# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_8334.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       BAF54902.1  [L=148]
Description: cglu2 BAF54902.1 GIB00498CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
  ------ inclusion threshold ------
        1.6   11.5   0.1        3.4   10.5   0.1    1.5  1  PF08951  Enterocin A Immunity
        5.3    8.0   0.8        9.4    7.2   0.5    1.5  1  PF06782  Uncharacterised protein family (UPF0236)
        9.6    8.6   0.1         19    7.6   0.1    1.5  1  PF11520  Chromatin protein Cren7
         10    8.0   0.0         15    7.4   0.0    1.4  1  PF04250  Protein of unknown function (DUF429)
         19    7.6   0.0         53    6.1   0.0    1.8  1  PF06158  Phage tail protein E
         20    7.8   0.3         83    5.9   0.0    1.9  1  PF04823  Herpesvirus UL49 tegument protein
         27    7.5   0.2         61    6.3   0.1    1.6  1  PF10406  Transcription factor TFIID complex subunit 8 C-term
         32    7.0   0.0         52    6.4   0.0    1.4  1  PF08681  Protein of unknown function (DUF1778)
         34    6.7   0.1         69    5.7   0.1    1.5  1  PF05391  Lsm interaction motif
         52    6.5   0.1    1.4e+02    5.2   0.0    1.7  1  PF11417  Loader and inhibitor of phage G40P
         52    6.4   0.0    3.1e+02    3.9   0.0    2.1  1  PF01381  Helix-turn-helix
         60    5.9   0.0    1.1e+02    5.1   0.0    1.4  1  PF08828  Doublesex dimerisation domain
         75    5.9   0.0    1.1e+02    5.4   0.0    1.5  1  PF00237  Ribosomal protein L22p/L17e
         78    5.4   0.1    1.6e+02    4.5   0.0    1.5  1  PF07574  Nse1 non-SMC component of SMC5-6 complex
         79    4.5   0.0      1e+02    4.1   0.0    1.2  1  PF03377  Xanthomonas avirulence protein, Avr/PthA
    1.2e+02    5.5   0.2    1.7e+02    5.0   0.1    1.3  1  PF07762  Protein of unknown function (DUF1618)
    1.3e+02    4.9   0.0      2e+02    4.3   0.0    1.4  1  PF00427  Phycobilisome Linker polypeptide
    1.5e+02    5.0   0.1    3.4e+02    3.9   0.1    1.6  1  PF09121  Tower
    1.9e+02    3.9   0.5      3e+02    3.3   0.4    1.3  1  PF03472  Autoinducer binding domain
      2e+02    4.9   3.9    3.7e+02    4.0   2.3    1.8  1  PF07336  Protein of unknown function (DUF1470)
    2.3e+02    3.6   0.1    2.8e+02    3.3   0.0    1.1  1  PF03317  ELF protein
    2.5e+02    4.1   0.0    6.8e+02    2.7   0.0    1.7  1  PF04627  Mitochondrial ATP synthase epsilon chain
    3.1e+02    3.5   0.0    5.1e+02    2.8   0.0    1.3  1  PF02260  FATC domain
    3.2e+02    3.7   0.2    9.3e+02    2.3   0.1    1.7  1  PF12434  Malate dehydrogenase enzyme
    4.6e+02    3.2   0.1    7.1e+02    2.6   0.1    1.4  1  PF05859  Mis12 protein
    5.2e+02    2.9   0.0    9.6e+02    2.1   0.0    1.4  1  PF09282  Mago binding
    6.5e+02    3.3   0.0    9.4e+02    2.8   0.0    1.3  1  PF10554  Ash protein family


Domain and alignment annotation for each model:
>> PF08951  Enterocin A Immunity
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.5   0.1   0.00092       3.4      19      40 ..     120     141 ..     114     145 .. 0.89

  Alignments for each domain:
  == domain 1    score: 10.5 bits;  conditional E-value: 0.00092
                 HCSGHHHHHHHHHHHHHHTSCC CS
     PF08951  19 inaneelrelLlkaakklekgk 40 
                 ++ ne +  l+++a+kk+e+gk
  BAF54902.1 120 PKSNEKINSLIQQAYKKIENGK 141
                 7899****************98 PP

>> PF06782  Uncharacterised protein family (UPF0236)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.2   0.5    0.0025       9.4     380     436 ..      78     138 ..      39     144 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.2 bits;  conditional E-value: 0.0025
     PF06782 380 sklalsWsreGlkamlrlraasingtslreveweekkel....vsvalaeerikeakrkvk 436
                 s ++++W re  + m  lr  +   +  re++   ++ l     s +  +  i++a +k++
  BAF54902.1  78 SPQGRAWHREHQRRMEDLRDQQLRDGTFRELRYAGRQALeappKSNEKINSLIQQAYKKIE 138
                 6689*********************************995543344444455666666654 PP

>> PF11520  Chromatin protein Cren7
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.6   0.1    0.0052        19      17      33 ..      66      82 ..      52      84 .. 0.78

  Alignments for each domain:
  == domain 1    score: 7.6 bits;  conditional E-value: 0.0052
     PF11520 17 eveLkPiKaWvLaPkGr 33
                ++ ++ +KaW+ +P+Gr
  BAF54902.1 66 DALVAEKKAWQQSPQGR 82
                5556679*********9 PP

>> PF04250  Protein of unknown function (DUF429)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    7.4   0.0    0.0041        15     152     185 ..      41      74 ..      10      94 .. 0.81

  Alignments for each domain:
  == domain 1    score: 7.4 bits;  conditional E-value: 0.0041
     PF04250 152 lgieaavellleayeergaasdDllDAlaaaltA 185
                 +++++++ +++e++ +r a  +D++DAl+a   A
  BAF54902.1  41 SMQKVLTRWSREGTTQRMATPKDIRDALVAEKKA 74 
                 3344488999******************996555 PP

>> PF06158  Phage tail protein E
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.1   0.0     0.014        53      28      53 ..      10      35 ..       6      70 .. 0.90

  Alignments for each domain:
  == domain 1    score: 6.1 bits;  conditional E-value: 0.014
     PF06158 28 eLRGlkLadvlqldvdalitlLpRit 53
                +L G +L ++ + +v+a++++Lp i 
  BAF54902.1 10 SLAGDRLPAITKENVEAWARVLPEIC 35
                7899999****************885 PP

>> PF04823  Herpesvirus UL49 tegument protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.022        83      64      83 ..     118     137 ..     108     145 .. 0.84

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.022
     PF04823  64 nkPrtneeLeklleaaviri 83 
                  +P++ne++++l+++a  +i
  BAF54902.1 118 APPKSNEKINSLIQQAYKKI 137
                 69*************99887 PP

>> PF10406  Transcription factor TFIID complex subunit 8 C-term
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.1     0.016        61      23      46 ..      55      78 ..      39      78 .. 0.87

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.016
     PF10406 23 vdevtdprriReklaeesrlaEea 46
                +++ + p+ iR +l+ e++  +++
  BAF54902.1 55 TQRMATPKDIRDALVAEKKAWQQS 78
                677889*************87765 PP

>> PF08681  Protein of unknown function (DUF1778)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.4   0.0     0.014        52      59      77 ..     114     132 ..      89     136 .. 0.88

  Alignments for each domain:
  == domain 1    score: 6.4 bits;  conditional E-value: 0.014
     PF08681  59 aaLdeppkpnerLkkalrr 77 
                 +aL++ppk ne+++ ++++
  BAF54902.1 114 QALEAPPKSNEKINSLIQQ 132
                 79************99974 PP

>> PF05391  Lsm interaction motif
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.1     0.019        69       6      13 ..     117     124 ..     114     125 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.019
     PF05391   6 takpkSND 13 
                 +a+pkSN+
  BAF54902.1 117 EAPPKSNE 124
                 79*****7 PP

>> PF11417  Loader and inhibitor of phage G40P
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.2   0.0     0.037   1.4e+02      21      42 ..      12      33 ..       7      47 .. 0.87

  Alignments for each domain:
  == domain 1    score: 5.2 bits;  conditional E-value: 0.037
                .-----ST----HHHHHHHHTT CS
     PF11417 21 ardlkPdDlkttvklWsrvLed 42
                a+d  P   k  v++W rvL +
  BAF54902.1 12 AGDRLPAITKENVEAWARVLPE 33
                677778899**********977 PP

>> PF01381  Helix-turn-helix
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.0     0.084   3.1e+02      23      34 ..     131     142 ..     124     147 .. 0.86

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.084
                 HHHHHHHHTTSS CS
     PF01381  23 rstisriEnGer 34 
                 ++++ +iEnG+ 
  BAF54902.1 131 QQAYKKIENGKG 142
                 899*******85 PP

>> PF08828  Doublesex dimerisation domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.1   0.0     0.029   1.1e+02      36      53 ..     128     145 ..     124     148 .] 0.85

  Alignments for each domain:
  == domain 1    score: 5.1 bits;  conditional E-value: 0.029
     PF08828  36 adieeAsrrIeEgklvvn 53 
                 + i++A ++Ie gk vv+
  BAF54902.1 128 SLIQQAYKKIENGKGVVH 145
                 5699**********9998 PP

>> PF00237  Ribosomal protein L22p/L17e
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.4   0.0      0.03   1.1e+02      26      60 ..     109     143 ..      40     147 .. 0.82

  Alignments for each domain:
  == domain 1    score: 5.4 bits;  conditional E-value: 0.03
     PF00237  26 eeAlaiLefvpkkaakivlklLksaeanaennkgl 60 
                 + A ++  + p k+ + +++l+++a ++ en kg+
  BAF54902.1 109 RYAGRQALEAPPKSNEKINSLIQQAYKKIENGKGV 143
                 3444444455999*****************99986 PP

>> PF07574  Nse1 non-SMC component of SMC5-6 complex
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.5   0.0     0.042   1.6e+02     153     180 ..      26      53 ..       6      60 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.5 bits;  conditional E-value: 0.042
     PF07574 153 adiaaltdtkeLkkseaeeLLqklvelk 180
                 a + +l++   L+ks ++++L+++++++
  BAF54902.1  26 AWARVLPEICVLSKSSMQKVLTRWSREG 53 
                 55677888889**************986 PP

>> PF03377  Xanthomonas avirulence protein, Avr/PthA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.0     0.027     1e+02     289     326 ..      23      60 ..       9      92 .. 0.52

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.027
     PF03377 289 aletvqrllpvlcqahgltpdqvvaiasndggkqalet 326
                  +e+  r+lp +c     + ++v++  s++g  q + t
  BAF54902.1  23 NVEAWARVLPEICVLSKSSMQKVLTRWSREGTTQRMAT 60 
                 22222222222222222222222222222222222222 PP

>> PF07762  Protein of unknown function (DUF1618)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.0   0.1     0.046   1.7e+02      76     103 ..      73     100 ..      33     126 .. 0.80

  Alignments for each domain:
  == domain 1    score: 5.0 bits;  conditional E-value: 0.046
     PF07762  76 ttWtlkidskeWekdaevdlaelwsdes 103
                 + W+ +++  +W+++++ ++++l  ++ 
  BAF54902.1  73 KAWQQSPQGRAWHREHQRRMEDLRDQQL 100
                 57888889999***********998876 PP

>> PF00427  Phycobilisome Linker polypeptide
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.3   0.0     0.054     2e+02       3      23 ..     119     139 ..     117     148 .] 0.82

  Alignments for each domain:
  == domain 1    score: 4.3 bits;  conditional E-value: 0.054
     PF00427   3 anaseeeleeviraaYrqvfg 23 
                 + +s+e+++++i++aY+++ +
  BAF54902.1 119 PPKSNEKINSLIQQAYKKIEN 139
                 567899***********9965 PP

>> PF09121  Tower
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.9   0.1     0.092   3.4e+02      24      35 ..      84      95 ..      80      98 .. 0.83

  Alignments for each domain:
  == domain 1    score: 3.9 bits;  conditional E-value: 0.092
     PF09121 24 yaeaqqkklEaL 35
                ++ + q+++E+L
  BAF54902.1 84 WHREHQRRMEDL 95
                68899******9 PP

>> PF03472  Autoinducer binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.4     0.081     3e+02      73     102 ..      74     103 ..      66     114 .. 0.89

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.081
                 ---CCCTSS.HSHHHHHHHHHHHH----E- CS
     PF03472  73 sWsdldlaaaaspearrvleeardfGlrsG 102
                  W++ ++ +a+ +e++r +e+ rd +lr+G
  BAF54902.1  74 AWQQSPQGRAWHREHQRRMEDLRDQQLRDG 103
                 6999999988889999*************9 PP

>> PF07336  Protein of unknown function (DUF1470)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.0   2.3       0.1   3.7e+02      29      67 ..      81     119 ..      45     136 .. 0.83

  Alignments for each domain:
  == domain 1    score: 4.0 bits;  conditional E-value: 0.1
                 HHHHTTT-HHHHHH---TT--.....--HHHHHHHHHHH CS
     PF07336  29 llaWlraaglvpagaaaalallaaaraLRealrrlfaaa 67 
                  +aW r++  + ++ ++++    + r+LR a r++++a 
  BAF54902.1  81 GRAWHREHQRRMEDLRDQQLRDGTFRELRYAGRQALEAP 119
                 579999999999999999988899999999999999986 PP

>> PF03317  ELF protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.3   0.0     0.075   2.8e+02     208     259 ..      90     141 ..      64     146 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.3 bits;  conditional E-value: 0.075
     PF03317 208 aayqdlrdneegsvffrdvvshnrdlleaesakrrwleverrilyekiekak 259
                    +dlrd++     fr+     r+ lea       ++   +  y+kie+ k
  BAF54902.1  90 RRMEDLRDQQLRDGTFRELRYAGRQALEAPPKSNEKINSLIQQAYKKIENGK 141
                 56789****999999**************999999999999999***99887 PP

>> PF04627  Mitochondrial ATP synthase epsilon chain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0      0.18   6.8e+02      22      49 .]     113     140 ..     110     140 .. 0.93

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.18
                 T------STTSSHHHCS---BEEE-B-- CS
     PF04627  22 RqaLKeelrvaAekraeievkytkwenG 49 
                 RqaL  + +++ + +  i+  y k+enG
  BAF54902.1 113 RQALEAPPKSNEKINSLIQQAYKKIENG 140
                 9********99999999**********9 PP

>> PF02260  FATC domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.14   5.1e+02       7      16 ..     124     133 ..     121     136 .. 0.86

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.14
     PF02260   7 qQVdrLIseA 16 
                 + ++ LI++A
  BAF54902.1 124 EKINSLIQQA 133
                 67899****9 PP

>> PF12434  Malate dehydrogenase enzyme
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.3   0.1      0.25   9.3e+02       7      13 ..      93      99 ..      90     102 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.3 bits;  conditional E-value: 0.25
     PF12434  7 edlKeQq 13
                edl++Qq
  BAF54902.1 93 EDLRDQQ 99
                8*****9 PP

>> PF05859  Mis12 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.1      0.19   7.1e+02      94     135 ..     100     141 ..      82     145 .. 0.82

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.19
     PF05859  94 lpedkvrlehqeklelekekleedaeldaeleqlraeLeeqk 135
                 l+++ +r+ ++ + ++ ++  +++++++  ++q+ +++e+ k
  BAF54902.1 100 LRDGTFRELRYAGRQALEAPPKSNEKINSLIQQAYKKIENGK 141
                 688889988888888888888999999999999999998765 PP

>> PF09282  Mago binding
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.1   0.0      0.26   9.6e+02      12      16 ..     102     106 ..      99     109 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.1 bits;  conditional E-value: 0.26
     PF09282  12 DGsfR 16 
                 DG+fR
  BAF54902.1 102 DGTFR 106
                 ****9 PP

>> PF10554  Ash protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.8   0.0      0.25   9.4e+02       8      45 ..       9      46 ..       3      86 .. 0.75

  Alignments for each domain:
  == domain 1    score: 2.8 bits;  conditional E-value: 0.25
     PF10554  8 KsgAgigapsitkapsdapaavfflrcralisyltavt 45
                Ks Ag + p itk++ +a a v    c+ ++s +++v+
  BAF54902.1  9 KSLAGDRLPAITKENVEAWARVLPEICVLSKSSMQKVL 46
                999**************999888878888877766665 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (148 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       519  (0.0435695); expected 238.2 (0.02)
Passed bias filter:                      400  (0.0335796); expected 238.2 (0.02)
Passed Vit filter:                        27  (0.00226662); expected 11.9 (0.001)
Passed Fwd filter:                        27  (0.00226662); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              27  [number of targets reported over threshold]
# CPU time: 0.17u 0.05s 00:00:00.22 Elapsed: 00:00:00
# Mc/sec: 1879.51
//