# hmmscan :: search sequence(s) against a profile HMM database
# HMMER 3.0b2 (June 2009); http://hmmer.org/
# Copyright (C) 2009 Howard Hughes Medical Institute.
# Freely distributed under the GNU General Public License (GPLv3).
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query sequence file:             /home/niguts/usr08/shisakam/FASTA/gib_8340.fasta
# target HMM database:             /home/niguts/usr08/shisakam/PFAM/ver24.0/Pfam-A.hmm
# sequence search space set to:    100000
# set reporting thresholds to:     GA cutoffs
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       BAF55454.1  [L=335]
Description: cglu2 BAF55454.1 GIB00498CH01 "hypothetical protein"
Scores for complete sequence (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Model    Description
    ------- ------ -----    ------- ------ -----   ---- --  -------- -----------
    2.4e-13   52.4   0.0      4e-13   51.7   0.0    1.3  1  PF00107  Zinc-binding dehydrogenase
    3.8e-05   26.0   0.2    0.00022   23.5   0.0    2.3  1  PF08240  Alcohol dehydrogenase GroES-like domain
     0.0068   18.6   0.2       0.01   18.0   0.1    1.3  1  PF01370  NAD dependent epimerase/dehydratase family
     0.0073   18.9   0.7      0.014   17.9   0.5    1.5  1  PF00106  short chain dehydrogenase
  ------ inclusion threshold ------
        0.1   14.9   0.5       0.17   14.2   0.3    1.4  1  PF08659  KR domain
        1.9   10.7   0.5          3   10.0   0.4    1.2  1  PF00208  Glutamate/Leucine/Phenylalanine/Valine dehydrogenas
        4.9    9.9   0.2         19    8.0   0.1    1.9  1  PF01488  Shikimate / quinate 5-dehydrogenase
        5.3    8.9   0.1        7.6    8.4   0.1    1.2  1  PF05368  NmrA-like family
        6.7    9.4   0.0         15    8.2   0.0    1.5  1  PF00702  haloacid dehalogenase-like hydrolase
         11    9.2   0.8         19    8.4   0.5    1.5  1  PF02670  1-deoxy-D-xylulose 5-phosphate reductoisomerase
         16    7.0   0.1         22    6.5   0.0    1.3  1  PF04321  RmlD substrate binding domain
         23    7.0   0.1         40    6.3   0.1    1.4  1  PF02558  Ketopantoate reductase PanE/ApbA
         26    6.2   0.0         34    5.9   0.0    1.2  1  PF02719  Polysaccharide biosynthesis protein
         29    7.0   0.0         71    5.7   0.0    1.6  1  PF03829  PTS system glucitol/sorbitol-specific IIA component
    1.2e+02    5.3   0.0    2.4e+02    4.4   0.0    1.4  1  PF02254  TrkA-N domain
    1.2e+02    5.9   0.2    4.4e+02    4.1   0.1    1.9  1  PF02629  CoA binding domain
    1.3e+02    4.9   0.0    3.6e+02    3.5   0.0    1.7  1  PF11713  Peptidase C80 family
    1.4e+02    4.6   0.0    2.4e+02    3.8   0.0    1.3  1  PF10635  DisA bacterial checkpoint controller linker region
    1.6e+02    4.5   0.0    3.7e+02    3.4   0.0    1.6  1  PF04688  Phage lysis protein, holin
    1.9e+02    4.5   0.1    5.2e+02    3.1   0.1    1.7  1  PF07012  Curlin associated repeat
      2e+02    4.2   0.1    6.3e+02    2.7   0.0    1.7  1  PF06399  GTP cyclohydrolase I feedback regulatory protein (G
    2.3e+02    3.3   0.2    3.9e+02    2.6   0.1    1.2  1  PF03668  P-loop ATPase protein family
    3.2e+02    2.3   0.0    5.3e+02    1.6   0.0    1.2  1  PF05830  Nodulation protein Z (NodZ)
    3.5e+02    3.6   0.1    6.5e+02    2.7   0.1    1.3  1  PF10580  Gap junction protein N-terminal region
      5e+02    1.4   0.1    1.8e+03   -0.4   0.0    1.5  1  PF00501  AMP-binding enzyme
    5.1e+02    2.9   0.1    1.1e+03    1.9   0.1    1.5  1  PF02831  gpW
    5.4e+02    2.5   0.0    1.7e+03    0.9   0.1    1.7  1  PF10516  SHNi-TPR
    5.5e+02    1.9   0.0    7.6e+02    1.4   0.0    1.2  1  PF06581  Protein of unknown function (DUF1135)
    5.9e+02    2.3   0.0      1e+03    1.5   0.0    1.3  1  PF06432  Phosphatidylinositol N-acetylglucosaminyltransferas
    6.1e+02    3.0   0.2    1.5e+03    1.8   0.1    1.6  1  PF07440  Caerin 1 protein
    6.9e+02    2.2   0.0    1.3e+03    1.4   0.0    1.4  1  PF03543  Yersinia/Haemophilus virulence surface antigen
    6.9e+02    1.9   0.0    1.2e+03    1.1   0.0    1.3  1  PF09533  Predicted lipoprotein of unknown function (DUF2380)
      8e+02    2.8   0.0    1.4e+03    2.0   0.0    1.3  1  PF06129  Chordopoxvirus G3 protein
    1.4e+03    3.0   0.0    3.6e+03    1.7   0.0    1.7  1  PF01581  FMRFamide related peptide family
    1.5e+03    1.2   0.0    2.4e+03    0.6   0.0    1.2  1  PF06658  Protein of unknown function (DUF1168)
    1.9e+03    1.3   0.3    4.2e+03    0.2   0.2    1.5  1  PF04649  Mycoplasma hyorhinis VlpA repeat
    2.9e+03    0.4   0.2    4.5e+03   -0.2   0.1    1.1  1  PF06978  Ribonucleases P/MRP protein subunit POP1


Domain and alignment annotation for each model:
>> PF00107  Zinc-binding dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   51.7   0.0   1.5e-16     4e-13       1     123 [.     167     287 ..     167     297 .. 0.91

  Alignments for each domain:
  == domain 1    score: 51.7 bits;  conditional E-value: 1.5e-16
                 ----HHHHHHHHH-.-EEEEEESSHHHHHHHHH----EEEETTTSTHHHHHHHHTCC--BSEEEEET-.HHHHHHHHTTS-----EEEE----EEEEEE CS
     PF00107   1 GvGlaavqlAkalG.arviavdsseeklelakelGadhvinskdedfvkaireltggkgvdvviecvgagatfeqalkllapgGrvvvvggtsganvef 98 
                 GvG++a+ l++ lG  +v ++ + e  +e++ +lGa ++i++ +   +++ r l +g     v+++vg  +t+  a++ ++ gG v+ +g++ g++ + 
  BAF55454.1 167 GVGSIALHLLNKLGyTTVAVTGRREAHAEYLTSLGASDIIDRAEL--SEKGRPLQKG-RWAGVVDSVG-SHTLVNAIAQTKWGGIVTACGMAQGPDLPG 261
                 9*************999999999*******************996..7999999999.9*********.****************************** PP

                 CHHHHHTTT--EEE--SSS.HHHHHH CS
     PF00107  99 dlrklllkektiqGsllgn.peelee 123
                  + +++l++++++G+   + p+el+ 
  BAF55454.1 262 TVLPFILRGVHLVGINSVDaPRELRR 287
                 ****************9999444433 PP

>> PF08240  Alcohol dehydrogenase GroES-like domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   23.5   0.0   8.3e-08   0.00022       2      62 ..      37      95 ..      36     103 .. 0.90

  Alignments for each domain:
  == domain 1    score: 23.5 bits;  conditional E-value: 8.3e-08
                TEEEEEEEEB---HHHHHHH--.CCCT--SSEE----BE-EEEEE----B------EEEE- CS
     PF08240  2 gevlvkvkaaGiCgsDlhivkgekelevklplilGhEivGiveevgegvkklkvGdrvvve 62
                g+vl++v + +++  D + +kg+k + +  pli+G ++vG+v e  +   ++  Gd+vv++
  BAF55454.1 37 GDVLIEVGWSSLNYKDAMALKGDKGVVRTVPLIPGIDVVGTVIESADP--RFGRGDEVVLN 95
                79****************************************995543..58999999986 PP

>> PF01370  NAD dependent epimerase/dehydratase family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   18.0   0.1   3.8e-06      0.01       1      57 [.     159     210 ..     159     243 .. 0.79

  Alignments for each domain:
  == domain 1    score: 18.0 bits;  conditional E-value: 3.8e-06
                 EEEE--------HHHHHHHHH-TEEE-EESSCSTGGGTCCHHCTEEEEB--TT-HHH CS
     PF01370   1 ilVtGgtGfiGsalveallekgyevvdnlirrtrseelaterlrvelvegdltdkda 57 
                 ilVtG tG +Gs  ++ l++ gy+ v ++++r++++++  +     l   d+ d+++
  BAF55454.1 159 ILVTGSTGGVGSIALHLLNKLGYTTV-AVTGRREAHAEYLT----SLGASDIIDRAE 210
                 8***********************88.77777776644333....344555555554 PP

>> PF00106  short chain dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   17.9   0.5   5.4e-06     0.014       3      92 ..     159     255 ..     157     262 .. 0.75

  Alignments for each domain:
  == domain 1    score: 17.9 bits;  conditional E-value: 5.4e-06
                 EEEE--------HHHHHHHHH..-EEEEEESSS..SHHHHHHH.......HHHHHHTSCEEEEEE.TTTTSHHHHHHHHHHHHHHS---SEEEE----T CS
     PF00106   3 vliTGGlgglGlalArwLvee.garhlvlvsrr.edapgaael.......iaelealgaevtvva.cDvadrdalaallaeirkelgpldgvvhaagvl 91 
                 +l+TG +gg+G  +A +L+++ g   +++++rr ++a+ ++ l       +ael ++g+  +  + + v d     +l+++i+    ++ g+v a g++
  BAF55454.1 159 ILVTGSTGGVGS-IALHLLNKlGYTTVAVTGRReAHAEYLTSLgasdiidRAELSEKGRPLQKGRwAGVVDSVGSHTLVNAIA--QTKWGGIVTACGMA 254
                 8**********6.777777777***********76666666667667777778888887777777666777777777887777..66777777777766 PP

                 T CS
     PF00106  92 d 92 
                 +
  BAF55454.1 255 Q 255
                 5 PP

>> PF08659  KR domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   14.2   0.3   6.2e-05      0.17       1      40 [.     157     195 ..     157     253 .. 0.85

  Alignments for each domain:
  == domain 1    score: 14.2 bits;  conditional E-value: 6.2e-05
     PF08659   1 GtyLvtGGlgglGlelarwLaergarhlvllsrsaapdee 40 
                 G  LvtG +gg+G  + + L + g +++++++r+ ++++e
  BAF55454.1 157 GEILVTGSTGGVGSIALHLLNKLGYTTVAVTGRR-EAHAE 195
                 568************9999999************.33333 PP

>> PF00208  Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   10.0   0.4    0.0011         3      11      62 ..     137     187 ..     130     193 .. 0.85

  Alignments for each domain:
  == domain 1    score: 10.0 bits;  conditional E-value: 0.0011
                 H---HHHHHHHHHH.TT--CCC-EEEEE--.--HHHHHHHHHHHCT-EEEEE- CS
     PF00208  11 glGvvyyveemlkklgldslegkrvaiqGs.Gnvgsyaaelltelgakvvavs 62 
                 g+ ++  v++++++ g++  e+ ++ + Gs G vgs a  ll++lg + vav 
  BAF55454.1 137 GFTAALSVNALVDQ-GIK-PEDGEILVTGStGGVGSIALHLLNKLGYTTVAVT 187
                 66667778888888.777.788899*************************995 PP

>> PF01488  Shikimate / quinate 5-dehydrogenase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.0   0.1     0.007        19      15      54 ..     159     199 ..     152     217 .. 0.73

  Alignments for each domain:
  == domain 1    score: 8.0 bits;  conditional E-value: 0.007
                 EEEE--.-----HHHHHHHH-.---EEEE--SSHHHHHHHHH CS
     PF01488  15 vlviGA.GemarlvakhLlek.gvkkiviaNRtaekakeLae 54 
                 +lv G  G+++  +a hLl+k g++ + +++R +++a+ L++
  BAF55454.1 159 ILVTGStGGVGS-IALHLLNKlGYTTVAVTGRREAHAEYLTS 199
                 677775255555.555555555***************99975 PP

>> PF05368  NmrA-like family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.1    0.0028       7.6       1      40 [.     159     200 ..     159     241 .. 0.81

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0028
                 EEESS----HHHHHHHHHHH---EEEEE-..S-----HHHHH CS
     PF05368   1 ilviGaTGqqGksvvraslkaghkvralv..Rdlkselaksl 40 
                 ilv+G+TG +G+   + + k g+++ a++  R+ + e ++sl
  BAF55454.1 159 ILVTGSTGGVGSIALHLLNKLGYTTVAVTgrREAHAEYLTSL 200
                 8**************************984344444444444 PP

>> PF00702  haloacid dehalogenase-like hydrolase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.2   0.0    0.0057        15     108     148 ..     172     206 ..     168     221 .. 0.73

  Alignments for each domain:
  == domain 1    score: 8.2 bits;  conditional E-value: 0.0057
                 HHHHHHHTTSEEEEEESSTHHHHHHHHHHTTHGGGSSEEEE CS
     PF00702 108 alraLkkaGikvvllTgdnrataeavlkitglaaefdfivd 148
                 al+ L+k+G+ +v++Tg   a+ae+      l +  + +++
  BAF55454.1 172 ALHLLNKLGYTTVAVTGRREAHAEY------LTSLGASDII 206
                 89**********************9......4444443333 PP

>> PF02670  1-deoxy-D-xylulose 5-phosphate reductoisomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    8.4   0.5    0.0072        19       1      35 [.     159     191 ..     159     256 .. 0.81

  Alignments for each domain:
  == domain 1    score: 8.4 bits;  conditional E-value: 0.0072
                 EEEE--------HHHHHHHHTTTTEEEEEEEESS- CS
     PF02670   1 vviLGsTGSIGtqtLdvieknpdkfevvalaagsn 35 
                 +++ GsTG +G+ +L++++k    ++ va+++ ++
  BAF55454.1 159 ILVTGSTGGVGSIALHLLNKLG--YTTVAVTGRRE 191
                 6899**************9998..88888887554 PP

>> PF04321  RmlD substrate binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.5   0.0    0.0083        22       2      34 ..     158     191 ..     157     242 .. 0.80

  Alignments for each domain:
  == domain 1    score: 6.5 bits;  conditional E-value: 0.0083
                 EEEEE--------HHHHHH----EEEEE-.-TTT CS
     PF04321   2 rilvtGanGqlGteLaralkeegvevval.dree 34 
                 +ilvtG++G +G+   + l++ g+++va+ +r+e
  BAF55454.1 158 EILVTGSTGGVGSIALHLLNKLGYTTVAVtGRRE 191
                 59**********************9999944443 PP

>> PF02558  Ketopantoate reductase PanE/ApbA
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    6.3   0.1     0.015        40       2      40 ..     160     201 ..     159     212 .. 0.79

  Alignments for each domain:
  == domain 1    score: 6.3 bits;  conditional E-value: 0.015
                 EEE--.-----HHHHHHTCHHHE.EEEE-S-H.HHHHHHH-- CS
     PF02558   2 ailGa.GaiGsllaakLakagad.vtlilrsr.rlealkkng 40 
                 ++ G+ G++Gs+  + L+k g+  v + +r++ ++e l + g
  BAF55454.1 160 LVTGStGGVGSIALHLLNKLGYTtVAVTGRREaHAEYLTSLG 201
                 566644*************77764888888888888876655 PP

>> PF02719  Polysaccharide biosynthesis protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.9   0.0     0.013        34       1      39 [.     159     197 ..     159     239 .. 0.90

  Alignments for each domain:
  == domain 1    score: 5.9 bits;  conditional E-value: 0.013
                 EEEE--------HHHHHHHHHB-SEEEEE-S-HHHHHHH CS
     PF02719   1 vlvtGagGSiGselvrqilkkkpkkiillersElklyei 39 
                 +lvtG++G +Gs  ++ + k   +++ +  r E +   +
  BAF55454.1 159 ILVTGSTGGVGSIALHLLNKLGYTTVAVTGRREAHAEYL 197
                 89***********99999999*******99999877655 PP

>> PF03829  PTS system glucitol/sorbitol-specific IIA component
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    5.7   0.0     0.026        71      70      95 ..     168     193 ..     153     203 .. 0.91

  Alignments for each domain:
  == domain 1    score: 5.7 bits;  conditional E-value: 0.026
     PF03829  70 VGevanknLreLGHitlkFdgakeae 95 
                 VG+ a + L++LG +t+  +g +ea+
  BAF55454.1 168 VGSIALHLLNKLGYTTVAVTGRREAH 193
                 9********************98875 PP

>> PF02254  TrkA-N domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.4   0.0     0.087   2.4e+02      59     114 ..     151     206 ..     134     207 .. 0.68

  Alignments for each domain:
  == domain 1    score: 4.4 bits;  conditional E-value: 0.087
                 TGTTESEEEE-SSSH.HHHHHHHHHHHHHTSTSEEEEE-SSGGGHHHHHH--TSEEE CS
     PF02254  59 giesadaviaatgdd.eanllavllarelnpkkkiiaraqdeehakllkkagadevi 114
                 gi+  d  i++tg+   +  +a++l+++l    ++ +  ++e+ha++l ++ga ++i
  BAF55454.1 151 GIKPEDGEILVTGSTgGVGSIALHLLNKLGY-TTVAVTGRREAHAEYLTSLGASDII 206
                 5555555566666663444445555554444.678888899999********99887 PP

>> PF02629  CoA binding domain
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    4.1   0.1      0.16   4.4e+02       2      35 ..     155     188 ..     154     195 .. 0.90

  Alignments for each domain:
  == domain 1    score: 4.1 bits;  conditional E-value: 0.16
                 TTEEEEEE---S-TTCCCHHHHHHHHEEEEEEEE CS
     PF02629   2 ketkviviGasglgiqllyhfkellkygikkvfg 35 
                 ++++++v G +g  + ++ h+ ++l+y +++v g
  BAF55454.1 155 EDGEILVTGSTGGVGSIALHLLNKLGYTTVAVTG 188
                 5789**************************9987 PP

>> PF11713  Peptidase C80 family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.5   0.0      0.13   3.6e+02      26      49 ..       3      26 ..       1      57 [. 0.81

  Alignments for each domain:
  == domain 1    score: 3.5 bits;  conditional E-value: 0.13
                HHSGGGEEEEEGGGGGG-EEEEE- CS
     PF11713 26 kKhpknsvviqldadgkyrvvygd 49
                +  p nsvv+ +d dg++  +y+d
  BAF55454.1  3 SEGPINSVVLTQDEDGNFSTAYQD 26
                56688***************9998 PP

>> PF10635  DisA bacterial checkpoint controller linker region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.8   0.0     0.089   2.4e+02      29      57 ..     294     322 ..     284     325 .. 0.84

  Alignments for each domain:
  == domain 1    score: 3.8 bits;  conditional E-value: 0.089
     PF10635  29 lsnLsalEledlvtlrdVveviqrlemvl 57 
                  ++L+++ l+d+ t+ dV  v q  e ++
  BAF55454.1 294 SEHLDTAVLDDMTTVIDVKDVAQAGEDLM 322
                 57899999**************9988765 PP

>> PF04688  Phage lysis protein, holin
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.4   0.0      0.14   3.7e+02       4      28 ..     122     146 ..     120     147 .. 0.90

  Alignments for each domain:
  == domain 1    score: 3.4 bits;  conditional E-value: 0.14
     PF04688   4 plpidEeqintllstvftivtalwa 28 
                 p++++ +q+  l+++ ft+++++ a
  BAF55454.1 122 PFNFSAQQVGALGTAGFTAALSVNA 146
                 899999**************99865 PP

>> PF07012  Curlin associated repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    3.1   0.1      0.19   5.2e+02       4      21 ..       8      25 ..       5      25 .. 0.91

  Alignments for each domain:
  == domain 1    score: 3.1 bits;  conditional E-value: 0.19
     PF07012  4 NsvditQyGdaNlaliaq 21
                Nsv +tQ+ d+N+++ +q
  BAF55454.1  8 NSVVLTQDEDGNFSTAYQ 25
                99************9998 PP

>> PF06399  GTP cyclohydrolase I feedback regulatory protein (GFRP)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.0      0.23   6.3e+02      54      71 ..     171     188 ..     167     193 .. 0.89

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.23
     PF06399  54 vvldklekiGyrvvsmtG 71 
                 + l+ l+k+Gy  v++tG
  BAF55454.1 171 IALHLLNKLGYTTVAVTG 188
                 78999************9 PP

>> PF03668  P-loop ATPase protein family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.6   0.1      0.14   3.9e+02       4      29 ..     159     184 ..     158     188 .. 0.92

  Alignments for each domain:
  == domain 1    score: 2.6 bits;  conditional E-value: 0.14
     PF03668   4 vivsGlsGaGksvalraledlGyyvv 29 
                 ++v+G +G   s+al+ l+ lGy  v
  BAF55454.1 159 ILVTGSTGGVGSIALHLLNKLGYTTV 184
                 79*********************876 PP

>> PF05830  Nodulation protein Z (NodZ)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.6   0.0       0.2   5.3e+02     237     269 ..     117     149 ..     107     155 .. 0.87

  Alignments for each domain:
  == domain 1    score: 1.6 bits;  conditional E-value: 0.2
                 TEE-------------------------HHHHH CS
     PF05830 237 dllavpkefradqaGplhsaelGveGgvsalve 269
                  ll +p +f a+q G l +a + +  +v alv+
  BAF55454.1 117 PLLHIPFNFSAQQVGALGTAGFTAALSVNALVD 149
                 5899***************************98 PP

>> PF10580  Gap junction protein N-terminal region
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.7   0.1      0.24   6.5e+02      25      30 ..     151     156 ..     147     157 .. 0.84

  Alignments for each domain:
  == domain 1    score: 2.7 bits;  conditional E-value: 0.24
     PF10580  25 GiKPEd 30 
                 GiKPEd
  BAF55454.1 151 GIKPED 156
                 9****9 PP

>> PF00501  AMP-binding enzyme
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.4   0.0      0.66   1.8e+03     262     310 ..     215     263 ..     210     282 .. 0.84

  Alignments for each domain:
  == domain 1    score: -0.4 bits;  conditional E-value: 0.66
                 ----THHHHHHHHHHCTTSEEEEEE--GGGSSESEEEECGHHH-SSC-- CS
     PF00501 262 geplspellrrlreafggipivngYGltEttvivtvslpgdeetkpgsi 310
                 g pl++  ++ + + +g  ++vn+  +t  ++ivt++   +    pg++
  BAF55454.1 215 GRPLQKGRWAGVVDSVGSHTLVNAIAQTKWGGIVTACGMAQGPDLPGTV 263
                 78999999999999999******************99988886555555 PP

>> PF02831  gpW
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.9   0.1      0.39   1.1e+03       1      21 [.     305     325 ..     305     331 .. 0.91

  Alignments for each domain:
  == domain 1    score: 1.9 bits;  conditional E-value: 0.39
     PF02831   1 MtkeeeLqkaraAlhdLlTGk 21 
                 Mt++   +++ +A  dL+ Gk
  BAF55454.1 305 MTTVIDVKDVAQAGEDLMAGK 325
                 8999999999**********9 PP

>> PF10516  SHNi-TPR
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.9   0.1      0.64   1.7e+03      13      23 ..      16      26 ..      16      28 .. 0.92

  Alignments for each domain:
  == domain 1    score: 0.9 bits;  conditional E-value: 0.64
     PF10516 13 EnEnFpqAveD 23
                E++nF++A +D
  BAF55454.1 16 EDGNFSTAYQD 26
                899*****999 PP

>> PF06581  Protein of unknown function (DUF1135)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.0      0.28   7.6e+02     198     229 ..     304     335 .]     276     335 .] 0.82

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.28
                 ----EEEE---TT----SSEEETT-------- CS
     PF06581 198 lmgtivmvqghrdcgedwfqpklnyrvpsrgh 229
                  m t++ v+   + ged +  kl  r   r h
  BAF55454.1 304 DMTTVIDVKDVAQAGEDLMAGKLHGRTAVRVH 335
                 499********************999988876 PP

>> PF06432  Phosphatidylinositol N-acetylglucosaminyltransferase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.5   0.0      0.37     1e+03       9      22 ..      22      35 ..      20      43 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.5 bits;  conditional E-value: 0.37
     PF06432  9 qsypDNYtDetFle 22
                 +y+D Y D++Fl 
  BAF55454.1 22 TAYQDTYSDPSFLG 35
                58**********96 PP

>> PF07440  Caerin 1 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.8   0.1      0.57   1.5e+03       7      14 ..     169     176 ..     167     177 .. 0.92

  Alignments for each domain:
  == domain 1    score: 1.8 bits;  conditional E-value: 0.57
     PF07440   7 GSVAKHlL 14 
                 GS+A HlL
  BAF55454.1 169 GSIALHLL 176
                 9******9 PP

>> PF03543  Yersinia/Haemophilus virulence surface antigen
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.4   0.0      0.47   1.3e+03      87     127 ..     203     243 ..     182     255 .. 0.88

  Alignments for each domain:
  == domain 1    score: 1.4 bits;  conditional E-value: 0.47
                 .HHHHH---EE-S--EEEE..----------HHHHHH---- CS
     PF03543  87 dtwlkeaglepseeelklgevagavsaenvsrllkaildtg 127
                 ++++++a l++++ +l+ g  ag v + +  +l++ai++t 
  BAF55454.1 203 SDIIDRAELSEKGRPLQKGRWAGVVDSVGSHTLVNAIAQTK 243
                 67899999999********9******************996 PP

>> PF09533  Predicted lipoprotein of unknown function (DUF2380)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.1   0.0      0.46   1.2e+03      82     115 ..      97     130 ..      77     139 .. 0.89

  Alignments for each domain:
  == domain 1    score: 1.1 bits;  conditional E-value: 0.46
     PF09533  82 pGrgprrnwgngqklprGarpvlvfpwngaperv 115
                  G g +r+ g +q+l+  ++p l  p+n+++++v
  BAF55454.1  97 AGLGENRHGGFTQRLKVPSEPLLHIPFNFSAQQV 130
                 58999*********************99988765 PP

>> PF06129  Chordopoxvirus G3 protein
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    2.0   0.0      0.53   1.4e+03      29      64 ..     274     309 ..     271     316 .. 0.88

  Alignments for each domain:
  == domain 1    score: 2.0 bits;  conditional E-value: 0.53
     PF06129  29 lavkelneenaikkqadeelpavletllftkkdkvv 64 
                 ++++++++ ++++++a++ l + l+t+++ +  +v+
  BAF55454.1 274 VGINSVDAPRELRRRAWALLSEHLDTAVLDDMTTVI 309
                 68999999********************99877665 PP

>> PF01581  FMRFamide related peptide family
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    1.7   0.0       1.3   3.6e+03       8      11 .]      85      88 ..      81      88 .. 0.66

  Alignments for each domain:
  == domain 1    score: 1.7 bits;  conditional E-value: 1.3
     PF01581  8 RFGR 11
                RFGR
  BAF55454.1 85 RFGR 88
                7776 PP

>> PF06658  Protein of unknown function (DUF1168)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.6   0.0      0.89   2.4e+03      26      40 ..     161     175 ..     154     179 .. 0.90

  Alignments for each domain:
  == domain 1    score: 0.6 bits;  conditional E-value: 0.89
     PF06658  26 VqGSSAGAGSgeFhv 40 
                 V+GS+ G GS  +h+
  BAF55454.1 161 VTGSTGGVGSIALHL 175
                 89********99996 PP

>> PF04649  Mycoplasma hyorhinis VlpA repeat
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?    0.2   0.2       1.6   4.2e+03       6      13 .]     128     135 ..     127     135 .. 0.87

  Alignments for each domain:
  == domain 1    score: 0.2 bits;  conditional E-value: 1.6
     PF04649   6 QQSEAlGT 13 
                 QQ  AlGT
  BAF55454.1 128 QQVGALGT 135
                 8888***9 PP

>> PF06978  Ribonucleases P/MRP protein subunit POP1
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 ?   -0.2   0.1       1.7   4.5e+03      32      39 ..     282     289 ..     279     293 .. 0.87

  Alignments for each domain:
  == domain 1    score: -0.2 bits;  conditional E-value: 1.7
     PF06978  32 pralRRRa 39 
                 pr+lRRRa
  BAF55454.1 282 PRELRRRA 289
                 9******8 PP



Internal pipeline statistics summary:
-------------------------------------
Query sequence(s):                         1  (335 residues)
Target model(s):                       11912  (2158902 nodes)
Passed MSV filter:                       275  (0.023086); expected 238.2 (0.02)
Passed bias filter:                      254  (0.021323); expected 238.2 (0.02)
Passed Vit filter:                        39  (0.00327401); expected 11.9 (0.001)
Passed Fwd filter:                        39  (0.00327401); expected 0.1 (1e-05)
Initial search space (Z):             100000  [as set by --Z on cmdline]
Domain search space  (domZ):              37  [number of targets reported over threshold]
# CPU time: 0.24u 0.05s 00:00:00.28 Elapsed: 00:00:01
# Mc/sec: 3013.47
//