hmmpfam - search one or more sequences against HMM database
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/genome/SCOP/1.73/Scop1.73.bin
Sequence file:            /home/genome/FASTA/gib_8332.fasta
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query sequence: BAF54635.1
Accession:      [none]
Description:    cglu2 BAF54635.1 GIB00498CH01 "hypothetical protein"

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N 
-------- -----------                                    -----    ------- ---
0037940  YrdC/RibB                                      271.4    4.4e-86   1
0039907  YrdC/RibB                                      276.9    5.3e-86   1
0044038  YrdC/RibB                                      268.1    7.2e-79   1
0042499  YrdC/RibB                                      266.9    3.4e-78   1
0052081  RibA-like                                      221.0      2e-62   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
0037940    1/1       3   212 ..     1   209 []   271.4  4.4e-86
0044038    1/1       9   210 ..     1   202 []   268.1  7.2e-79
0039907    1/1      11   215 ..     1   216 []   276.9  5.3e-86
0042499    1/1      12   208 ..     1   219 []   266.9  3.4e-78
0052081    1/1     213   389 ..     1   174 []   221.0    2e-62

Alignments of top-scoring domains:
0037940: domain 1 of 1, from 3 to 212: score 271.4, E = 4.4e-86
                   *->llellglllssieeaiealraGklvlvvddedrenegdlvlaaelvt
                       +e+ + +l+s+eeai++++aGk v+vvddedrenegd+++aael+t
  BAF54635.1     3    EHEQAHSQLDSVEEAIADIAAGKAVVVVDDEDRENEGDIIFAAELAT 49   

                   pelinfmirhasGliclalteelaerlgLplmvedntsdlgtaftvsvda
                   pel++fm+r++sG+ic++lt + a+rl+Lp+m+++n++  gta+tv+vda
  BAF54635.1    50 PELVAFMVRYSSGYICAPLTAKDADRLDLPPMTAHNQDARGTAYTVTVDA 99   

                   aegvtTGisaadraltiraladpdakpedlvrPGHvfplrakeggvleRa
                     + tTGisa+dra+t+r+ladp+a   d++rPGHv+plra+eggvl+Ra
  BAF54635.1   100 N-TGTTGISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAREGGVLVRA 148  

                   GhtEaavdLarlaGlkpaavicellnd..dgtmarlpellefaeehglkl
                   GhtEaavdLar aGl+pa+vice++++++   mar+pel++f++eh+lkl
  BAF54635.1   149 GHTEAAVDLARAAGLRPAGVICEVVSEedPTGMARVPELRRFCDEHDLKL 198  

                   itiedlieyrlklellllsieeaiealraGklvlvvddedrenegdlvlaaelvtpelinf
                       +l+s+eeai++++aGk v+vvddedrenegd+++aael+tpel++f
  BAF54635.1     9    SQLDSVEEAIADIAAGKAVVVVDDEDRENEGDIIFAAELATPELVAF 55   

                   lvrlasGliclalteeraerlgLplmvednsddlgtaftvsvdaalgvtT
                   +vr++sG+ic++lt + a+rl+Lp+m+++n+d +gta+tv+vda  + tT
  BAF54635.1    56 MVRYSSGYICAPLTAKDADRLDLPPMTAHNQDARGTAYTVTVDAN-TGTT 104  

                   GisaadRaltirlladpnakpedlvrPGHvfplrardggvleRaGhteaa
                   Gisa dRa+t+rlladp+a   d++rPGHv+plrar+ggvl+RaGhteaa
  BAF54635.1   105 GISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAREGGVLVRAGHTEAA 154  

                   vdLarlaglkpaavicellneddgt.marldellefaeehglklitiedl
                   vdLar agl+pa+vice+++e+d+t mar++el++f++eh+lkli+ie+l
  BAF54635.1   155 VDLARAAGLRPAGVICEVVSEEDPTgMARVPELRRFCDEHDLKLISIEQL 204  

                   ieyrlkllsieeaiealraGklvlvvddedrenegdlvlaAelvtpelinfma
                      l+s+eeai++++aGk v+vvddedrenegd+++aAel+tpel++fm+
  BAF54635.1    11    LDSVEEAIADIAAGKAVVVVDDEDRENEGDIIFAAELATPELVAFMV 57   

                   rhasGliclalteelakrlgLplmvdlndssygtaftvsidaaelgvtTG
                   r++sG+ic++lt + a+rl+Lp+m+++n++ +gta+tv++da+  + tTG
  BAF54635.1    58 RYSSGYICAPLTAKDADRLDLPPMTAHNQDARGTAYTVTVDAN--TGTTG 105  

                   isaadRaltiraladpdakpedlvrPGHvfplrardggvleRaGhtEaav
                   isa dRa+t+r+ladp+a   d++rPGHv+plrar+ggvl+RaGhtEaav
  BAF54635.1   106 ISATDRAHTLRLLADPEADRTDFTRPGHVVPLRAREGGVLVRAGHTEAAV 155  

                   dLarlaglkpaaviceilnddeeaegealeedgtmarldellefaeehgl
                   dLar agl+pa+vice+++++++           mar++el++f++eh+l
  BAF54635.1   156 DLARAAGLRPAGVICEVVSEEDP---------TGMARVPELRRFCDEHDL 196  

                   klitiedlieyrlkleklvlsieeaiealraGklvlvvddedrenegdlviaAelvtpelinflvr
                      +s+eeai++++aGk v+vvddedrenegd+++aAel+tpel++f+vr
  BAF54635.1    12    DSVEEAIADIAAGKAVVVVDDEDRENEGDIIFAAELATPELVAFMVR 58   

                   hasGliclalteeraeklgLplmvdlnteasellelleelleddleddlg
                   ++sG+ic++lt + a++l+Lp+m+ +n+                  d +g
  BAF54635.1    59 YSSGYICAPLTAKDADRLDLPPMTAHNQ------------------DARG 90   

                   taftvsvdargvtTGisaadRaltiraladlveeeeldalpedfvrPGHv
                   ta+tv+vda + tTGisa dRa+t+r+lad+      +a   df+rPGHv
  BAF54635.1    91 TAYTVTVDANTGTTGISATDRAHTLRLLADP------EADRTDFTRPGHV 134  

                   fplrardggvleRaGhteaavdLarlagllpaavicelln..ddgsmarl
                   +plrar+ggvl+RaGhteaavdLar agl+pa+vice+++++d  +mar+
  BAF54635.1   135 VPLRAREGGVLVRAGHTEAAVDLARAAGLRPAGVICEVVSeeDPTGMARV 184  

                   dellefakehglklitiedlieyrslvervaeaelptlfgefrlvayrdlidglehlalvkGdi..dddep
                       lver  e+ lpt fg+f++v yr++idg+e +a+v Gd++ d++e+
  BAF54635.1   213    ILVERQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVasDGGEN 259  

                   vlvRvhsecltgDvlgslrcdcgwqLeaaleliaeegrGvlvylr.qegr
                   vlvRvhsecltgDv+gs+rcdcg+qL+++l+li+e+grGv+vy+r +egr
  BAF54635.1   260 VLVRVHSECLTGDVFGSRRCDCGQQLHESLRLIQEAGRGVVVYMRgHEGR 309  

                   gigllnklrayalqdegldtveanealgfpadlrdyglgaqiLrdlgvsk
                   gigll+klray+lqdeg+dtv+an+alg+pad+r++g+ aqiL dlgv++
  BAF54635.1   310 GIGLLAKLRAYQLQDEGADTVDANLALGLPADAREFGTSAQILYDLGVRS 359  

                   irlltnnprklvgLegfglevvervpllve