RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAF53115.1 cglu2 BAF53115.1 GIB00498CH01 "hypothetical protein"
         (383 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1bl3B [c.55.3] INTEGRASE                                               59   2e-11
1biuA [c.55.3] HIV-1 INTEGRASE                                         58   6e-11
1bisB [c.55.3] HIV-1 INTEGRASE                                         57   9e-11
1bi4C [c.55.3] INTEGRASE                                               54   7e-10
1c6vC [c.55.3] PROTEIN (SIV INTEGRASE)                                 54   1e-09
1bhlA [x.x.x] HIV-1 INTEGRASE                                          53   1e-09
2b4jB [x.x.x] INTEGRASE (IN)                                           53   2e-09
1c6vB [c.55.3] PROTEIN (SIV INTEGRASE)                                 53   2e-09
1bi4B [c.55.3] INTEGRASE                                               50   8e-09
1biuB [c.55.3] HIV-1 INTEGRASE                                         50   1e-08
1bizB [c.55.3] HIV-1 INTEGRASE                                         49   2e-08
1bi4A [c.55.3] INTEGRASE                                               49   2e-08
1c6vA [c.55.3] PROTEIN (SIV INTEGRASE)                                 46   2e-07
1b9fA [c.55.3] PROTEIN (INTEGRASE)                                     45   4e-07
1bizA [c.55.3] HIV-1 INTEGRASE                                         42   4e-06
1b9dA [c.55.3] PROTEIN (INTEGRASE)                                     39   2e-05
1bisA [c.55.3] HIV-1 INTEGRASE                                         38   3e-05
1cz9A [c.55.3] AVIAN SARCOMA VIRUS INTEGRASE                           37   1e-04
2b4jA [x.x.x] INTEGRASE (IN)                                           36   2e-04
1bibA [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]                   35   4e-04

>1bl3B [c.55.3] INTEGRASE
          Length = 143

 Score = 59.2 bits (142), Expect = 2e-11
 Identities = 16/142 (11%), Positives = 39/142 (27%), Gaps = 12/142 (8%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D      +  I   +  A+ +     + +         L++  G+ P +   +  
Sbjct: 3   GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHT-D 60

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F       +        R   ++           +T +
Sbjct: 61  NGSNFTSTTVKAACWWAGIKQEFVIESMNKELKKIIGQVRDQAEHL----------KTAV 110

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N++ +  +G  +  E
Sbjct: 111 QMAVFIHNHKRKGGIGGYSAGE 132


>1biuA [c.55.3] HIV-1 INTEGRASE
          Length = 147

 Score = 57.7 bits (138), Expect = 6e-11
 Identities = 14/142 (9%), Positives = 32/142 (22%), Gaps = 9/142 (6%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D      +  I   +  A+ +     + +          + +L            
Sbjct: 4   GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYF-LLKLAGRWPVKTVHTD 61

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F            +     +R             +T +
Sbjct: 62  NGSNFTSTTVKAACEWGGIKQEFGQGVIESMNKELKKIIGQVRDQAEHL-------KTAV 114

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N + +  +G  +  E
Sbjct: 115 QMAVFIHNKKRKGGIGGYSAGE 136


>1bisB [c.55.3] HIV-1 INTEGRASE
          Length = 154

 Score = 57.0 bits (136), Expect = 9e-11
 Identities = 20/142 (14%), Positives = 45/142 (31%), Gaps = 2/142 (1%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D      +  I   +  A+ +     + +         L++  G+          
Sbjct: 4   GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGR-WPVKTVHTD 61

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F  P++P  +G  E+ N+ L++   +        +T +
Sbjct: 62  NGSNFTSTTVKAACEWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAV 121

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N + +  +G  +  E
Sbjct: 122 QMAVFIHNKKRKGGIGGYSAGE 143


>1bi4C [c.55.3] INTEGRASE
          Length = 160

 Score = 54.0 bits (128), Expect = 7e-10
 Identities = 22/142 (15%), Positives = 45/142 (31%), Gaps = 2/142 (1%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D      +  I   +  A+ +     V        TA  + +L            
Sbjct: 10  GIWQLDCTHLEGKV-ILVAVHVASGYI-EAEVIPAETGQETAYFLLKLAGRWPVKTVHTD 67

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F  P++P  +G  E+ N+ L++   +        +T +
Sbjct: 68  NGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAV 127

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N++ +  +G  +  E
Sbjct: 128 QMAVFIHNHKRKGGIGGYSAGE 149


>1c6vC [c.55.3] PROTEIN (SIV INTEGRASE)
          Length = 143

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 23/142 (16%), Positives = 42/142 (29%), Gaps = 12/142 (8%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D     +   +   +  A+ F     +           L++  G+ P     +  
Sbjct: 5   GTWQMD-CTHLEGKIVIVAVHVASGFIEAEVIPQETGRQTALFLLKLAGRWPITHLHT-- 61

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
            D G   A  +            A           E  N  L+    +        +T +
Sbjct: 62  -DNGANFASQEVK--------MVAWWAGIEHTFGVEAMNHHLKNQIDRIREQANSVETIV 112

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                 +N++ R  +G  TPAE
Sbjct: 113 LMAVHCMNHKRRGGIGDMTPAE 134


>1bhlA [x.x.x] HIV-1 INTEGRASE
          Length = 133

 Score = 53.5 bits (127), Expect = 1e-09
 Identities = 11/142 (7%), Positives = 32/142 (22%), Gaps = 20/142 (14%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D  +  +   I   +  A+ +     + +         L++  G+ P +   +  
Sbjct: 3   GIWQLDTHLEGKV--ILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDN 60

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                                      +   +                           +
Sbjct: 61  GSNFTSTTVKA-------AWWAGIKQMNKELKKIIGQVRDQAEHLKTA-----------V 102

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N++ +  +G  +  E
Sbjct: 103 QMAVFIHNHKRKGGIGGYSAGE 124


>2b4jB [x.x.x] INTEGRASE (IN)
          Length = 145

 Score = 52.9 bits (125), Expect = 2e-09
 Identities = 19/144 (13%), Positives = 45/144 (31%), Gaps = 4/144 (2%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D     +   I   +  A+ +     + +         L++  G+ P +   +  
Sbjct: 3   GIWQLDC-THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHT-D 60

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F  P++P  +G  E+ N+ L++   +        +T +
Sbjct: 61  NGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAV 120

Query: 355 DQVADKLNNRPRKV--LGFRTPAE 376
                  N +      +      +
Sbjct: 121 QMAVFIHNKKRSAGERIVDIIATD 144


>1c6vB [c.55.3] PROTEIN (SIV INTEGRASE)
          Length = 142

 Score = 52.7 bits (125), Expect = 2e-09
 Identities = 20/142 (14%), Positives = 41/142 (28%), Gaps = 13/142 (9%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D     +   +   +  A+ F     +           L++  G+ P     +  
Sbjct: 5   GTWQMDCTHL-EGKIVIVAVHVASGFIEAEVIPQETGRQTALFLLKLAGRWPITHLHT-D 62

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K V    G+   F +  +   +   +                    +T +
Sbjct: 63  NGANFASQEVKMVAWWAGIEHTFGEAMNHHLKNQIDRIREQANSV-----------ETIV 111

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                 +N++ R  +G  TPAE
Sbjct: 112 LMAVHCMNHKRRGGIGDMTPAE 133


>1bi4B [c.55.3] INTEGRASE
          Length = 143

 Score = 50.4 bits (119), Expect = 8e-09
 Identities = 17/142 (11%), Positives = 38/142 (26%), Gaps = 12/142 (8%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D      +  I   +  A+ +     + +         L++  G+ P +   +  
Sbjct: 3   GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHT-D 60

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F       +        R   ++      M  F     
Sbjct: 61  NGSNFTSTTVKAACWWAGIKQEFLIESMNKELKKIIGQVRDQAEHLKTAVQMAVFI---- 116

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N++ +  +G  +  E
Sbjct: 117 ------HNHKRKGGIGGYSAGE 132


>1biuB [c.55.3] HIV-1 INTEGRASE
          Length = 146

 Score = 49.7 bits (117), Expect = 1e-08
 Identities = 15/142 (10%), Positives = 34/142 (23%), Gaps = 10/142 (7%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D     +   I   +  A+ +     +        TA  + +L            
Sbjct: 4   GIWQLDC-THLEGKVILVAVHVASGYIEAEVI-PAETGQETAYFLLKLAGRWPVKTVHTD 61

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F        +   +   ++               +T +
Sbjct: 62  NGSNFTSTTVKAACEWGGIKQEFGGVIESMNKELKKIIGQV--------RDQAEHLKTAV 113

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N + +  +G  +  E
Sbjct: 114 QMAVFIHNKKRKGGIGGYSAGE 135


>1bizB [c.55.3] HIV-1 INTEGRASE
          Length = 143

 Score = 49.4 bits (116), Expect = 2e-08
 Identities = 14/142 (9%), Positives = 34/142 (23%), Gaps = 14/142 (9%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D      +  I   +  A+ +     + +         L++ L            
Sbjct: 2   GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLK-LAGRWPVKTVHTD 59

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F   +   +            +   +        +T +
Sbjct: 60  NGSNFTSTTVKAACWWAGIKQEFGSMNKELK------------KIIGQVRDQAEHLKTAV 107

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N + +  +G  +  E
Sbjct: 108 QMAVFIHNKKRKGGIGGYSAGE 129


>1bi4A [c.55.3] INTEGRASE
          Length = 142

 Score = 49.2 bits (116), Expect = 2e-08
 Identities = 15/142 (10%), Positives = 34/142 (23%), Gaps = 12/142 (8%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D     +   I   +  A+ +     + +         L  +L            
Sbjct: 3   GIWQLDCTHL-EGKVILVAVHVASGYIEAEVIPAETGQETAYFL-LKLAGRWPVKTVHTD 60

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F       +        R   ++           +T +
Sbjct: 61  NGSNFTSTTVKAACWWAGIKQEFGIESMNKELKKIIGQVRDQAEHL----------KTAV 110

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N++ +  +G  +  E
Sbjct: 111 QMAVFIHNHKRKGGIGGYSAGE 132


>1c6vA [c.55.3] PROTEIN (SIV INTEGRASE)
          Length = 148

 Score = 45.7 bits (107), Expect = 2e-07
 Identities = 18/142 (12%), Positives = 35/142 (24%), Gaps = 13/142 (9%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D     +   +   +  A+ F     +         A  + +L            
Sbjct: 5   GTWQMDCTHL-EGKIVIVAVHVASGFIEAEVIPQETGRQT-ALFLLKLAGRWPITHLHTD 62

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K V    G+   F +  +   +   +                        
Sbjct: 63  NGANFASQEVKMVAWWAGIEHTFGEAMNHHLKNQIDRIREQANSVETIVL---------- 112

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                 +N++ R  +G  TPAE
Sbjct: 113 -MAVHCMNHKRRGGIGDMTPAE 133


>1b9fA [c.55.3] PROTEIN (INTEGRASE)
          Length = 151

 Score = 44.7 bits (104), Expect = 4e-07
 Identities = 18/148 (12%), Positives = 43/148 (29%), Gaps = 11/148 (7%)

Query: 236 HWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLTW 295
            W+ D     +   I   +  A+ +     + +             L        +++  
Sbjct: 5   IWQLDC-THLEGKVILVAVHVASGYIEAEVIPAETGQETA---YFLLKLAGRWPVKTVHT 60

Query: 296 DRGMELAGH--KEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTD 353
           D G        K      G+   FA P++P  +   E+ N+ L++   +        +T 
Sbjct: 61  DNGSNFTSTTVKAACWWAGIKQEFAIPYNPQSQAVIESMNKELKKIIGQVRDQAEHLKTA 120

Query: 354 LDQVADKLNNRPRK-----VLGFRTPAE 376
           +       N + +       +      +
Sbjct: 121 VQMAVFIHNKKRKGYSAGERIVDIIATD 148


>1bizA [c.55.3] HIV-1 INTEGRASE
          Length = 147

 Score = 41.5 bits (96), Expect = 4e-06
 Identities = 16/144 (11%), Positives = 39/144 (27%), Gaps = 14/144 (9%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D     +   I   +  A+ +     + +         L++          +++ 
Sbjct: 6   GIWQLDC-THLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLK---LAGRWPVKTVH 61

Query: 295 WDRGMELAGH--KEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQT 352
            D G        K      G+   F        +   +   ++  Q            +T
Sbjct: 62  TDNGSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAEHL--------KT 113

Query: 353 DLDQVADKLNNRPRKVLGFRTPAE 376
            +       N + +  +G  +  E
Sbjct: 114 AVQMAVFIHNKKRKGGIGGYSAGE 137


>1b9dA [c.55.3] PROTEIN (INTEGRASE)
          Length = 143

 Score = 39.1 bits (90), Expect = 2e-05
 Identities = 13/147 (8%), Positives = 36/147 (24%), Gaps = 16/147 (10%)

Query: 236 HWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLTW 295
            W+ D     +   I   +  A+ +     + +         L++  G+ P +   +   
Sbjct: 4   IWQLDCT-HLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHT-DN 61

Query: 296 DRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDLD 355
                    K      G+   F        +   +   ++  Q            +T + 
Sbjct: 62  GSNFTSTTVKAACWWAGIKQEFGGVIESMNKELKKIIGQVRDQAE--------HLKTAVQ 113

Query: 356 QVADKLNNRPRK------VLGFRTPAE 376
                 N + +        +      +
Sbjct: 114 MAVFIHNKKRKGGYSAGERIVDIIATD 140


>1bisA [c.55.3] HIV-1 INTEGRASE
          Length = 146

 Score = 38.5 bits (88), Expect = 3e-05
 Identities = 18/142 (12%), Positives = 42/142 (29%), Gaps = 10/142 (7%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D      +  I   +  A+ +     + +         L++  G+ P +   +  
Sbjct: 4   GIWQLDCTHLEGKV-ILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDN 62

Query: 295 WDRGMELAGHKEVTAGTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQTDL 354
                     K      G+   F  P     +   +   ++  Q    KT+++       
Sbjct: 63  G-SNFTSTTVKAACEWAGIKQEFGIPIESMNKELKKIIGQVRDQAEHLKTAVQ------- 114

Query: 355 DQVADKLNNRPRKVLGFRTPAE 376
                  N + +  +G  +  E
Sbjct: 115 -MAVFIHNKKRKGGIGGYSAGE 135


>1cz9A [c.55.3] AVIAN SARCOMA VIRUS INTEGRASE
          Length = 139

 Score = 36.6 bits (83), Expect = 1e-04
 Identities = 15/103 (14%), Positives = 28/103 (27%)

Query: 250 IATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLTWDRGMELAGHKEVTA 309
           +A  ++ A+    V       + +        +  L                   +E  A
Sbjct: 19  LAVTVDTASSAIVVTQHGRVTSVAAQHHWATAIAVLGRPKAIKTDNGSCFTSKSTREWLA 78

Query: 310 GTGMTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFSQT 352
             G+      P +   +   E  NRLL+          GF + 
Sbjct: 79  RWGIAHTTGIPGNSQGQAMVERANRLLKDKIRVLAEGDGFMKR 121


>2b4jA [x.x.x] INTEGRASE (IN)
          Length = 135

 Score = 36.2 bits (82), Expect = 2e-04
 Identities = 13/146 (8%), Positives = 32/146 (21%), Gaps = 19/146 (13%)

Query: 235 GHWEGDLVIGAQQSQIATVIERATRFTRVVHVESRHAASVTAGLIRELGQLPDQAKRSLT 294
           G W+ D     +   I   +  A+ +     + +         L++  G+ P +   +  
Sbjct: 4   GIWQLD-CTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHT-D 61

Query: 295 WDRGMELAGHKEVTAGTG----MTVCFADPHSPWQRGTNENTNRLLRQYFPKKTSMKGFS 350
                     K      G      +   +       G   +    L+             
Sbjct: 62  NGSNFTSTTVKAACWWAGIKQEFVIESMNKELKKIIGQVRDQAEHLKTAVQMA------- 114

Query: 351 QTDLDQVADKLNNRPRKVLGFRTPAE 376
                 V         + +      +
Sbjct: 115 ------VFIHNKKSAGERIVDIIATD 134


>1bibA [x.x.x] BIR A[MASQUE : MEMB(X) 45 / COIL(x) 0]
          Length = 294

 Score = 35.1 bits (80), Expect = 4e-04
 Identities = 18/127 (14%), Positives = 37/127 (29%), Gaps = 17/127 (13%)

Query: 68  REEISRGLSVG--LSYRAIARLTGRSASTISR-----------EVTRNRGRTAYRAIDAD 114
             ++   L+ G   S   +    G S + I++             T      +       
Sbjct: 6   PLKLIALLANGEFHSGEQLGETLGMSRAAINKHIQTLRDWGVDVFTVPGKGYSLPEPIQL 65

Query: 115 DRSWRQARRPQRCKLAKNPVLRGYVAARLREDWSPEQIAGRLKITYACTSRMQIS--HES 172
             + +   +     +A  PV+      +   D   E  +G   I     +    S    +
Sbjct: 66  LNAKQILGQLDGGSVAVLPVID--STNQYLLDRIGELKSGDACIAEYQQAGRGRSPFGAN 123

Query: 173 IYKSLFI 179
           +Y S+F 
Sbjct: 124 LYLSMFW 130


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.324    0.138    0.465 

Gapped
Lambda     K      H
   0.267   0.0504    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 15,712,504
Number of extensions: 918262
Number of successful extensions: 11704
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5726
Number of HSP's successfully gapped: 480
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)