hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_8315.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: BAF52967.1
Accession:      [none]
Description:    cglu2 BAF52967.1 GIB00498CH01 "hypothetical protein"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0035588  Type II DNA topoisomerase                      274.2      1e-85   1
0043464  ATPase domain of HSP90 chaperone/DNA topoiso   235.6    1.4e-67   1
0037015  ATPase domain of HSP90 chaperone/DNA topoiso   209.8    1.3e-60   1
0040104  Ribosomal protein S5 domain 2-like             211.0    1.9e-59   1
0042491  ATPase domain of HSP90 chaperone/DNA topoiso   201.7    2.1e-59   1
0037014  Ribosomal protein S5 domain 2-like             211.1    2.5e-59   1
0040105  ATPase domain of HSP90 chaperone/DNA topoiso   204.2    6.1e-59   1
0043463  Ribosomal protein S5 domain 2-like             199.9      9e-58   1
0042490  Ribosomal protein S5 domain 2-like             182.3    9.8e-56   1
0043462  ATPase domain of HSP90 chaperone/DNA topoiso   174.4    6.6e-52   1
0035364  ATPase domain of HSP90 chaperone/DNA topoiso   132.0      5e-39   1
0038465  ATPase domain of HSP90 chaperone/DNA topoiso   129.7      7e-37   1
0048223  ATPase domain of HSP90 chaperone/DNA topoiso   113.2    1.8e-33   1
0035784  ATPase domain of HSP90 chaperone/DNA topoiso    98.6    1.2e-28   1
0043038  ATPase domain of HSP90 chaperone/DNA topoiso    82.2    1.6e-24   1
0044566  ATPase domain of HSP90 chaperone/DNA topoiso    59.1    5.9e-17   1
0043939  ATPase domain of HSP90 chaperone/DNA topoiso    49.6    2.6e-14   1
0039624  ATPase domain of HSP90 chaperone/DNA topoiso    36.3    1.2e-09   1
0053133  ATPase domain of HSP90 chaperone/DNA topoiso    29.7    3.9e-08   1
0038146  ATPase domain of HSP90 chaperone/DNA topoiso    14.2    0.00082   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0037015    1/1       6   215 ..     1   219 []   209.8  1.3e-60
0043464    1/1       7   218 ..     1   213 []   235.6  1.4e-67
0035784    1/1       8   209 ..     1   213 []    98.6  1.2e-28
0042491    1/1       8   212 ..     1   239 []   201.7  2.1e-59
0035364    1/1       9   277 ..     1   218 []   132.0    5e-39
0040105    1/1      12   213 ..     1   212 []   204.2  6.1e-59
0044566    1/1      13   210 ..     1   211 []    59.1  5.9e-17
0053133    1/1      13   211 ..     1   213 []    29.7  3.9e-08
0043939    1/1      16   225 ..     1   225 []    49.6  2.6e-14
0048223    1/1      16   208 ..     1   219 []   113.2  1.8e-33
0039624    1/1      18   143 ..    41   190 .]    36.3  1.2e-09
0043038    1/1      18   274 ..     1   266 []    82.2  1.6e-24
0038465    1/1      32   209 ..     1   203 []   129.7    7e-37
0043462    1/1      33   219 ..     1   168 []   174.4  6.6e-52
0038146    1/1      38   138 ..    54   172 ..    14.2  0.00082
0042490    1/1     261   425 ..     1   161 []   182.3  9.8e-56
0043463    1/1     264   430 ..     1   167 []   199.9    9e-58
0037014    1/1     265   436 ..     1   172 []   211.1  2.5e-59
0040104    1/1     265   436 ..     1   172 []   211.0  1.9e-59
0035588    1/1     438   679 ..     1   243 [.   274.2    1e-85

Alignments of top-scoring domains:
0037015: domain 1 of 1, from 6 to 215: score 209.8, E = 1.3e-60
                   *->ldelledliavlkglelvlkrpgmlilvtgdatglyrvvqelldNAi
                       +++ ++ i +l+gle+v+krpgm+i++tg ++gl+++++e++dN++
  BAF52967.1     6    -HNYDASSITILEGLEAVRKRPGMYIGSTG-PRGLHHLIWEVVDNSV 50   

                   dhalaggavtisvtldgdgsisVeDdGrGippeileriferfyelvltvl
                   d+a+ag+a++++vtl +dg + V DdGrGip+++++  + + +++v+t+l
  BAF52967.1    51 DEAMAGHATKVEVTLLEDGGVQVVDDGRGIPVDMHPS-GAPTVQVVMTQL 99   

                   hagskfdddsykvsggghGlGlsivnalsellggtitrdgkvytqlferg
                   hag+kfd+dsy vsgg+hG+G+s+vnals++++++i  +gk+++q fe+ 
  BAF52967.1   100 HAGGKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGKHWYQNFEKS 149  

                   vpvaplkvvgstpggGttvtfrlpleiflettefeletllkrlrelafln
                   vp + ++  g++ g+Gtt++f+++ eif ettef++et+++rl+e+afln
  BAF52967.1   150 VPDELIE-GGNARGTGTTIRFWPDAEIF-ETTEFDFETISRRLQEMAFLN 197  

                   pgvkitlnderlglkefflyegrylaesiqvlialeevlerpgmyigst...gllrvvkelvdNAidaa
                      +y+a+si +l++le+v++rpgmyigst   gl+++++e+vdN++d+a
  BAF52967.1     7    NYDASSITILEGLEAVRKRPGMYIGSTgprGLHHLIWEVVDNSVDEA 53   

                   laggavrievtldddgsisVeDdGrGipvdilpkifepfveliltvlhag
                   +ag+a+++evtl +dg ++V+DdGrGipvd++p  + p+v++++t+lhag
  BAF52967.1    54 MAGHATKVEVTLLEDGGVQVVDDGRGIPVDMHP-SGAPTVQVVMTQLHAG 102  

                   skfddlsykvsgglhGlGlsvvnalsellggtvtrdgkvytqlfedgvpv
                   +kfd++sy vsgglhG+G+svvnals+++++ ++++gk+++q fe+ vp 
  BAF52967.1   103 GKFDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGKHWYQNFEKSVPD 152  

                   aplkvigetdapgtGttvtfkpplkifkttefeydtlakrlrelaflnpg
                   + ++      a+gtGtt++f+p+ +if+ttef+++t+++rl+e+afln+g
  BAF52967.1   153 ELIEGGN---ARGTGTTIRFWPDAEIFETTEFDFETISRRLQEMAFLNKG 199  

                   vkitlnderlelldfflyelelkaiaeklgielevdrlldilagslysnleivlrELisNAiDAla
                      ++++ i +  g+e++++r++++++++ +  l+++++E+++N++    
  BAF52967.1     8    YDASSITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSV---- 50   

                   klrlilltdeklageggeitirllpdkeeltltvsDnGiGitkedlin..
                           de++ag++++++++ll+d+    ++v+D+G+Gi+++ ++  +
  BAF52967.1    51 --------DEAMAGHATKVEVTLLEDG---GVQVVDDGRGIPVDMHPSga 89   

                   .....ifgtfatsgkkgfleylvdgsdvsliggfGlGlysvfaladkvtv
                    ++++++++++++gk++  +y v+g      g +G+G+++v+al+ +v+ 
  BAF52967.1    90 ptvqvVMTQLHAGGKFDSDSYAVSG------GLHGVGISVVNALSTRVEA 133  

                   ttrsdgeeavrwlsllggtitveeilgselgrGTtitltlpldkle....
                     + +g+++++ +++      +e    +++g+GTti+++++ +++e+++ 
  BAF52967.1   134 DIKLHGKHWYQNFEKSVPDELIEGG--NARGTGTTIRFWPDAEIFEttef 181  

                   .flellrllrllaklspfigfpilllgeylvedllvlsrleavrlrpdmyigllelaeekgivleleldellllv
                      y ++++ +l++leavr+rp+myig+++                    
  BAF52967.1     8    YDASSITILEGLEAVRKRPGMYIGSTG-------------------- 34   

                   lgdvegllqillelldNAidhalagpgairikvtldgdgvsieVeDnGrG
                      ++gl+++++e++dN++d+a+ag +a++++vtl +dg  ++V D+GrG
  BAF52967.1    35 ---PRGLHHLIWEVVDNSVDEAMAG-HATKVEVTLLEDG-GVQVVDDGRG 79   

                   IpveilekifepffeliltvlhaggkfdddsykvsgggtGlGlsivnals
                   Ipv++++  + p +++++t+lhaggkfd+dsy vsgg++G+G+s+vnals
  BAF52967.1    80 IPVDMHPS-GAPTVQVVMTQLHAGGKFDSDSYAVSGGLHGVGISVVNALS 128  

                   ellggtvevksggttftitlplgmpvasllvigdlkkgkdgTtvtflPdl
                   +++  +  +k  g+ +++ +    + ++ ++i++ +++ +gTt++f+Pd 
  BAF52967.1   129 TRV--EADIKLHGKHWYQNF---EKSVPDELIEGGNARGTGTTIRFWPDA 173  

                   eifetlefdldilslllkrlrelAflnpgvkivlnderldvkfqaeikvlldleavllaagedier.....laqvlreLvdNAidag..
                       + +i++l +leav++++g++i+++    l+++++e+vdN++d++++
  BAF52967.1     9    DASSITILEGLEAVRKRPGMYIGStgprgLHHLIWEVVDNSVDEAma 55   

                   ..agrievsle.dgglvlitVrDnGiGipeddlpr........lferfat
                    +a+++ev+l +dg    ++V D+G+Gip+d +p  + ++++++++++a+
  BAF52967.1    56 ghATKVEVTLLeDG---GVQVVDDGRGIPVDMHPSgaptvqvvMTQLHAG 102  

                   skissfddlsyivsiGgrGlGlasvralaelvivtrtadgkvatrlfsah
                   +k   fd+ sy vs+G++G+G+++v+al+++v+  ++ +gk++++ f + 
  BAF52967.1   103 GK---FDSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGKHWYQNFEKS 149  

                   ggtitvespaapgrGttvtltlpfynlpvrrkilkseklelarlldllre
                        +e+  a+g+Gtt++++       ++ +i+++++++++++ ++l+e
  BAF52967.1   150 VPDELIEGGNARGTGTTIRFW-------PDAEIFETTEFDFETISRRLQE 192  

                   yallnpgvpitltd....................................
                   +a+ln+g++itltd+ +++++ + ++ +++ +++++   ++++++++ ++
  BAF52967.1   193 MAFLNKGLTITLTDnratdeelelealaeqgetatelsldeidnetelve 242  

                   ..........egkllllllyegglleflkellgkkkievlgillavrlrpgliivsgdverlaqvlkeLldNAidaapagga
                       i +l++l+avr+rpg++i+s+ +++l+++++e++dN++d+a+ag+a
  BAF52967.1    12    SITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGHA 58   

                   vtirvtldddgsltVeDnGrGippedlprlferfytskltvllaggkfdd
                   ++++vtl +dg ++V D+GrGip++++p  + + +++++t+l+aggkfd+
  BAF52967.1    59 TKVEVTLLEDGGVQVVDDGRGIPVDMHPS-GAPTVQVVMTQLHAGGKFDS 107  

                   lsykvsggghGlGlsivnalsellggtitvdskvytqlfsdggpviplkv
                   +sy vsgg+hG+G+s+vnals++++++i +++k+++q f++++p   ++ 
  BAF52967.1   108 DSYAVSGGLHGVGISVVNALSTRVEADIKLHGKHWYQNFEKSVPDELIEG 157  

                   igelkspggGttvtvtlpleifettefeydtlldrlrelallnpgvkitl
                        ++g+Gtt++++++ eifettef+++t+ +rl+e+a+ln+g++itl
  BAF52967.1   158 GN---ARGTGTTIRFWPDAEIFETTEFDFETISRRLQEMAFLNKGLTITL 204  

                   tderlelldfflyegeaeklefqleverlldilvgslysnleivlrELisNAiDAlaklvyl
                      + +  +++++ +r+ ++++ + +  l++ + E ++N++         
  BAF52967.1    13    ITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSV--------- 50   

                   sltdgkltleggeiririlldkdnltltvsDnGiGitked.......lek
                        + +++g   +++++l +d+  + v+D+G+Gi+ + +   + +++ 
  BAF52967.1    51 -----DEAMAGHATKVEVTLLEDG-GVQVVDDGRGIPVDMhpsgaptVQV 94   

                   ifgtfatskkkgfleklsdladidliGgfGlGlysvfavadkvtvltrsa
                   +++++++++k+      ++++++ + G +G+G+++v+a++ +v+   +  
  BAF52967.1    95 VMTQLHAGGKF------DSDSYAVSGGLHGVGISVVNALSTRVEADIKLH 138  

                   gdeaalvlsllggsitvesepaeklgrGTtitl.....tlpldkleflel
                   g++++  ++++  +  +e     ++g+GTti++  +++++ +++++f  +
  BAF52967.1   139 GKHWYQNFEKSVPDELIEGGN--ARGTGTTIRFwpdaeIFETTEFDFETI 186  

                   lrllrliakysdfirfpillvgeklnlleklefqveverlldllikslysnleivlrELisNAiDAlaklvyl
                      +    ++++  +r   +++++ +++l++ ++E ++N++D        
  BAF52967.1    13    ITILEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVD-------- 51   

                   sltdekllgeggeilirilpdkdavtltirDnGiGmtkedlek.......
                       e ++g+  ++++++l d+    + + D+G G++ +  ++ + ++++
  BAF52967.1    52 ----EAMAGHATKVEVTLLEDG---GVQVVDDGRGIPVDMHPSgaptvqv 94   

                   ilgtiatsgkkgfleklddkadrsliGqfGlGlysvflvadkvtvisrsa
                   ++++++ +gk++      +++   + G +G+G+++v +++ +v+   +  
  BAF52967.1    95 VMTQLHAGGKFD------SDSYAVSGGLHGVGISVVNALSTRVEADIKLH 138  

                   gdeayvwesdgggsftieeievesklgrGTtitlhlpedale...fleel
                   g+ +y+ + +  +   ie    +++ g GTti++    +++e+++f  e 
  BAF52967.1   139 GKHWYQNFEKSVPDELIEG---GNARGTGTTIRFWPDAEIFEtteFDFET 185  

                   rlkelikkysdfigfpilllgekinelniqlevdglldilig.sdysrleqvlreLisNAiD.Alaklvllll
                      l+    v++ + ++ig + +  l+++++e ++N++D+A+a       
  BAF52967.1    16    LEGLEAVRKRPGMYIGsTGPRGLHHLIWEVVDNSVDeAMA------- 55   

                   tdgkklaeggeitirikldkdnvlltvtDnGiGiteedlkkifepfatsk
                         ++++++++++  d+    ++v D+G+Gi+ + ++    +     
  BAF52967.1    56 ------GHATKVEVTLLEDG---GVQVVDDGRGIPVDMHPSGAPTVQV-- 94   

                   tkgflealkaggkedlsdirligg.fGlGlasvflvadkvtvttrsngse
                      ++++l+aggk+d +++ + gg +G+G ++v++++ +v+   + +g +
  BAF52967.1    95 ---VMTQLHAGGKFDSDSYAVSGGlHGVGISVVNALSTRVEADIKLHGKH 141  

                   aalwvellggtitveseeglalgrGTtitltlpldale.....fleilrl
                   +++  e+  ++  +e   g a+g GTti+++ + + +e+++ +f +i r+
  BAF52967.1   142 WYQNFEKSVPDELIE--GGNARGTGTTIRFWPDAEIFEttefdFETISRR 189  

                   lellakyspfigfpilldgellnklkalwtrspsellkilelvrkpplpiivggdprrleqvlrnLvsNAidatakggviviv
                      l++le+vrk+p+++i+++ pr+l+++++++v+N++d++ +g+ ++++
  BAF52967.1    16    LEGLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGHATKVE 62   

                   vilvivisedgglvritVsDnGiGIppeelpk..........iferfats
                   v+l        ++  ++V+D+G+GIp++++p  + +++++++ +++++++
  BAF52967.1    63 VTL-------LEDGGVQVVDDGRGIPVDMHPSgaptvqvvmtQLHAGGKF 105  

                   kiksfsrliggtGlGlsivkllselhggeitvesepgggstftitlplgi
                   + +s++ ++g++G+G s+v++ls +++++i ++++            ++ 
  BAF52967.1   106 DSDSYAVSGGLHGVGISVVNALSTRVEADIKLHGK----------HWYQN 145  

                   lrgtepvlllkgttvevldlfvnfplrlkilkdikfeielllellrrlal
                    ++  p  l+ g+  + +++++ f+++ +i+++++f++e++ ++l+++a+
  BAF52967.1   146 FEKSVPDELIEGGNARGTGTTIRFWPDAEIFETTEFDFETISRRLQEMAF 195  

                   lnpgveitlidegkellllllledllpelpkegielvldldplllvlgdplrlrqvllnLlsNAikatpeggleslllp
                      g+e v++++++++  + p+ l+++++++++N+++ +++g+       
  BAF52967.1    18    GLEAVRKRPGMYIGSTGPRGLHHLIWEVVDNSVDEAMAGH-----AT 59   

                   titvslrldgdlvvisvsDnGiGipeell....erifepfyrtkssrsld
                   +++v+l +dg+   ++v D+G+Gip +++   ++ +   ++++++++++d
  BAF52967.1    60 KVEVTLLEDGG---VQVVDDGRGIPVDMHpsgaPTVQVVMTQLHAGGKFD 106  

                   sslrklgG..tGLGLaivkrivelhggtitvesepggGttftltLPllll
                   s+ + ++G  +G+G+++v+++  + + +i ++  + +             
  BAF52967.1   107 SDSYAVSGglHGVGISVVNALSTRVEADIKLHGKHWY------------- 143  

                   eslellplllaesiqfqveierlldilinadysrleqvlrELiqNAiDAgatrvei
                      + e ++  + +     +++ + + +l++ ++E+++N++D        
  BAF52967.1    18    GLEAVRKRPGM-----YIGSTGPRGLHHLIWEVVDNSVD-------- 51   

                   sledegklgengeitikiladkenvlitvtDnGiGiteedlpkiferfat
                       e ++g+ +++++++l d     ++v D+G+Gi+ + +p      + 
  BAF52967.1    52 ----EAMAGHATKVEVTLLED---GGVQVVDDGRGIPVDMHPS-----GA 89   

                   skkkeflellhagggtdlssrktiGg.fGlGlssvfsvsdevevttktng
                    +  +++++lhagg++d +s+ + Gg +G+G s+v+++s++ve   k +g
  BAF52967.1    90 PTVQVVMTQLHAGGKFDSDSYAVSGGlHGVGISVVNALSTRVEADIKLHG 139  

                   deakkivedhggtitveiplgse.lgkGTtvtltlpednleyleparlkf
                      k+++++++++++ e+++g +++g+GTt++++++ +++e +e+++ + 
  BAF52967.1   140 ---KHWYQNFEKSVPDELIEGGNaRGTGTTIRFWPDAEIFETTEFDFETI 186  

                   lks.kyaeflnlpilillldlslpelefke................liel
                     + + + fln +++i+l d +  ++e ++++ +++ +++++   ++i +
  BAF52967.1   187 SRRlQEMAFLNKGLTITLTDNRATDEELELealaeqgetatelsldEIDN 236  

                   lndlsllllvsvsdlleeellnllllvlglledlllllgedierlasvlkeLvdNAidag....atrievtle.dgglllieVsD
                      ++ +++l+++++e+vdN++d++++ +at++evtl +dgg   ++V D
  BAF52967.1    32    STGPRGLHHLIWEVVDNSVDEAmaghATKVEVTLLeDGG---VQVVD 75   

                   nGiGipeedlek........lferfatskisgfddlssrvtlGfrGlGla
                   +G+Gip+++++  + ++++++++++a++k   fd+ s+ v++G++G+G++
  BAF52967.1    76 DGRGIPVDMHPSgaptvqvvMTQLHAGGK---FDSDSYAVSGGLHGVGIS 122  

                   svkalsellggtitrdgkvatrlfldggglesllvpsapgkGttvtvrlp
                   +v+als+++   i+ +gk++++ f + ++ e ++  +a+g+Gtt++++++
  BAF52967.1   123 VVNALSTRVEADIKLHGKHWYQNFEKSVPDELIEGGNARGTGTTIRFWPD 172  

                   fynlpvrrkeflkslktellklldllrrlallnpgvritlrdegkelkll
                            e++++++++++++ ++l+++a+ln+g++itl+d++      
  BAF52967.1   173 --------AEIFETTEFDFETISRRLQEMAFLNKGLTITLTDNRA----- 209  

                   lllltlleggllefvlllyevveglahvvkelvdNAidaalagkatrievtleadgsieViDnGrG
                      + ++gl+h+++e+vdN++d+a+ag+at++evtl +dg ++V+D+GrG
  BAF52967.1    33    TGPRGLHHLIWEVVDNSVDEAMAGHATKVEVTLLEDGGVQVVDDGRG 79   

                   ipvdilpl......................ykvsgglhGvGlsvvnalse
                   ipvd++p  + ++++++++ ++  + + + y vsgglhGvG+svvnals+
  BAF52967.1    80 IPVDMHPSgaptvqvvmtqlhaggkfdsdsYAVSGGLHGVGISVVNALST 129  

                   llggtvtrdgkvylqlfsrgvpvaplevigetdaggtgttvtfkpdlkif
                   ++++ ++++gk+++q f+++vp + +e  +   a+gtgtt++f+pd +if
  BAF52967.1   130 RVEADIKLHGKHWYQNFEKSVPDELIEGGN---ARGTGTTIRFWPDAEIF 176  

                   kttefeldtladrlrelAflnpgvkitltderlgllelflyeglrqvllnLlsNAikatpegleegklelgtitvslrlegdlvvisvsD
                      l++ ++++++N+++ +++g      + ++++v+l  +g+   ++v D
  BAF52967.1    38    LHHLIWEVVDNSVDEAMAG------HATKVEVTLLEDGG---VQVVD 75   

                   nGiGippedlerifepffttkeaglsdlellnllllpglslaslvrdlgG
                   +G+Gip ++++         ++a + +  +++l+   +++ +s++ + g 
  BAF52967.1    76 DGRGIPVDMHP---------SGAPTVQVVMTQLHAGGKFDSDSYAVSGGL 116  

                   tGlGLaivrrivelhgGsitvevylnGlklfvkelnkykelllkeiiylegellllvlekdgirveval
                      +y+nGl+++v++ln++k+ +++ i+ +e+         d+++veva+
  BAF52967.1   261    HYPNGLEDYVQYLNRSKTNIHPSIVSFEA-------KGDDHEVEVAM 300  

                   qwsdgy.enivsfvNnipTteGGtHvdgfrdaltralneyak.....kkk
                   qw+++y+e++++f+N+i+T+eGGtH++gfr+alt+ +n+ya++++  k+k
  BAF52967.1   301 QWNSSYkESVHTFANTINTREGGTHEEGFRSALTSLMNRYARehkllKEK 350  

                   kvklkgddvregltavvsvkipnPqFegQTKekLgssevrflvesvvsek
                   +++l+gdd+regl av+sv++ +PqFegQTK+kLg++e++++v+ + +e+
  BAF52967.1   351 EANLTGDDCREGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEH 400  

                   llkfllenp.....ivekileaaeagGlkdyvelllkdkellleeviyiegelegirvevalqwsdsygefq
                      +Gl+dyv++l+++k+ +++ ++ +e   ++++veva+qw+ sy+e  
  BAF52967.1   264    NGLEDYVQYLNRSKTNIHPSIVSFEAKGDDHEVEVAMQWNSSYKES- 309  

                   ilsfvNniptteGGthvdgfrdaltralneyaekknllkk.kvklkgddv
                   +++f+N+i+t+eGGth++gfr+alt+ +n+ya++++llk+++++l+gdd+
  BAF52967.1   310 VHTFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEkEANLTGDDC 359  

                   regltavvsvkvpePqFegQTKekLgssevrflveslvsekllkfllenp
                   regl av+sv+v +PqFegQTK+kLg++e++ +v+++ +e++ ++l+ np
  BAF52967.1   360 REGLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANP 409  

                   eiaklilekallaakarlaarGlkdyvelllkdkellleepiyivgekdgirvevalqwsdgysenil
                      Gl+dyv++l+++k+ +++ ++ ++ + d+++veva+qw+ +y+e+++
  BAF52967.1   265    GLEDYVQYLNRSKTNIHPSIVSFEAKGDDHEVEVAMQWNSSYKESVH 311  

                   sfvNniptteGGthvdgfrdaltralneyakkkgllkkkkvkltgddvre
                   +f+N+i+t+eGGth++gfr+alt+ +n+ya++++llk+k+++ltgdd+re
  BAF52967.1   312 TFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEKEANLTGDDCRE 361  

                   gltavvsvkipnPqFegQTKekLgssevrflvesvvsekllkfllenpel
                   gl av+sv++ +PqFegQTK+kLg++e++++v+++ +e++ ++l+ np++
  BAF52967.1   362 GLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAE 411  

                   aklilekvllaakareaarkareltGlkdyvelllkdkellleepiyivgekdgirvevalqwsdgysenil
                      Gl+dyv++l+++k+ +++ ++ ++ + d+++veva+qw+ +y+e+++
  BAF52967.1   265    GLEDYVQYLNRSKTNIHPSIVSFEAKGDDHEVEVAMQWNSSYKESVH 311  

                   sfvNniptteGGthvngfrdaltralneyakklgllkkkkvkltgddvre
                   +f+N+i+t+eGGth++gfr+alt+ +n+ya++++llk+k+++ltgdd+re
  BAF52967.1   312 TFANTINTREGGTHEEGFRSALTSLMNRYAREHKLLKEKEANLTGDDCRE 361  

                   gltavvsvkipePqFegQTKekLgssevrflveslvsekllkfllenpel
                   gl av+sv++ +PqFegQTK+kLg++e++++v+++ +e++ ++l+ np++
  BAF52967.1   362 GLSAVISVRVGDPQFEGQTKTKLGNTEIKSFVQRMANEHIGHWLEANPAE 411  

                   aklilekvllaakareaarkareltrkslllgipllgkladagskdsekceLflvEGdSAggsakqgrsvvd
                      rks++    l+gklad++skd+ek+eL++vEGdSAggsak+gr   d
  BAF52967.1   438    RKSATDLGGLPGKLADCRSKDPEKSELYIVEGDSAGGSAKSGR---D 481  

                   rdfqavlPLrGkilNvrkasldkilkneeiqnlitalGlgigkeyfdlek
                     fqa+lPLrGkilNv+ka+ldk+lkn+e+q++italG+gi++e fd++k
  BAF52967.1   482 SMFQAILPLRGKILNVEKARLDKVLKNAEVQAIITALGTGIHDE-FDINK 530  

                   lrYgkiiimtDaDvDGshIktLlltfflrympsllelngflyiaipPlyk
                   lrY+ki++m+DaDvDG hI+tLllt+++r+mp+l+  +g++y+a+pPlyk
  BAF52967.1   531 LRYHKIVLMADADVDGQHIATLLLTLLFRFMPDLVA-EGHVYLAQPPLYK 579  

                   vtkgkkkkkviyfysleeleellkelgnl.....kkleikryKGLGemnp
                   +++ +  ++  ++ys+ee++e l+e      +++k+  i+ryKGLGemn+
  BAF52967.1   580 LKWQR--GEPGFAYSDEERDEQLNEGLAAgrkinKDDGIQRYKGLGEMNA 627  

                   eelkettmdletrlllfvtlddade.eliflalmgkkvedrkewleelvp
                   +el+ettmd+  r+l++v ++da +++++f++lmg++v  r+ +++++++
  BAF52967.1   628 SELWETTMDPTVRILRRVDITDAQRaDELFSILMGDDVVARRSFITRNAK 677  

                   gt