# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_8325.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       BAF53991.1  [L=160]
Description: cglu2 BAF53991.1 GIB00498CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.8e-07   33.5   0.0    2.3e-07   33.2   0.0    1.1  1  PF00578  AhpC/TSA family
    6.7e-07   31.6   0.0    9.1e-07   31.2   0.0    1.1  1  PF08534  Redoxin
  ------ inclusion threshold ------
       0.05   15.9   0.0      0.064   15.5   0.0    1.1  1  PF02630  SCO1/SenC
          5    9.3   0.1        8.1    8.7   0.1    1.3  1  PF00751  DM DNA binding domain
         14    6.3   0.0         17    6.1   0.0    1.1  1  PF11134  Phage stabilisation protein
         18    7.2   0.0         75    5.2   0.0    1.8  1  PF09695  Bacterial protein of unknown function (YtfJ_HI0045)
         18    7.6   0.0         45    6.3   0.0    1.6  1  PF01191  RNA polymerase Rpb5, C-terminal domain
         25    5.7   0.0         28    5.5   0.0    1.1  1  PF09887  Uncharacterized protein conserved in archaea (DUF21
         36    6.3   0.0         49    5.9   0.0    1.2  1  PF03691  Uncharacterised protein family (UPF0167)
         42    6.4   0.0    1.3e+02    4.9   0.0    1.7  1  PF10137  Predicted nucleotide-binding protein containing TIR
         43    6.4   0.0         71    5.7   0.0    1.4  1  PF02225  PA domain
         47    6.5   0.1         79    5.8   0.0    1.3  1  PF02591  Putative zinc ribbon domain
         49    5.9   0.0         91    5.0   0.0    1.4  1  PF05840  Bacteriophage replication gene A protein (GPA)
         53    6.7   0.2    1.2e+02    5.5   0.2    1.6  1  PF00403  Heavy-metal-associated domain
         86    4.8   0.0    1.2e+02    4.3   0.0    1.3  1  PF08735  Putative pyruvate format-lyase activating enzyme (D
         98    5.6   0.0      2e+02    4.6   0.0    1.5  1  PF09633  Protein of unknown function (DUF2023)
    1.1e+02    5.5   2.1         87    5.9   0.3    1.6  1  PF08364  Bacterial translation initiation factor IF-2 associ
    1.9e+02    4.7   0.0      4e+02    3.7   0.0    1.5  1  PF08444  Aralkyl acyl-CoA:amino acid N-acyltransferase, C-te
    2.4e+02    3.3   0.0    3.2e+02    2.8   0.0    1.2  1  PF08456  Viral methyltransferase C-terminal
    2.6e+02    3.7   0.3    4.4e+02    3.0   0.2    1.3  1  PF06803  Protein of unknown function (DUF1232)
    3.9e+02    3.5   0.0    8.1e+02    2.5   0.0    1.5  1  PF12399  Branched-chain amino acid ATP-binding cassette tran
    4.5e+02    3.2   0.0      8e+02    2.3   0.0    1.4  1  PF09042  Titin Z
    6.1e+02    2.6   0.0    8.2e+02    2.2   0.0    1.3  1  PF09732  Cactus-binding C-terminus of cactin protein
      7e+02    3.0   0.2      1e+03    2.5   0.1    1.2  1  PF02067  Metallothionein family 5
    7.4e+02    2.7   0.3    1.3e+03    1.9   0.2    1.3  1  PF08274  PhnA Zinc-Ribbon
    7.5e+02    1.0   0.0    8.7e+02    0.8   0.0    1.1  1  PF00998  Viral RNA dependent RNA polymerase
    1.1e+03    2.6   0.0    1.5e+03    2.2   0.0    1.3  1  PF03734  L,D-transpeptidase catalytic domain
    1.9e+03    2.3   0.7    4.5e+03    1.1   0.5    1.6  1  PF10578  Seminal vesicle protein repeat


Domain and alignment annotation for each model:
>> PF00578  AhpC/TSA family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   33.2   0.0   6.4e-11   2.3e-07       4     123 ..       6     135 ..       4     136 .. 0.78

  Alignments for each domain:
  == domain 1    score: 33.2 bits;  conditional E-value: 6.4e-11
                 -----EEE---...--EEESGGG---EEEEEEE-T.T-HHHH.HHHHHHHHHHHHS----EEEEEEE-..SSS-......-GGGGG---.S-EEEE-.. CS
     PF00578   4 kapdfelkdtd...gkkvslsdlkgkpvvLffypkdfcpvCt.telpalaelyeefkkkgvevigvsv..dspe.....shkkfaeknelnfpllsD.. 89 
                  ap  el+ ++    + +s +dl+gk+vv+ ++ +  cp+C  + +p+ ++ +  +++  v+vig+ +  + ++     ++k f+ + +++fp++ D  
  BAF53991.1   6 NAPLLELDVQEwvnHEGLSNEDLRGKVVVVEVFQM-LCPGCVnHGVPQAQKIHRMIDESQVQVIGLHSvfEHHDvmtpeALKVFISEFGIKFPVAVDmp 103
                 567777774332213558899**************.*****97789********************8744444488898******************55 PP

                 .----HHHH----......SSSEEEEE-----EEE CS
     PF00578  90 .eegevakaygvlneekglalratfvidkegkiry 123
                  e     +    +++     +++ ++ d++g+ir+
  BAF53991.1 104 rE---GQRIPSTMKKYRLEGTPSIILADRKGRIRQ 135
                 43...444444443334559************997 PP

>> PF08534  Redoxin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   31.2   0.0   2.5e-10   9.1e-07      22     135 ..      24     141 ..      13     145 .. 0.84

  Alignments for each domain:
  == domain 1    score: 31.2 bits;  conditional E-value: 2.5e-10
                 EHHHCTTSEEEEEE------HHHHHCCH.HHCTHHHHHCCS--SEEEEEESS-HH.......HHHHHHHTT-TSEEEE-......---HHHHHCT..-E CS
     PF08534  22 slsdfkgkkvvlvfvpgafcptCsaehp.yleklaklakekgvdvvavvaqndaf.......vkeawakeglkipvlsD......esasfakalglrlt 106
                 s +d++gk+vv+ ++    cp+C +  + + +k+ + + e  v+v+++ ++ +          k ++++ g+k+pv+ D      +  s++k++ l+  
  BAF53991.1  24 SNEDLRGKVVVVEVFQM-LCPGCVNHGVpQAQKIHRMIDESQVQVIGLHSVFEHHdvmtpeaLKVFISEFGIKFPVAVDmpregqRIPSTMKKYRLE-- 119
                 5677*****99999999.*****998778*******************777777776766667888888**********998544445666666655.. PP

                 E--GGG-EE--EEEEEETTEEEEEEE-SS CS
     PF08534 107 edasagirtpryavidedgkvvylevepe 135
                        +tp+ ++ d++g++++++ ++ 
  BAF53991.1 120 -------GTPSIILADRKGRIRQVQFGQV 141
                 .......9****************99875 PP

>> PF02630  SCO1/SenC
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   15.5   0.0   1.8e-05     0.064      42     136 ..      20     118 ..      10     130 .. 0.81

  Alignments for each domain:
  == domain 1    score: 15.5 bits;  conditional E-value: 1.8e-05
                 --EEECGGG----EEEEEE-TTSSSCHCCCHHHHHHHHHHHHHCTTT-EEEEEESSTTTS..-HHHHHHHHTTSTTTG...CGEEEECHHHHHHHHHCC CS
     PF02630  42 gkkfeeenLkGklsliyFgftncpdicpealekltdllkkLkeekidvqvvfisvDPerD..tpevlkeylknfdesf...igltgtveeikevakkfk 135
                  +  ++e+L+Gk++++      cp   ++ + + +++ + ++e +++v+ +  sv  ++D  tpe lk ++++f  +f   + +  + + i + +kk++
  BAF53991.1  20 HEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLH-SVFEHHDvmTPEALKVFISEFGIKFpvaVDMPREGQRIPSTMKKYR 117
                 55678899*********9999********99999999999999887776664.6777777679***********9999533445556677778888887 PP

                 H CS
     PF02630 136 v 136
                 +
  BAF53991.1 118 L 118
                 6 PP

>> PF00751  DM DNA binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.7   0.1    0.0023       8.1       5      21 ..      42      58 ..      39      60 .. 0.88

  Alignments for each domain:
  == domain 1    score: 8.7 bits;  conditional E-value: 0.0023
     PF00751  5 CarCrnHgvlsplkGHk 21
                C  C nHgv +  k H+
  BAF53991.1 42 CPGCVNHGVPQAQKIHR 58
                999***********996 PP

>> PF11134  Phage stabilisation protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0    0.0048        17      83     141 ..      89     145 ..      66     150 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.0048
     PF11134  83 iadvagkgrvslaygrdsqaivsagklklyrydGavktlsnwPkdkytqydlGevkdvv 141
                 i++ + k+ v+++  r+ q i s   +k+yr +G+   + ++ k +  q ++G+v d v
  BAF53991.1  89 ISEFGIKFPVAVDMPREGQRIPST--MKKYRLEGTPSIILADRKGRIRQVQFGQVDDFV 145
                 677788888899999998888765..677****************************87 PP

>> PF09695  Bacterial protein of unknown function (YtfJ_HI0045)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.021        75     132     160 ..     115     142 ..     110     147 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.021
     PF09695 132 aWkLkeessaivvldkeGkvlfvkegalt 160
                 +++L+     i++ d++G+++ v+ g+++
  BAF53991.1 115 KYRLEGT-PSIILADRKGRIRQVQFGQVD 142
                 5566555.56999************9986 PP

>> PF01191  RNA polymerase Rpb5, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.0     0.013        45       5      30 ..      70      95 ..      65      98 .. 0.91

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.013
                TSSS--B--B--TTTHHHHHHH---- CS
     PF01191  5 kHelvPkHellseeekkkllkeykik 30
                 H++  +H ++++e  k +++e+ ik
  BAF53991.1 70 LHSVFEHHDVMTPEALKVFISEFGIK 95
                599999****************9997 PP

>> PF09887  Uncharacterized protein conserved in archaea (DUF2114)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.0     0.008        28     109     150 ..      34      75 ..      11      91 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.008
     PF09887 109 vgelikaLadGClkagvpprkmtpamskenipeklrkfslld 150
                 v e+ + L+ GC++ gvp  + +  m  e++ + +  +s+++
  BAF53991.1  34 VVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFE 75 
                 55778899******************9999999998888877 PP

>> PF03691  Uncharacterised protein family (UPF0167)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.014        49      40      63 ..      30      53 ..      24      78 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.014
     PF03691 40 gpvyaveevealCpwCiadGsAae 63
                g+v  ve  ++lCp C++ G   +
  BAF53991.1 30 GKVVVVEVFQMLCPGCVNHGVPQA 53
                6677788899*********97554 PP

>> PF10137  Predicted nucleotide-binding protein containing TIR-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.9   0.0     0.036   1.3e+02       8      57 ..      77     126 ..      70     137 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.9 bits;  conditional E-value: 0.036
     PF10137   8 rdeaakeevarfleklgleviilheqanegktiiekleseadsvgfaivl 57 
                 +d  + e+++ f++++g++  +    ++eg+ i   ++++  + + +i+l
  BAF53991.1  77 HDVMTPEALKVFISEFGIKFPVAVDMPREGQRIPSTMKKYRLEGTPSIIL 126
                 88899999*************************99999987766666666 PP

>> PF02225  PA domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0      0.02        71      27      43 ..      23      39 ..      14      66 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.02
     PF02225 27 laksdvkGkIvlvrrgs 43
                l ++d++Gk+v+v+ ++
  BAF53991.1 23 LSNEDLRGKVVVVEVFQ 39
                6789*********7655 PP

>> PF02591  Putative zinc ribbon domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0     0.022        79      12      29 ..      29      46 ..      25      61 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.022
     PF02591 12 rkgvgvapveggaCgGCn 29
                r++v+v++v +  C GC 
  BAF53991.1 29 RGKVVVVEVFQMLCPGCV 46
                688**************5 PP

>> PF05840  Bacteriophage replication gene A protein (GPA)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.0     0.025        91      40      72 ..      50      82 ..      44      95 .. 0.81

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.025
     PF05840 40 vkvwaaiRaklnkeeirvyGvRvvePhhDgtph 72
                v + ++i + +++++++v G+  v  hhD    
  BAF53991.1 50 VPQAQKIHRMIDESQVQVIGLHSVFEHHDVMTP 82
                5577899999******************97554 PP

>> PF00403  Heavy-metal-associated domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.5   0.2     0.034   1.2e+02       1      14 [.      34      47 ..      34      48 .. 0.89

  Alignments for each domain:
  == domain 1    score: 5.5 bits;  conditional E-value: 0.034
     PF00403  1 tvrvpgmhCagCaa 14
                +v v++m C gC++
  BAF53991.1 34 VVEVFQMLCPGCVN 47
                689*********98 PP

>> PF08735  Putative pyruvate format-lyase activating enzyme (DUF1786)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.035   1.2e+02     189     212 ..      70      92 ..      42      94 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.035
     PF08735 189 ikgvfEhHtslldpeklekllekl 212
                 +++vfEhH  +++pe l+ +++++
  BAF53991.1  70 LHSVFEHHD-VMTPEALKVFISEF 92 
                 5789****5.78999999999886 PP

>> PF09633  Protein of unknown function (DUF2023)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.6   0.0     0.056     2e+02      74      88 ..     137     151 ..     119     156 .. 0.84

  Alignments for each domain:
  == domain 1    score: 4.6 bits;  conditional E-value: 0.056
                 G--HHHHHH------ CS
     PF09633  74 eltaeedfilGalLG 88 
                 ++ + +df+lG lLG
  BAF53991.1 137 QFGQVDDFVLGLLLG 151
                 566789********9 PP

>> PF08364  Bacterial translation initiation factor IF-2 associated region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.3     0.024        87      23      31 ..      29      37 ..      21      37 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.024
     PF08364 23 RsKtVnVEV 31
                R+K+V+VEV
  BAF53991.1 29 RGKVVVVEV 37
                99******9 PP

>> PF08444  Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.7   0.0      0.11     4e+02      23      52 ..     108     137 ..      99     141 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.7 bits;  conditional E-value: 0.11
     PF08444  23 rmagtlpkYrrqglvahvivkqakalekkg 52 
                 r+  t++kYr +g  + +++ ++  +++ +
  BAF53991.1 108 RIPSTMKKYRLEGTPSIILADRKGRIRQVQ 137
                 7789*********99988888777777665 PP

>> PF08456  Viral methyltransferase C-terminal
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0     0.091   3.2e+02     156     206 ..      14      64 ..      11      87 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.091
     PF08456 156 vdsWiekedhFnfssseaeekyswlkkllkevwevilpelefapvyfddee 206
                 v++W++ e   n +  +++   +  + l+   ++  +p+++  + ++d+ +
  BAF53991.1  14 VQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQ 64 
                 89*******99999999999999999***************9999999866 PP

>> PF06803  Protein of unknown function (DUF1232)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.0   0.2      0.12   4.4e+02      28      38 ..     138     148 ..     137     150 .. 0.82

  Alignments for each domain:
  == domain 1    score: 3.0 bits;  conditional E-value: 0.12
     PF06803  28 lGylDDlavla 38 
                 +G++DD+++  
  BAF53991.1 138 FGQVDDFVLGL 148
                 6******9865 PP

>> PF12399  Branched-chain amino acid ATP-binding cassette transporter
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.0      0.23   8.1e+02       5      15 ..     119     129 ..     119     130 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.23
     PF12399   5 eGtPeEvrndP 15 
                 eGtP  + +d 
  BAF53991.1 119 EGTPSIILADR 129
                 8****999995 PP

>> PF09042  Titin Z
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.0      0.23     8e+02      18      31 ..      98     111 ..      98     113 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.23
     PF09042  18 aAvDkArereplsd 31 
                 +AvD++re  ++++
  BAF53991.1  98 VAVDMPREGQRIPS 111
                 8******9777765 PP

>> PF09732  Cactus-binding C-terminus of cactin protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.23   8.2e+02      30      86 ..      23      79 ..      15     102 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.23
     PF09732 30 ydsdnpPPkivqgYkFnifYpdLidkskapkykieklednedtvllkfsagkpYedi 86
                 +++++  k+v    F++  p  ++++  +  ki+++ d++++ ++ +++    +d+
  BAF53991.1 23 LSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFEHHDV 79
                567778889999999999999999*9999999****999999999998876666655 PP

>> PF02067  Metallothionein family 5
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.5   0.1      0.28     1e+03       1       8 [.      40      47 ..      40      57 .. 0.74

  Alignments for each domain:
  == domain 1    score: 2.5 bits;  conditional E-value: 0.28
     PF02067  1 mvCkGCGs 8 
                m C+GC  
  BAF53991.1 40 MLCPGCVN 47
                99****65 PP

>> PF08274  PhnA Zinc-Ribbon
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.2      0.37   1.3e+03      19      25 ..      39      45 ..      36      47 .. 0.86

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.37
     PF08274 19 llvCpeC 25
                +++Cp C
  BAF53991.1 39 QMLCPGC 45
                699**99 PP

>> PF00998  Viral RNA dependent RNA polymerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.8   0.0      0.24   8.7e+02     384     466 ..      13      95 ..       5     110 .. 0.72

  Alignments for each domain:
  == domain 1    score: 0.8 bits;  conditional E-value: 0.24
                 SCES----TTTTTTSHHHHHTHHHHHHHHHHHHT-.S-EEEE----EEEEHHHHH---GGGT-BS--HHHHHHHHHHHH---- CS
     PF00998 384 pvkswlgaigecglalaggvpvlqafyscllrqskskkvskekkgkeysviikrllglsagsrkseevseeaRvSfylafgit 466
                 +v++w++  g  +  l g+v+v++ f   +    ++   + +k ++ ++ + +++ gl+    + + +++ea   f+ +fgi+
  BAF53991.1  13 DVQEWVNHEGLSNEDLRGKVVVVEVFQMLCPGCVNHGVPQAQKIHRMIDESQVQVIGLHSVFEHHDVMTPEALKVFISEFGIK 95 
                 68899999999999999999888766555554455455667777777777777777776666666666777666677777765 PP

>> PF03734  L,D-transpeptidase catalytic domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.2   0.0      0.41   1.5e+03      92     112 ..      44      64 ..      24      89 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.2 bits;  conditional E-value: 0.41
                 ---EE-HHHHHHH-------- CS
     PF03734  92 GCvrlsnedakelyelvlvgt 112
                 GCv+   ++a+++ + +++ +
  BAF53991.1  44 GCVNHGVPQAQKIHRMIDESQ 64 
                 999999999999999988753 PP

>> PF10578  Seminal vesicle protein repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.5       1.3   4.5e+03       5       9 ..     137     141 ..     135     141 .. 0.87

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 1.3
     PF10578   5 SFGQv 9  
                 +FGQv
  BAF53991.1 137 QFGQV 141
                 8***8 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (160 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       337  (0.0282908); expected 238.2 (0.02)
Passed bias filter:                      330  (0.0277032); expected 238.2 (0.02)
Passed Vit filter:                        28  (0.00235057); expected 11.9 (0.001)
Passed Fwd filter:                        28  (0.00235057); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              28  [number of targets reported over threshold]
# CPU time: 0.17u 0.04s 00:00:00.21 Elapsed: 00:00:01
# Mc/sec: 2031.91
//