RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAF54635.1 cglu2 BAF54635.1 GIB00498CH01 "hypothetical protein"
         (422 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

2bz0A [x.x.x] GTP CYCLOHYDROLASE II                                    92   4e-21
2bz1A [x.x.x] GTP CYCLOHYDROLASE II                                    90   2e-20
2bz0B [x.x.x] GTP CYCLOHYDROLASE II                                    85   4e-19
1aq0A [c.1.8] 1,3-1,4-BETA-GLUCANASE                                   47   8e-08

>2bz0A [x.x.x] GTP CYCLOHYDROLASE II
          Length = 168

 Score = 91.6 bits (226), Expect = 4e-21
 Identities = 80/176 (45%), Positives = 102/176 (57%), Gaps = 8/176 (4%)

Query: 213 ILVERQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGD 272
           + ++R  E  LPT +G F  VG+  +  G + VA+V G     G   VL RVHSECLTGD
Sbjct: 1   MQLKRVAEAKLPTPWGDFLMVGFEELATGHDHVALVYG--DISGHTPVLARVHSECLTGD 58

Query: 273 VFGSRRCDCGQQLHESLRLIQEAGRGVVVYMRGHEGRGIGLLAKLRAYQLQDEGADTVDA 332
              S RCDCG QL  +L  I E GRG+++Y R   GR IGLL K+RAY LQD+G DTV+ 
Sbjct: 59  ALFSLRCDCGFQLEAALTQIAEEGRGILLYHRQE-GRNIGLLNKIRAYALQDQGYDTVEG 117

Query: 333 NLALGLPADAREFGTSAQILYDLGVRSLNLISNNPAKKVGLEGHGISIASRTPIPV 388
                  AD R+F   A +   LGV  + L++NNP K   L   GI+I  R P+ V
Sbjct: 118 F-----AADERDFTLCADMFKLLGVNEVRLLTNNPKKVEILTEAGINIVERVPLIV 168


>2bz1A [x.x.x] GTP CYCLOHYDROLASE II
          Length = 170

 Score = 89.6 bits (221), Expect = 2e-20
 Identities = 85/174 (48%), Positives = 106/174 (60%), Gaps = 5/174 (2%)

Query: 215 VERQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGDVF 274
           ++R  E  LPT +G    VG+  +  G + VA+V GD+   G   VL RVHSECLTGD  
Sbjct: 2   LKRVAEAKLPTPWGD-FLVGFEELATGHDHVALVYGDI--SGHTPVLARVHSECLTGDAL 58

Query: 275 GSRRCDCGQQLHESLRLIQEAGRGVVVYMRGHEGRGIGLLAKLRAYQLQDEGADTVDANL 334
            S RCDCG QL  +L  I E GRG+++Y R  EGR IGLL K+RAY LQD+G DTV+AN 
Sbjct: 59  FSLRCDCGFQLEAALTQIAEEGRGILLYHR-QEGRNIGLLNKIRAYALQDQGYDTVEANH 117

Query: 335 ALGLPADAREFGTSAQILYDLGVRSLNLISNNPAKKVGLEGHGISIASRTPIPV 388
            LG  AD R+F   A     LGV  + L++NNP K   L   GI+I  R P+ V
Sbjct: 118 QLGFAADERDFTLCAD-FKLLGVNEVRLLTNNPKKVEILTEAGINIVERVPLIV 170


>2bz0B [x.x.x] GTP CYCLOHYDROLASE II
          Length = 173

 Score = 84.9 bits (209), Expect = 4e-19
 Identities = 86/176 (48%), Positives = 109/176 (61%), Gaps = 3/176 (1%)

Query: 213 ILVERQVETVLPTDFGTFKAVGYRSIIDGTELVAIVAGDVASDGGENVLVRVHSECLTGD 272
           + ++R  E  LPT +G F  VG+  +  G + VA+V GD+   G   VL RVHSECLTGD
Sbjct: 1   MQLKRVAEAKLPTPWGDFLMVGFEELATGHDHVALVYGDI--SGHTPVLARVHSECLTGD 58

Query: 273 VFGSRRCDCGQQLHESLRLIQEAGRGVVVYMRGHEGRGIGLLAKLRAYQLQDEGADTVDA 332
              S RCDCG QL  +L  I E GRG+++Y R  EGR IGLL K+RAY LQD+G DTV+A
Sbjct: 59  ALFSLRCDCGFQLEAALTQIAEEGRGILLYHR-QEGRNIGLLNKIRAYALQDQGYDTVEA 117

Query: 333 NLALGLPADAREFGTSAQILYDLGVRSLNLISNNPAKKVGLEGHGISIASRTPIPV 388
           N  LG  AD R+F   A +   LGV  + L++NNP K   L   GI+I  R P+ V
Sbjct: 118 NHQLGFAADERDFTLCADMFKLLGVNEVRLLTNNPKKVEILTEAGINIVERVPLIV 173


>1aq0A [c.1.8] 1,3-1,4-BETA-GLUCANASE
          Length = 306

 Score = 47.4 bits (111), Expect = 8e-08
 Identities = 11/52 (21%), Positives = 21/52 (40%)

Query: 340 ADAREFGTSAQILYDLGVRSLNLISNNPAKKVGLEGHGISIASRTPIPVAVH 391
            +     T   +    G++S+ L + N A    + G GI++    P  V  +
Sbjct: 10  NNLPAASTVVSMFKSNGIKSMRLYAPNQAALQAVGGTGINVVVGAPNDVLSN 61


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.319    0.135    0.388 

Gapped
Lambda     K      H
   0.267   0.0558    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 25,855,332
Number of extensions: 1641969
Number of successful extensions: 18228
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 8163
Number of HSP's successfully gapped: 397
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)