# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_8317.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       BAF53177.1  [L=136]
Description: cglu2 BAF53177.1 GIB00498CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.9e-48  165.5   1.3    2.2e-48  165.3   0.9    1.0  1  PF02261  Aspartate decarboxylase
  ------ inclusion threshold ------
        5.8    8.5   0.1        6.1    8.4   0.1    1.2  1  PF01048  Phosphorylase superfamily
         11    7.2   0.1         12    7.0   0.0    1.1  1  PF09818  Predicted ATPase of the ABC class
         12    8.0   0.0         22    7.2   0.0    1.4  1  PF07504  Fungalysin/Thermolysin Propeptide Motif
         18    6.9   0.1         48    5.5   0.0    1.6  1  PF01861  Protein of unknown function DUF43
         21    7.4   0.0         43    6.4   0.0    1.5  1  PF03077  Putative vacuolating cytotoxin
         24    7.7   0.0         41    7.0   0.0    1.3  1  PF03720  UDP-glucose/GDP-mannose dehydrogenase family, UDP b
         36    6.7   0.0         55    6.1   0.0    1.2  1  PF10329  Region of unknown function (DUF2417)
         39    6.0   0.0         61    5.4   0.0    1.3  1  PF05678  VQ motif
         41    6.3   0.0    1.3e+02    4.7   0.0    1.9  1  PF11302  Protein of unknown function (DUF3104)
         52    6.2   0.0         91    5.4   0.0    1.4  1  PF02933  Cell division protein 48 (CDC48), domain 2
         53    4.8   0.0         74    4.3   0.0    1.1  1  PF04958  Arginine N-succinyltransferase beta subunit
         67    5.9   0.2    1.8e+02    4.5   0.0    1.7  1  PF05862  Helicobacter pylori IceA2 protein
         93    6.2   0.0    1.4e+02    5.6   0.0    1.3  1  PF11365  Protein of unknown function (DUF3166)
    1.1e+02    5.8   0.0    1.6e+02    5.2   0.0    1.4  1  PF10850  Protein of unknown function (DUF2653)
    1.4e+02    5.0   0.0    2.8e+02    4.1   0.0    1.4  1  PF09252  Allergen Fel d I-B chain
    3.5e+02    3.8   0.0    6.9e+02    2.9   0.0    1.4  1  PF03109  ABC1 family
    3.6e+02    3.9   0.0    5.9e+02    3.2   0.0    1.3  1  PF07875  Coat F domain
    3.7e+02    3.8   4.0    7.2e+02    2.8   1.0    2.5  2  PF08194  DIM protein
    1.1e+03    1.8   0.0    1.4e+03    1.5   0.0    1.1  1  PF11708  Pre-mRNA splicing Prp18-interacting factor


Domain and alignment annotation for each model:
>> PF02261  Aspartate decarboxylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  165.3   0.9   4.4e-52   2.2e-48       1     115 [.       1     115 [.       1     116 [. 0.99

  Alignments for each domain:
  == domain 1    score: 165.3 bits;  conditional E-value: 4.4e-52
                 -EEE---EEEEEEE-----TT----EE--HHHHHHTT--TT-EEEEEETT---EEEEEEE--------------CCCTS----EEEEEE--EEEHHHHH CS
     PF02261   1 mlrtllkskihratvteaelnYeGSitideelleaagilelekvqivnvnnGeRleTYvikgergsgvislnGaaArlvqvgdlviiiayaqleeeeak 99 
                 mlrt+l skihratvt+a+l+Y+GS+tid++l++aag++e ekv+iv+++nG+RleTYvi g++g+g i++nGaaA+l+++gdlvii++y q +++eak
  BAF53177.1   1 MLRTILGSKIHRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVDITNGARLETYVIVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAK 99 
                 889************************************************************************************************ PP

                 C---EEEEE-TT--EE CS
     PF02261 100 klkpkvvlvdeknkik 115
                 +++pk+v+vd++n+i+
  BAF53177.1 100 AYEPKIVHVDADNRIV 115
                 *************996 PP

>> PF01048  Phosphorylase superfamily
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.1    0.0012       6.1      76     127 ..      69     113 ..      22     129 .. 0.79

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0012
                 E--B---TTTT-TT-EEE-SEEEE.SS--GGSTTTT...CTS-TCCEB---HH CS
     PF01048  76 tGtaGglnpdlkvGdvvipddain.fdgtsplygpkeegegapdvaeakadpe 127
                 + + G+  + +++Gd+vi+ ++++ +d  +++y pk           ++ad +
  BAF53177.1  69 ICINGAAAHLINPGDLVIIMSYLQaTDAEAKAYEPK--------IVHVDADNR 113
                 4455999999***********999777777755544........444444444 PP

>> PF09818  Predicted ATPase of the ABC class
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0    0.0024        12     386     425 ..      63     102 ..      45     116 .. 0.89

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.0024
     PF09818 386 klgvstilvvggsgdyldvAdtvilmeeyrpkdvtekake 425
                 ++g   i + g++ ++++  d vi m   +++d+++ka e
  BAF53177.1  63 DAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKAYE 102
                 67888999**************************988765 PP

>> PF07504  Fungalysin/Thermolysin Propeptide Motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0    0.0043        22      34      50 ..     105     121 ..     105     122 .. 0.92

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0043
     PF07504  34 vVhvdkdGkvksvsGsl 50 
                 +Vhvd+d+++++ +++l
  BAF53177.1 105 IVHVDADNRIVALGNDL 121
                 7***********99987 PP

>> PF01861  Protein of unknown function DUF43
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0    0.0095        48      68      89 ..     103     124 ..      87     128 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.0095
     PF01861  68 kkvvvvDiDeRlikfiervaee 89 
                  k+v vD+D+R++ + + +ae+
  BAF53177.1 103 PKIVHVDADNRIVALGNDLAEA 124
                 48999**********9999886 PP

>> PF03077  Putative vacuolating cytotoxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0    0.0085        43      17      57 ..      60     100 ..      56     102 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.0085
     PF03077  17 iTgtlksGnavstGGgAnltFnaadnitlnqaninnskagt 57 
                 i g  ++Gn + +G +A l+  +   i++  ++ ++++a +
  BAF53177.1  60 IVGDAGTGNICINGAAAHLINPGDLVIIMSYLQATDAEAKA 100
                 668889**************999999999999988888865 PP

>> PF03720  UDP-glucose/GDP-mannose dehydrogenase family, UDP binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.0   0.0    0.0082        41      21      67 ..      86     128 ..      83     132 .. 0.82

  Alignments for each domain:
  == domain 1    score: 7.0 bits;  conditional E-value: 0.0082
                 HHHHHHHH---EEEEE-SS---........-----EES-CCCCCTT- CS
     PF03720  21 diieeLleegaevkiyDPkvkeeaaealleeknvelvsdleealkga 67 
                  i+  L++ +ae k+y+Pk+ +  a +    + v l +dl+eal g+
  BAF53177.1  86 IIMSYLQATDAEAKAYEPKIVHVDADN----RIVALGNDLAEALPGS 128
                 58999*************999988776....6788888888888776 PP

>> PF10329  Region of unknown function (DUF2417)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.011        55      53      78 ..      86     112 ..      77     117 .. 0.82

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.011
     PF10329  53 tltllLralDaslasyg.klywVdedk 78 
                  +   L+a Da++++y+ k + Vd+d+
  BAF53177.1  86 IIMSYLQATDAEAKAYEpKIVHVDADN 112
                 556789**********95567899886 PP

>> PF05678  VQ motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.012        61       2      12 ..     100     110 ..      99     112 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.012
     PF05678   2 rapptvihtdp 12 
                  + p+++h+d+
  BAF53177.1 100 AYEPKIVHVDA 110
                 689*******8 PP

>> PF11302  Protein of unknown function (DUF3104)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.7   0.0     0.025   1.3e+02       6      26 ..      79      99 ..      74     115 .. 0.79

  Alignments for each domain:
  == domain 1    score: 4.7 bits;  conditional E-value: 0.025
     PF11302  6 vkpGdlVivekeqeakekksk 26
                ++pGdlVi+ +  +a++++ k
  BAF53177.1 79 INPGDLVIIMSYLQATDAEAK 99
                79*******988777766665 PP

>> PF02933  Cell division protein 48 (CDC48), domain 2
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.018        91      19      57 ..      79     117 ..      76     124 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.018
                 E-TT-EEEEE----EEEEEEEEEESCESCE--CTSEEEE CS
     PF02933  19 vskGdiivfeflgkeiklvVvstePsgpvkitedTeiel 57 
                 + +Gd++ ++  +++ +   +  eP+ +++  ++ +++l
  BAF53177.1  79 INPGDLVIIMSYLQATDAEAKAYEPKIVHVDADNRIVAL 117
                 579***********************5555556666555 PP

>> PF04958  Arginine N-succinyltransferase beta subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.015        74     300     337 ..      11      48 ..       5      49 .. 0.92

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.015
                 --EEEEE--------EE--HHHHHH-------EEEEEE CS
     PF04958 300 Fravlaeveeeeedevvlsaeaaealevsegdkvrlva 337
                 +ra++++++ +  ++v+++a+ ++a ++ eg+kv +v 
  BAF53177.1  11 HRATVTQADLDYVGSVTIDADLVHAAGLIEGEKVAIVD 48 
                 69********99**********************9986 PP

>> PF05862  Helicobacter pylori IceA2 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.036   1.8e+02      22      40 ..      99     117 ..      95     119 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.036
     PF05862  22 RtYdsnivavdvdGhvvav 40 
                 + Y+  iv vd d  +va 
  BAF53177.1  99 KAYEPKIVHVDADNRIVAL 117
                 6799*************95 PP

>> PF11365  Protein of unknown function (DUF3166)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0     0.027   1.4e+02      70      94 ..      90     114 ..      57     117 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.027
     PF11365  70 rLklveeeanilsrkivelevenRv 94 
                  L++++ ea+   +kiv ++ +nR+
  BAF53177.1  90 YLQATDAEAKAYEPKIVHVDADNRI 114
                 6899999*****************5 PP

>> PF10850  Protein of unknown function (DUF2653)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.033   1.6e+02      13      41 ..      68      96 ..      59     125 .. 0.85

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.033
     PF10850 13 aiCiyiaekreiePedveveLsYdddtGf 41
                 iCi  a  + i+P d ++ +sY + t  
  BAF53177.1 68 NICINGAAAHLINPGDLVIIMSYLQATDA 96
                69*****************9999877654 PP

>> PF09252  Allergen Fel d I-B chain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.056   2.8e+02      23      37 ..      88     102 ..      83     110 .. 0.87

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.056
                 HHHTT--HHHHHHHH CS
     PF09252  23 LskfnatekereAfe 37 
                 +s+++at++e +A+e
  BAF53177.1  88 MSYLQATDAEAKAYE 102
                 7999**********9 PP

>> PF03109  ABC1 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0      0.14   6.9e+02      27      40 ..      33      46 ..      30      55 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.14
     PF03109 27 VHrAvlksgeeVav 40
                VH A l +ge+Va+
  BAF53177.1 33 VHAAGLIEGEKVAI 46
                9************8 PP

>> PF07875  Coat F domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0      0.12   5.9e+02       2      21 ..      83     102 ..      82     110 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.12
     PF07875   2 DkdiandlLssaKaaassya 21 
                 D +i++++L ++ a a++y 
  BAF53177.1  83 DLVIIMSYLQATDAEAKAYE 102
                 889***************95 PP

>> PF08194  DIM protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   1.0      0.14   7.2e+02      21      30 ..      64      73 ..      59      77 .. 0.82
   2 ?    1.0   0.0      0.53   2.6e+03      16      28 ..      74      86 ..      74      87 .. 0.85

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.14
     PF08194 21 lspGnViING 30
                +  Gn+ ING
  BAF53177.1 64 AGTGNICING 73
                557******* PP

  == domain 2    score: 1.0 bits;  conditional E-value: 0.53
     PF08194 16 anavplspGnViI 28
                a+a+ ++pG  +I
  BAF53177.1 74 AAAHLINPGDLVI 86
                7899999**9877 PP

>> PF11708  Pre-mRNA splicing Prp18-interacting factor
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.28   1.4e+03      86     101 ..      89     104 ..      87     123 .. 0.85

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.28
     PF11708  86 kYLknldsnsakYDPK 101
                 +YL+  d + + Y+PK
  BAF53177.1  89 SYLQATDAEAKAYEPK 104
                 6**************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (136 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       231  (0.0193922); expected 238.2 (0.02)
Passed bias filter:                      210  (0.0176293); expected 238.2 (0.02)
Passed Vit filter:                        20  (0.00167898); expected 11.9 (0.001)
Passed Fwd filter:                        20  (0.00167898); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              20  [number of targets reported over threshold]
# CPU time: 0.14u 0.05s 00:00:00.19 Elapsed: 00:00:00
# Mc/sec: 2097.22
//