LHQGYNKIHTYDA 121
           +        E GV    G+F+               N  VLI   G + Q Y KI  +  
Sbjct: 84  TAIFSAACREAGVW---GVFSITGEQHEDHPRKPPYNTLVLIDDHGEIVQKYRKILPWCP 140

Query: 122 FGYRESDTVKPGDELVVFE-VDDIKFGVATCYDIRFPEQFKDLARNDAQVIL 172
                 +   PGD   V E    +K  +  C D  +PE ++D A   A++I+
Sbjct: 141 I-----EGWYPGDTTYVTEGPKGLKISLIVCDDGNYPEIWRDCAMKGAELIV 187


>AROB_SHESW RecName: Full=3-dehydroquinate synthase;       
           EC=4.2.3.4;
          Length = 359

 Score = 34.7 bits (78), Expect = 0.001
 Identities = 30/112 (26%), Positives = 50/112 (44%), Gaps = 9/112 (8%)

Query: 144 IKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDGPGKLEQWQLLPRARALDSTSWIV 203
           + FG      +   EQFKDLA  DA   +     Q   G+      L      D T +  
Sbjct: 59  VSFGEVESVILPDGEQFKDLAHLDA---IFTALLQRNYGRDSVLVALGGGVIGDMTGFAA 115

Query: 204 ACGQA-----RLPEELRDKRNGPTGIGHSMVANPHGQVIVSAGYEPEMLIVD 250
           AC Q      ++P  L  + +   G G + V +P G+ ++ A Y+P+++++D
Sbjct: 116 ACYQRGIDFIQIPTTLLSQVDSSVG-GKTAVNHPLGKNMIGAFYQPQLVLID 166


>AMIE_VARPS RecName: Full=Aliphatic amidase;       
           EC=3.5.1.4;AltName: Full=Acylamide amidohydrolase;
          Length = 344

 Score = 34.7 bits (78), Expect = 0.001
 Identities = 62/266 (23%), Positives = 111/266 (41%), Gaps = 33/266 (12%)

Query: 7   QISTNSDKMDNFALLRD--AAEKAAEQGARVLVFPEATSQS--FGTGRLDTQAEELDGEF 62
           ++ T ++ +DN   + +     K    G  +++FPE ++    + T  +   A  + GE 
Sbjct: 24  RLHTKAEVLDNARKIGEMLVGMKKGLPGMDLVIFPEYSTHGIMYDTKEMYDTASAIPGE- 82

Query: 63  STAVKELADELGVVIVAGMFTPADTVQRGEKTISRVNNTVLISGAG-LHQGYNKIHTYDA 121
            TA+   AD      V G+F+            +  N  +L++  G + Q Y KI  +  
Sbjct: 83  ETAI--FADACRRANVWGVFSLTGERHEAHPDKAPYNTLILMNNQGEIVQKYRKIMPWVP 140

Query: 122 FGYRESDTVKPGDELVVFE-VDDIKFGVATCYDIRFPEQFKDLARNDAQVILVPTSWQDG 180
                 +   PGD   V +    +K  +  C D  +PE ++D A   A++I+    +   
Sbjct: 141 I-----EGWYPGDCTYVSDGPKGMKMSLIICDDGNYPEIWRDCAMRGAELIIRCQGYM-Y 194

Query: 181 PGKLEQWQLLPRARALDSTSWIVACGQARLPEELRDKRNGPTGI----GHSMVANPHGQV 236
           P K EQ  L+ +A A  + +++     A           G  G+    GHS +    G+ 
Sbjct: 195 PAK-EQQILVSKAMAFMNNTYVAVANAA-----------GFDGVYSYFGHSAIIGFDGRT 242

Query: 237 IVSAGYEPEMLIVDIDVSDLSKIREA 262
           +   G E EM I   ++S +  IR+A
Sbjct: 243 LGECG-EEEMGINYAELS-MGLIRDA 266


  Database: sws57.9x
    Posted date:  Nov 5, 2009 10:46 AM
  Number of letters in database: 179,409,320
  Number of sequences in database:  510,076
  
Lambda     K      H
   0.318    0.136    0.415 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 510076
Number of Hits to DB: 10,682,311,582
Number of extensions: 429471186
Number of successful extensions: 1065822
Number of sequences better than 1.0e-03: 21959
Number of HSP's gapped: 1033631
Number of HSP's successfully gapped: 25709
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)