RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAF55227.1 cglu2 BAF55227.1 GIB00498CH01 "hypothetical protein"
         (106 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

3cb4D [x.x.x] GTP-BINDING PROTEIN LEPA                                 87   2e-20
2e1rA [x.x.x] ELONGATION FACTOR 2                                      77   3e-17
2c5zA [x.x.x] SET DOMAIN PROTEIN 2                                     73   3e-16
3degC [x.x.x] GTP-BINDING PROTEIN LEPA                                 65   9e-14
2brvX [x.x.x] HYALURONATE LYASE                                        54   2e-10
2bm1A [x.x.x] ELONGATION FACTOR G                                      53   5e-10
2bm0A [x.x.x] ELONGATION FACTOR G                                      51   2e-09

>3cb4D [x.x.x] GTP-BINDING PROTEIN LEPA
          Length = 525

 Score = 87.2 bits (215), Expect = 2e-20
 Identities = 35/62 (56%), Positives = 49/62 (79%)

Query: 3   AFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKC 62
           A + I HRDN+Q  G ++  K+K+LIPRQQF++ +QAAIG+ +IAR  ++ LRK+VLAKC
Sbjct: 464 ALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQLRKNVLAKC 523

Query: 63  YG 64
           YG
Sbjct: 524 YG 525


>2e1rA [x.x.x] ELONGATION FACTOR 2
          Length = 828

 Score = 76.6 bits (187), Expect = 3e-17
 Identities = 6/98 (6%), Positives = 27/98 (27%), Gaps = 5/98 (5%)

Query: 1   MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLA 60
           ++     +H D     G ++   ++       F +          +            + 
Sbjct: 672 VNILDVTLHADAIHRGGGQIIPTMRR-ATYAGFLLADPKIQEPVFLVEIQCPE---QAVG 727

Query: 61  KCYGGDISRKRKLLEKQKAGKKRMKNIGSVEVPQEAFV 98
             Y     ++ +++ +++     +  +    +P     
Sbjct: 728 GIYSVLNKKRGQVVSEEQRPGTPLFTV-KAYLPVNESF 764


>2c5zA [x.x.x] SET DOMAIN PROTEIN 2
          Length = 93

 Score = 73.3 bits (180), Expect = 3e-16
 Identities = 11/84 (13%), Positives = 27/84 (32%), Gaps = 8/84 (9%)

Query: 12 NAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGGDI---S 68
           +Q   +         +P    + P            ENI+   KD++      ++   S
Sbjct: 3  QSQRLEHNWNKFFASFVPNLIKKNPQSKQFD-----HENIKQCAKDIVKILTTKELKKDS 57

Query: 69 RKRKLLEKQKAGKKRMKNIGSVEV 92
           +    +  K  + ++K   +  +
Sbjct: 58 SRAPPDDLTKGKRHKVKEFINSYM 81


>3degC [x.x.x] GTP-BINDING PROTEIN LEPA
          Length = 545

 Score = 65.0 bits (157), Expect = 9e-14
 Identities = 27/53 (50%), Positives = 40/53 (75%)

Query: 2   DAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRAL 54
           DA + I HRDN+Q  G ++  K+K+LIPRQQF++ +QAAIG+ +IAR  ++ L
Sbjct: 493 DALALITHRDNSQNRGRELVEKMKDLIPRQQFDIAIQAAIGTHIIARSTVKQL 545


>2brvX [x.x.x] HYALURONATE LYASE
          Length = 714

 Score = 53.9 bits (128), Expect = 2e-10
 Identities = 7/102 (6%), Positives = 20/102 (19%), Gaps = 6/102 (5%)

Query: 2   DAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAK 61
           D    + + D + +            +P        +A   +  +         K   A 
Sbjct: 414 DGMFYLYNGDLSHYSDGYWPTVNPYKMPGTTETDAKRADSDTGKVLPSAFVGTSKLDDAN 473

Query: 62  CYGGDISRKRKLLEKQKAGKKRMKNIGSVEVPQEAFVAALST 103
                                  K+   ++       + +  
Sbjct: 474 ATA------TMDFTNWNQTLTAHKSWFMLKDKIAFLGSNIQN 509


>2bm1A [x.x.x] ELONGATION FACTOR G
          Length = 660

 Score = 52.8 bits (125), Expect = 5e-10
 Identities = 6/53 (11%), Positives = 15/53 (28%), Gaps = 4/53 (7%)

Query: 1   MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRA 53
           M      ++       G  + ++ +      +  VP+    G     R   + 
Sbjct: 589 MGDVIGDLNARR----GQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQG 637


>2bm0A [x.x.x] ELONGATION FACTOR G
          Length = 666

 Score = 50.8 bits (120), Expect = 2e-09
 Identities = 6/53 (11%), Positives = 15/53 (28%), Gaps = 4/53 (7%)

Query: 1   MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRA 53
           M      ++       G  + ++ +      +  VP+    G     R   + 
Sbjct: 594 MGDVIGDLNARR----GQILGMEPRGNAQVIRAFVPLAEMFGYATDLRSKTQG 642


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.312    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0521    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 22,068,151
Number of extensions: 1326380
Number of successful extensions: 13417
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 4878
Number of HSP's successfully gapped: 86
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 6.8 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.9 bits)