# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_8329.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       BAF54367.1  [L=185]
Description: cglu2 BAF54367.1 GIB00498CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.3e-58  201.2   0.0    1.5e-58  201.0   0.0    1.0  1  PF00343  Carbohydrate phosphorylase
  ------ inclusion threshold ------
         24    6.0   0.1         32    5.6   0.0    1.1  1  PF09506  Glucosylglycerol-phosphate phosphatase (Salt_tol_Pa
         77    5.7   0.0    1.1e+02    5.1   0.0    1.2  1  PF09931  Uncharacterized conserved protein (DUF2163)
    1.4e+02    3.2   0.0    1.7e+02    2.9   0.0    1.1  1  PF07888  Calcium binding and coiled-coil domain (CALCOCO1) l
    1.5e+02    5.1   0.0    2.5e+02    4.4   0.0    1.3  1  PF12327  FtsZ family, C-terminal domain
    1.9e+02    4.8   0.1    3.5e+02    3.9   0.1    1.5  1  PF07978  NIPSNAP
    2.5e+02    4.0   0.0    4.3e+02    3.2   0.0    1.4  1  PF00076  RNA recognition motif. (a.k.a. RRM, RBD, or RNP dom
    2.5e+02    3.9   0.3    4.1e+02    3.2   0.2    1.3  1  PF11087  Protein of unknown function (DUF2881)
    2.9e+02    3.7   0.0    6.3e+02    2.6   0.0    1.5  1  PF10559  Plug domain of Sec61p
    3.5e+02    3.5   0.0    6.6e+02    2.6   0.0    1.4  1  PF09042  Titin Z
    4.7e+02    3.5   0.2    1.1e+03    2.3   0.2    1.5  1  PF04567  RNA polymerase Rpb2, domain 5
    5.1e+02    2.8   1.0    9.9e+02    1.9   0.2    1.8  1  PF06568  Domain of unknown function (DUF1127)
      2e+03    1.5   0.3    3.7e+03    0.6   0.2    1.3  1  PF08106  Formaecin family


Domain and alignment annotation for each model:
>> PF00343  Carbohydrate phosphorylase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  201.0   0.0   1.9e-62   1.5e-58     540     713 .]       1     179 [.       1     179 [. 0.95

  Alignments for each domain:
  == domain 1    score: 201.0 bits;  conditional E-value: 1.9e-62
                 GGG-SEEE--------------HHHHH---EEE--B---HHHHHHH---TTST----BHHHHHHHHH----HHHHHHHSHHHHHHHHHHH---TTTTST CS
     PF00343 540 iPaadlseqistagteasGtsnmkfalnGaltiGtldGanveiaeevGeenlfifGarveeveklrkkgykekeyyekdkrleevleqiesgafspedk 638
                 +Pa+d+seqistag+easGtsnmkf++nGalt+Gt+dGanvei ++vGeen +ifGarvee+ +lr++ y++ e ye+ + l+++l+++++g+ +++++
  BAF54367.1   1 MPASDVSEQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIVDSVGEENAYIFGARVEELPALRES-YQPYELYETVPGLKRALDALDNGTLNDNNS 98 
                 6*****************************************************************99.****************************** PP

                 TTTHHHHHH......HHHC-TT-HHHHHHHHHHHHHHHHHHHT.SHHHHHHHHHHHHHT----SHHHHHHHHHHHTTTS-- CS
     PF00343 639 defkdllds.....llqagdeylvladfesyvdaqekvdelyk.drekWtkksilniaasgkfssdrtikeyakeiWeiee 713
                   f dl +s        a+d+y vl df+ y ++++++ ++y  d+  W++++ +ni++sg fssdrti++ya+eiW++++
  BAF54367.1  99 GLFYDLKHSlihgyGKDASDTYYVLGDFADYRETRDRMAADYAsDPLGWARMAWINICESGRFSSDRTIRDYATEIWKLKP 179
                 *****99996555545679***********************736789******************************986 PP

>> PF09506  Glucosylglycerol-phosphate phosphatase (Salt_tol_Pase)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.6   0.0    0.0041        32     207     231 ..       7      31 ..       3      50 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.6 bits;  conditional E-value: 0.0041
     PF09506 207 keilklakkkdvGttdiqfllkGai 231
                 +e++ +a k+ +Gt +++f+++Ga+
  BAF54367.1   7 SEQISTAGKEASGTSNMKFMMNGAL 31 
                 699999*****************98 PP

>> PF09931  Uncharacterized conserved protein (DUF2163)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.015   1.1e+02      64     100 ..       8      44 ..       2      65 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.015
     PF09931  64 tglsvdnieiegalsdaaikeadleaGryDgarveiw 100
                   +s++  e+ g+ + + + + +l  G +Dga+vei 
  BAF54367.1   8 EQISTAGKEASGTSNMKFMMNGALTLGTMDGANVEIV 44 
                 5678889999999999*******************85 PP

>> PF07888  Calcium binding and coiled-coil domain (CALCOCO1) like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.0     0.023   1.7e+02      47      64 ..     164     181 ..     141     185 .] 0.71

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.023
     PF07888  47 aasvrDyetfvWalaPes 64 
                   ++rDy t +W l P  
  BAF54367.1 164 DRTIRDYATEIWKLKPTP 181
                 358***********9975 PP

>> PF12327  FtsZ family, C-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.033   2.5e+02      48      79 ..      30      61 ..      15      66 .. 0.89

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.033
                ------TTT---HHHHHS-TTS--B---EE-T CS
     PF12327 48 dltleEveevaeeireevdeeanvivGaside 79
                 ltl  ++ +  ei + v ee   i+Ga+++e
  BAF54367.1 30 ALTLGTMDGANVEIVDSVGEENAYIFGARVEE 61
                589999**********************9976 PP

>> PF07978  NIPSNAP
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.1     0.046   3.5e+02      56      71 ..     124     139 ..     110     151 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.046
     PF07978  56 dslaareayraalaad 71 
                  ++a+++++r+++aad
  BAF54367.1 124 GDFADYRETRDRMAAD 139
                 5889999999999998 PP

>> PF00076  RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.0     0.056   4.3e+02      46      67 ..      75      96 ..      74      98 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.056
                ESSHHHHHHHHHHHTTEEETTE CS
     PF00076 46 FeseedaekAlealngkklggr 67
                +e+    ++Al+al++ +l+++
  BAF54367.1 75 YETVPGLKRALDALDNGTLNDN 96
                7888999***********9987 PP

>> PF11087  Protein of unknown function (DUF2881)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.2   0.2     0.053   4.1e+02      25      50 ..       6      31 ..       3      33 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.2 bits;  conditional E-value: 0.053
     PF11087 25 vsrrsntAGvikaassGFssiLksAL 50
                vs +  tAG   +++s    +++ AL
  BAF54367.1  6 VSEQISTAGKEASGTSNMKFMMNGAL 31
                899999**********9999999998 PP

>> PF10559  Plug domain of Sec61p
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0     0.082   6.3e+02      20      28 ..     142     150 ..     138     150 .. 0.90

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.082
                 TCCHTTSHH CS
     PF10559  20 sDpfywlRa 28 
                 sDp++w R+
  BAF54367.1 142 SDPLGWARM 150
                 8******97 PP

>> PF09042  Titin Z
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.0     0.086   6.6e+02      28      38 ..       2      12 ..       1      15 [. 0.89

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.086
     PF09042 28 plsdarEeiat 38
                p+sd+ E+i+t
  BAF54367.1  2 PASDVSEQIST 12
                89*******99 PP

>> PF04567  RNA polymerase Rpb2, domain 5
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.2      0.14   1.1e+03      10      23 ..      41      54 ..      36      62 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.14
                EEEEECCCCCC--E CS
     PF04567 10 iEylDaeEeetamI 23
                +E++D   ee+a+I
  BAF54367.1 41 VEIVDSVGEENAYI 54
                9************9 PP

>> PF06568  Domain of unknown function (DUF1127)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.2      0.13   9.9e+02      18      30 ..      83      95 ..      81      95 .. 0.94

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.13
     PF06568 18 reLseLsDreLaD 30
                r+L +L++ +L+D
  BAF54367.1 83 RALDALDNGTLND 95
                8**********99 PP

>> PF08106  Formaecin family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.2      0.48   3.7e+03       9      12 ..     178     181 ..     177     182 .. 0.92

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.48
     PF08106   9 KPTP 12 
                 KPTP
  BAF54367.1 178 KPTP 181
                 9**9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (185 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       163  (0.0136837); expected 238.2 (0.02)
Passed bias filter:                      156  (0.013096); expected 238.2 (0.02)
Passed Vit filter:                        13  (0.00109134); expected 11.9 (0.001)
Passed Fwd filter:                        13  (0.00109134); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              13  [number of targets reported over threshold]
# CPU time: 0.15u 0.05s 00:00:00.20 Elapsed: 00:00:00
# Mc/sec: 2662.65
//