# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_8331.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       BAF54563.1  [L=140]
Description: cglu2 BAF54563.1 GIB00498CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    1.2e-19   73.3   0.0    1.5e-19   73.0   0.0    1.0  1  PF01451  Low molecular weight phosphotyrosine protein phosph
  ------ inclusion threshold ------
        2.9    9.8   0.0          4    9.3   0.0    1.2  1  PF11111  Centromere protein M (CENP-M)
          3   10.6   0.2        6.1    9.6   0.1    1.4  1  PF09040  Gastric H+/K+-ATPase, N terminal domain
        3.6    9.2   0.0        5.2    8.7   0.0    1.2  1  PF05681  Fumarate hydratase (Fumerase)
        6.7    9.4   0.1         11    8.7   0.1    1.4  1  PF01984  Double-stranded DNA-binding domain
         15    8.0   0.0         26    7.2   0.0    1.4  1  PF01272  Transcription elongation factor, GreA/GreB, C-term
         19    7.6   0.1         35    6.8   0.0    1.4  1  PF04210  Tetrahydromethanopterin S-methyltransferase, subuni
         20    5.6   0.0         26    5.2   0.0    1.1  1  PF00972  Flavivirus RNA-directed RNA polymerase
         25    7.0   0.1         26    6.9   0.1    1.2  1  PF03853  YjeF-related protein N-terminus
         30    6.7   0.0         54    5.8   0.0    1.4  1  PF03808  Glycosyl transferase WecB/TagA/CpsF family
         30    6.9   0.0    2.6e+02    3.9   0.0    2.1  2  PF09186  Domain of unknown function (DUF1949)
         58    5.9   0.0         83    5.4   0.0    1.2  1  PF07680  TQO small subunit DoxA
         87    5.9   0.0    2.7e+02    4.3   0.0    1.9  1  PF12431  Transcriptional regulator
    1.6e+02    4.7   0.9    4.4e+02    3.3   0.1    2.0  1  PF07498  Rho termination factor, N-terminal domain
    2.2e+02    4.0   0.1    4.7e+02    2.9   0.1    1.5  1  PF10346  Conidiation protein 6
    2.5e+02    4.5   0.0    3.8e+02    3.9   0.0    1.4  1  PF05304  Protein of unknown function (DUF728)
    3.1e+02    3.7   0.3    5.8e+02    2.9   0.2    1.4  1  PF05532  CsbD-like
    3.5e+03    1.6   3.7    7.1e+03    0.6   2.6    1.4  1  PF08249  Mastoparan protein


Domain and alignment annotation for each model:
>> PF01451  Low molecular weight phosphotyrosine protein phosphatase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   73.0   0.0   2.7e-23   1.5e-19       2     139 ..       6     134 ..       5     135 .. 0.91

  Alignments for each domain:
  == domain 1    score: 73.0 bits;  conditional E-value: 2.7e-23
                 EEEEEESS-TSHHHHHHHHHHHHHHHTEEEEEEESSTT--SS-THHHHHHHHHTTS-GTTSS--CGGHHHHHHSSEEEESSHHHHHHHHHC.TTSCCEE CS
     PF01451   2 kvlFvClgNicRSpmAeallrallekkvevesaGsethegesvdpravevlkehgidlsghrarqiteeelkefDliltmdgealrellevapearakv 100
                 +vlFvC+gN ++S+mA al+++ +++ +e++saG  t++g++ +++ +e  +e g d+s+  ++ i+ +  ++ D ++++++ea+ e++    + + + 
  BAF54563.1   6 SVLFVCVGNGGKSQMAAALAKKHAGDALEIHSAG--TKPGTKLNQQSLESIAEVGADMSQGFPKGIDLDLIRRVDRVIILGAEAQLEMPI-NANGTLQR 101
                 79********************************..***********************************************9999998.66778899 PP

                 EECCCCTTTSS-HHHCTS-HHHHHHHHHHHHHHHHHHHH CS
     PF01451 101 kllgdpakqkdiddpyygdedgfeevrdeieervkkllk 139
                 +l ++p  +++i+      ++  + vrd+i +rv++l++
  BAF54563.1 102 WLTDEPS-ERGIEG-----MERMRLVRDDIDARVQNLIA 134
                 9999999.455555.....46688999999999999986 PP

>> PF11111  Centromere protein M (CENP-M)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.3   0.0   0.00071         4      14      53 ..       3      42 ..       1      52 [. 0.90

  Alignments for each domain:
  == domain 1    score: 9.3 bits;  conditional E-value: 0.00071
     PF11111 14 ntatvLlvgteealkqqLaeailkeekefelkirlaksLP 53
                ++ +vL+v + +  k q+a a+ k++    l+i+ a + P
  BAF54563.1  3 DQPSVLFVCVGNGGKSQMAAALAKKHAGDALEIHSAGTKP 42
                7789******************************997766 PP

>> PF09040  Gastric H+/K+-ATPase, N terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    9.6   0.1    0.0011       6.1      11      32 ..      10      31 ..       7      32 .. 0.87

  Alignments for each domain:
  == domain 1    score: 9.6 bits;  conditional E-value: 0.0011
                CH---------SHCCHHHT--- CS
     PF09040 11 VELGpGPgGDmaAKmSKKKAGg 32
                V +G G    maA ++KK AG 
  BAF54563.1 10 VCVGNGGKSQMAAALAKKHAGD 31
                5678999999**********95 PP

>> PF05681  Fumarate hydratase (Fumerase)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.7   0.0   0.00093       5.2     178     226 ..       9      58 ..       4      66 .. 0.86

  Alignments for each domain:
  == domain 1    score: 8.7 bits;  conditional E-value: 0.00093
     PF05681 178 vvgvgiGgtsekaallakkallrpldern.pdprlaeleeellekinklg 226
                 +v vg Gg+s++aa+lakk   + l+ ++  ++  ++l ++ le+i ++g
  BAF54563.1   9 FVCVGNGGKSQMAAALAKKHAGDALEIHSaGTKPGTKLNQQSLESIAEVG 58 
                 689999**************999999998666888999999999998887 PP

>> PF01984  Double-stranded DNA-binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.7   0.1    0.0019        11      34      73 ..      95     138 ..      84     140 .] 0.84

  Alignments for each domain:
  == domain 1    score: 8.7 bits;  conditional E-value: 0.0019
                 CHHHHCCCB-HHHHHH....HHHHHHHHHHHHHHHHHHHHHHHH CS
     PF01984  34 keaiLrqiLepeAreR....LsrirlvkperAeavenqliqlaq 73 
                  +  L++ L++e  eR    ++r+rlv+ +   +v+n + +l q
  BAF54563.1  95 ANGTLQRWLTDEPSERgiegMERMRLVRDDIDARVQNLIAELTQ 138
                 567899999999999888889******************99988 PP

>> PF01272  Transcription elongation factor, GreA/GreB, C-term
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.0    0.0047        26      43      63 ..      17      37 ..      16      44 .. 0.88

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0047
                TS----TT---B---EEEE-- CS
     PF01272 43 eSPlGkaLlgkkvGDtvevka 63
                +S ++ aL +k++GD  e++ 
  BAF54563.1 17 KSQMAAALAKKHAGDALEIHS 37
                699**************9985 PP

>> PF04210  Tetrahydromethanopterin S-methyltransferase, subunit G
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.8   0.0    0.0064        35      22      38 ..     123     139 ..     112     140 .] 0.83

  Alignments for each domain:
  == domain 1    score: 6.8 bits;  conditional E-value: 0.0064
     PF04210  22 DeieekvefvngEvaqr 38 
                 D+i+ +v++  +E++q 
  BAF54563.1 123 DDIDARVQNLIAELTQN 139
                 9**************96 PP

>> PF00972  Flavivirus RNA-directed RNA polymerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0    0.0047        26     367     419 ..      70     126 ..      66     136 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.0047
                 -----------------------------------....------------------ CS
     PF00972 367 kvqlirlleaegvieaedvekvskkekkrveawle....ehgeerlkrmaisGddcv 419
                 +  lir ++   ++ ae + +++ + + ++++wl+    e g e ++rm +  dd+ 
  BAF54563.1  70 DLDLIRRVDRVIILGAEAQLEMPINANGTLQRWLTdepsERGIEGMERMRLVRDDID 126
                 678999999999999*999999************8222245777899**99999974 PP

>> PF03853  YjeF-related protein N-terminus
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.9   0.1    0.0048        26      37     108 ..      13      81 ..       2     136 .. 0.79

  Alignments for each domain:
  == domain 1    score: 6.9 bits;  conditional E-value: 0.0048
     PF03853  37 GpgnnGgdGlvaArhLaqegakvdvllleeeeklsedakkaleilkkaggkvveeepeedleeaispadlvi 108
                 G   nGg+  +aA+  +++  ++  ++    +++++ +++ le + ++g ++ +  p+  + + i ++d vi
  BAF54563.1  13 G---NGGKSQMAAALAKKHAGDALEIHSAGTKPGTKLNQQSLESIAEVGADMSQGFPKGIDLDLIRRVDRVI 81 
                 3...67777777766655555544456678889*****************9999988877766666555555 PP

>> PF03808  Glycosyl transferase WecB/TagA/CpsF family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.8   0.0    0.0098        54      55     104 ..      15      61 ..       4      66 .. 0.88

  Alignments for each domain:
  == domain 1    score: 5.8 bits;  conditional E-value: 0.0098
     PF03808  55 GakeevlekaaerlkarypglkivgvrdgyfkeeeeeaiieeInaskadl 104
                 G+k ++++++a++ + +  +++ +g+++g    + +++ +e+I++ +ad+
  BAF54563.1  15 GGKSQMAAALAKKHAGDALEIHSAGTKPG---TKLNQQSLESIAEVGADM 61 
                 89999999999999999999999999999...778999999999999986 PP

>> PF09186  Domain of unknown function (DUF1949)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.046   2.6e+02      32      51 ..      86     105 ..      84     105 .. 0.91
   2 ?    0.4   0.0      0.57   3.2e+03      44      55 ..     128     139 ..     121     140 .] 0.73

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.046
     PF09186  32 tltlavpeeeveafqaaLtd 51 
                 + +l++p +   ++q++Ltd
  BAF54563.1  86 EAQLEMPINANGTLQRWLTD 105
                 6799**************98 PP

  == domain 2    score: 0.4 bits;  conditional E-value: 0.57
     PF09186  44 afqaaLtdltsG 55 
                 ++q+ +++lt++
  BAF54563.1 128 RVQNLIAELTQN 139
                 567777777775 PP

>> PF07680  TQO small subunit DoxA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0     0.015        83      93     109 ..      80      97 ..      60     103 .. 0.86

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.015
     PF07680  93 vvpLGseatitlqlp.sl 109
                 v++LG+ea++ + ++ + 
  BAF54563.1  80 VIILGAEAQLEMPINaNG 97 
                 89**********998555 PP

>> PF12431  Transcriptional regulator
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.049   2.7e+02      23      28 ..      65      70 ..      55      70 .. 0.86

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.049
     PF12431 23 LPKGID 28
                 PKGID
  BAF54563.1 65 FPKGID 70
                6****9 PP

>> PF07498  Rho termination factor, N-terminal domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.1     0.079   4.4e+02      16      26 ..     109     119 ..     107     119 .. 0.93

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.079
     PF07498  16 elgienysrlr 26 
                 e+gie+  r+r
  BAF54563.1 109 ERGIEGMERMR 119
                 99********9 PP

>> PF10346  Conidiation protein 6
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.1     0.085   4.7e+02      23      32 ..      25      34 ..      23      37 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.085
     PF10346 23 AKqhAqqeLe 32
                AK+hA + Le
  BAF54563.1 25 AKKHAGDALE 34
                9******998 PP

>> PF05304  Protein of unknown function (DUF728)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.068   3.8e+02      86     102 ..     117     133 ..      79     134 .. 0.81

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.068
     PF05304  86 pkrllrddvdfGldqlf 102
                   rl+rdd+d  +++l+
  BAF54563.1 117 RMRLVRDDIDARVQNLI 133
                 569*******9998886 PP

>> PF05532  CsbD-like
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.9   0.2       0.1   5.8e+02      31      47 ..      16      32 ..      14      35 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.9 bits;  conditional E-value: 0.1
     PF05532 31 GkaeqlkGkaqekagda 47
                Gk + +++ a++ agda
  BAF54563.1 16 GKSQMAAALAKKHAGDA 32
                999999*********98 PP

>> PF08249  Mastoparan protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   2.6       1.3   7.1e+03       7      12 ..      22      27 ..      20      27 .. 0.93

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 1.3
                CCCCCC CS
     PF08249  7 AAlAKK 12
                AAlAKK
  BAF54563.1 22 AALAKK 27
                9****9 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (140 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       272  (0.0228341); expected 238.2 (0.02)
Passed bias filter:                      249  (0.0209033); expected 238.2 (0.02)
Passed Vit filter:                        19  (0.00159503); expected 11.9 (0.001)
Passed Fwd filter:                        19  (0.00159503); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              18  [number of targets reported over threshold]
# CPU time: 0.14u 0.04s 00:00:00.18 Elapsed: 00:00:00
# Mc/sec: 2158.90
//