RPS-BLAST 2.2.16 [Mar-25-2007]

Database: 95pdb09Oct16_0000; 95pdb09Oct16_0001; 95pdb09Oct16_0002;
95pdb09Oct16_0003 
           66,450 sequences; 15,983,541 total letters

Searching..................................................done

Query= BAF55378.1 cglu2 BAF55378.1 GIB00498CH01 "hypothetical protein"
         (366 letters)



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

1axeA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE                          185   1e-49
1a71A [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE                    180   7e-48
1axgA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE                          173   7e-46
1d1sA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN     171   3e-45
1ee2A [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE                          170   6e-45
1d1tA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN     169   1e-44
1e3eA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II                163   9e-43
1cdoA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE                          161   3e-42
3cosA [x.x.x] ALCOHOL DEHYDROGENASE 4                                 159   1e-41
1e3eB [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II                158   2e-41
1e3lB [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II                154   3e-40
3cosD [x.x.x] ALCOHOL DEHYDROGENASE 4                                 150   6e-39
1e3lA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II                149   1e-38
2dfvA [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE                    143   6e-37
2b83A [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE                    141   3e-36
2dphA [x.x.x] FORMALDEHYDE DISMUTASE                                  141   4e-36
2dq4A [x.x.x] L-THREONINE 3-DEHYDROGENASE                             140   8e-36
2d8aA [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE                    135   2e-34
1bxzA [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE           134   4e-34
2cf5A [x.x.x] CINNAMYL ALCOHOL DEHYDROGENASE                          134   4e-34
1e3jA [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE             133   8e-34
2eerB [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE                     132   1e-33
2b5wA [x.x.x] GLUCOSE DEHYDROGENASE                                   125   2e-31
3b70A [x.x.x] ENOYL REDUCTASE                                         123   8e-31
2eerA [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE                     122   1e-30
2b5vA [x.x.x] GLUCOSE DEHYDROGENASE                                   120   5e-30
3b6zA [x.x.x] ENOYL REDUCTASE                                         119   1e-29
2eihA [x.x.x] ALCOHOL DEHYDROGENASE                                   116   1e-28
2cdaA [x.x.x] GLUCOSE DEHYDROGENASE                                   113   6e-28
2cdbC [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,          112   1e-27
2dm6A [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-                       110   7e-27
2cd9A [x.x.x] GLUCOSE DEHYDROGENASE                                   109   2e-26
2cdaB [x.x.x] GLUCOSE DEHYDROGENASE                                   109   2e-26
2cd9B [x.x.x] GLUCOSE DEHYDROGENASE                                   106   1e-25
2cdbA [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,          105   2e-25
2cdbB [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,          105   3e-25
2c0cA [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN              102   2e-24
2c0cB [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN               97   6e-23
2dg2A [x.x.x] APOLIPOPROTEIN A-I BINDING PROTEIN                       87   7e-20
1ch6A [x.x.x] GLUTAMATE DEHYDROGENASE                                  68   5e-14
2ebjA [x.x.x] PYRROLIDONE CARBOXYL PEPTIDASE                           63   1e-12
2a33B [x.x.x] HYPOTHETICAL PROTEIN                                     56   2e-10
1dl5B [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE    49   2e-08
1dlgA [d.68.2] UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE         49   2e-08
3c85C [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX          46   1e-07
2bhtD [x.x.x] CYSTEINE SYNTHASE B                                      46   2e-07
3c3pB [x.x.x] METHYLTRANSFERASE                                        45   3e-07
3eeqB [x.x.x] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G                45   3e-07
3c85B [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX          43   2e-06
2bhtB [x.x.x] CYSTEINE SYNTHASE B                                      41   6e-06
2eguA [x.x.x] CYSTEINE SYNTHASE                                        41   6e-06
2cqwA [x.x.x] SUSHI DOMAIN CONTAINING 2                                40   1e-05
3e8wA [x.x.x] TAKEOUT-LIKE PROTEIN 1                                   40   1e-05
3ci9B [x.x.x] HEAT SHOCK FACTOR-BINDING PROTEIN 1                      39   2e-05
3ci9A [x.x.x] HEAT SHOCK FACTOR-BINDING PROTEIN 1                      38   5e-05
2bryA [x.x.x] NEDD9 INTERACTING PROTEIN WITH CALPONIN HOMOLOGY         37   1e-04
3dwgB [x.x.x] CYSTEINE SYNTHASE B                                      34   0.001

>1axeA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
          Length = 374

 Score =  185 bits (471), Expect = 1e-49
 Identities = 98/369 (26%), Positives = 158/369 (42%), Gaps = 5/369 (1%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AA++   K+PF I  +++  P+  EV+++++A G+C +D  V      T LP    
Sbjct: 7   IKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAG 66

Query: 61  XXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                            +P DKV+  +   CG+C  C   +  +C K        T  DG
Sbjct: 67  HEAAGIVESIGEGVTTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDG 126

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILN 179
           ++ F+  G+ +  HF G STF+ YT V   SV K+D               STG G+ + 
Sbjct: 127 TSRFTCRGKPIH-HFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVK 185

Query: 180 SLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
              V  G T AVFG                      VDI+  +   AKE+GAT  +N +D
Sbjct: 186 VAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQD 245

Query: 240 ED-PAEKIKQLTGDG-VQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVG 297
              P +++     +G V F+ +  G +     A         V ++    P ++      
Sbjct: 246 YKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQNLSMNP 305

Query: 298 ASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADSASG 356
             L+ G  ++  I G    +D +P+LV  +   KF ++ L+    P E IN+ F    SG
Sbjct: 306 MLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSG 365

Query: 357 EVIKPIITF 365
           E I+ I+TF
Sbjct: 366 ESIRTILTF 374


>1a71A [b.35.1 - c.2.1] LIVER ALCOHOL DEHYDROGENASE
          Length = 374

 Score =  180 bits (456), Expect = 7e-48
 Identities = 98/369 (26%), Positives = 157/369 (42%), Gaps = 5/369 (1%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AA++   K+PF I  +++  P+  EV+++++A G+C +D  V      T LP    
Sbjct: 7   IKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAG 66

Query: 61  XXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                            +P DKV+  +   CG+C  C   +  +C K        T  DG
Sbjct: 67  HEAAGIVESIGEGVTTVRPGDKVIPLWTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDG 126

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILN 179
           ++ F+  G +   HF G STF+ YT V   SV K+D               STG G+ + 
Sbjct: 127 TSRFTCRG-KPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVK 185

Query: 180 SLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
              V  G T AVFG                      VDI+  +   AKE+GAT  +N +D
Sbjct: 186 VAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQD 245

Query: 240 ED-PAEKIKQLTGDG-VQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVG 297
              P +++     +G V F+ +  G +     A         V ++    P ++      
Sbjct: 246 YKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQNLSMNP 305

Query: 298 ASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADSASG 356
             L+ G  ++  I G    +D +P+LV  +   KF ++ L+    P E IN+ F    SG
Sbjct: 306 MLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSG 365

Query: 357 EVIKPIITF 365
           E I+ I+TF
Sbjct: 366 ESIRTILTF 374


>1axgA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
          Length = 374

 Score =  173 bits (439), Expect = 7e-46
 Identities = 98/369 (26%), Positives = 156/369 (42%), Gaps = 5/369 (1%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AA++   K+PF I  +++  P+  EV+++++A G+C +D  V      T LP    
Sbjct: 7   IKCKAAVLWEEKKPFSIEEVEVAPPKAHEVRIKMVATGICRSDDHVVSGTLVTPLPVIAG 66

Query: 61  XXXXXXXXXXXXXXXXXKPDDKV-VLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                            +P DKV  L    CG+C  C   +  +C K        T  DG
Sbjct: 67  HEAAGIVESIGEGVTTVRPGDKVIPLFTPQCGKCRVCKHPEGNFCLKNDLSMPRGTMQDG 126

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILN 179
           ++ F+  G +   HF G STF+ YT V   SV K+D               STG G+ + 
Sbjct: 127 TSRFTCRG-KPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLIGCGFSTGYGSAVK 185

Query: 180 SLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
              V  G T AVFG                      VDI+  +   AKE+GAT  +N +D
Sbjct: 186 VAKVTQGSTCAVFGLGGAGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQD 245

Query: 240 EDPAEK--IKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVG 297
                +  + +++  GV F+ +  G +     A         V ++    P ++      
Sbjct: 246 YKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVTALSCCQEAYGVSVIVGVPPDSQNLSMNP 305

Query: 298 ASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADSASG 356
             L+ G  ++  I G    +D +P+LV  +   KF ++ L+    P E IN+ F    SG
Sbjct: 306 MLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSG 365

Query: 357 EVIKPIITF 365
           E I+ I+TF
Sbjct: 366 ESIRTILTF 374


>1d1sA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
          Length = 373

 Score =  171 bits (433), Expect = 3e-45
 Identities = 92/370 (24%), Positives = 145/370 (39%), Gaps = 8/370 (2%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AA++   KQPF I  I++  P+  EV+++++A G+C TD  V      +  P    
Sbjct: 7   IKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFPVIVG 66

Query: 61  XXXXXXXXXXXXXXXXXKP-DDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                            KP D  + L    C +C  C       C    D        DG
Sbjct: 67  HEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCI-RSDITGRGVLADG 125

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILN 179
           +T F+  G+ V  HF   STF  YT V   SV K+DD              STG GA + 
Sbjct: 126 TTRFTCKGKPVH-HFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVK 184

Query: 180 SLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
           +  V+ G T  VFG                      +D++  + E A  +GAT  I+ KD
Sbjct: 185 TGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKD 244

Query: 240 EDPA-EKIKQLTGDGVQF--ALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEV 296
                 ++                  +  +    A      GT  +VG P P A+     
Sbjct: 245 STKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVP-PSAKMLTYD 303

Query: 297 GASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADSAS 355
              L  G  ++  + G    +D +P+LV  +   KF +++L+    P + I++ F    S
Sbjct: 304 PMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNS 363

Query: 356 GEVIKPIITF 365
           G+ I+ ++TF
Sbjct: 364 GQSIRTVLTF 373


>1ee2A [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
          Length = 373

 Score =  170 bits (431), Expect = 6e-45
 Identities = 97/369 (26%), Positives = 156/369 (42%), Gaps = 6/369 (1%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AA++   K+PF I  +++  P+  EV+++++AAG+C +D  V        LP    
Sbjct: 7   IKCKAAVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVAPLPVIAG 66

Query: 61  XXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                            +P DKV+  F   CG+C  C   +   C          T  DG
Sbjct: 67  HEAAGIVESIGEGVTTVRPGDKVIPLFIPQCGKCSVCKHPEGNLCL-KNLSMPRGTMQDG 125

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILN 179
           ++ F+  G+ +  HF G STF+ YT V   SV K+D               STG G+ + 
Sbjct: 126 TSRFTCRGKPIH-HFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGYGSAVK 184

Query: 180 SLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
              V  G T AVFG                      VDI+  +   AKE+GAT  +N +D
Sbjct: 185 VAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATECVNPQD 244

Query: 240 EDP--AEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVG 297
                 E + +++  GV F+ +  G +     A         V ++    P ++      
Sbjct: 245 YKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVAALSCCQEAYGVSVIVGVPPDSQNLSMNP 304

Query: 298 ASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADSASG 356
             L+ G  ++  I G    +D +P+LV  +   KF ++ L+    P E IN+ F    SG
Sbjct: 305 MLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFDLLRSG 364

Query: 357 EVIKPIITF 365
           + I+ I+TF
Sbjct: 365 KSIRTILTF 373


>1d1tA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE CLASS IV SIGMA CHAIN
          Length = 373

 Score =  169 bits (429), Expect = 1e-44
 Identities = 88/370 (23%), Positives = 141/370 (38%), Gaps = 8/370 (2%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AA++   KQPF I  I++  P+  EV+++++A G+C TD  V      +  P    
Sbjct: 7   IKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTMVSKFPVIVG 66

Query: 61  XXXXXXXXXXXXXXXXXKPDDKV-VLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                            KP DKV  L    C +C  C       C +          D  
Sbjct: 67  HEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGT 126

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILN 179
           +    +             TF  YT V   SV K+DD              STG GA + 
Sbjct: 127 TRFTCKGKPVHHFLNTS--TFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVK 184

Query: 180 SLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
           +  V+ G T  VFG                      +D++  + E A  +GAT  I+ KD
Sbjct: 185 TGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKD 244

Query: 240 ED-PAEKIKQLTGDG-VQFALDTTGVVAVTRQAA-DSLAINGTVGLVGAPAPGAEATFEV 296
              P  ++        V +  +  G +     A        GT  +VG P P A+     
Sbjct: 245 STKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVP-PSAKMLTYD 303

Query: 297 GASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADSAS 355
              L  G  ++  + G    +D +P+LV  +   KF +++L+    P + I++ F    S
Sbjct: 304 PMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNS 363

Query: 356 GEVIKPIITF 365
           G+ I+ ++TF
Sbjct: 364 GQSIRTVLTF 373


>1e3eA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
          Length = 376

 Score =  163 bits (412), Expect = 9e-43
 Identities = 100/373 (26%), Positives = 147/373 (39%), Gaps = 11/373 (2%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AAI   T  P  I  I++  P+  EV+++VIA  VC TD    D       P    
Sbjct: 7   IKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKALFPVVLG 66

Query: 61  XXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCE----KFYDRNFACT 115
                            KP DKV+  F   C +C  CL      C       Y       
Sbjct: 67  HECAGIVESVGPGVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRNFKYPTIDQEL 126

Query: 116 RDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAG 175
            +D ++ F+  G  +  HF G S+F+ YT VS  ++ +VDD+             S+G G
Sbjct: 127 MEDRTSRFTCKGRSI-YHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYG 185

Query: 176 AILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTI 235
           A +N+  V  G T AVFG                      +DI+  +   AK LGAT  +
Sbjct: 186 AAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCL 245

Query: 236 NSKDEDPAEK--IKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEAT 293
           N ++ D   +  I +LT  GV ++LD  G     + A D   +      V       +  
Sbjct: 246 NPRELDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTV--VGAKVDEM 303

Query: 294 FEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFAD 352
                 ++ G        G     D +P LV  ++  KF ++ LV    P E INDA   
Sbjct: 304 TIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDL 363

Query: 353 SASGEVIKPIITF 365
              G+ I+ I+TF
Sbjct: 364 MKEGKSIRTILTF 376


>1cdoA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE
          Length = 374

 Score =  161 bits (407), Expect = 3e-42
 Identities = 92/370 (24%), Positives = 149/370 (40%), Gaps = 7/370 (1%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTF-LPXXX 59
           ++  AA+     +P  I  I++D P  +E+++++IA GVCHTD     +       P   
Sbjct: 7   IKCKAAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDGFPVVL 66

Query: 60  XXXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDD 118
                             +P +KV+  F   CG+C  C   K   C K +          
Sbjct: 67  GHEGAGIVESVGPGVTEFQPGEKVIPLFISQCGECRFCQSPKTNQCVKGWANESPDVMSP 126

Query: 119 GSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAIL 178
             T F+  G +    F G STF+ YT V+  +V K+D               STG GA +
Sbjct: 127 KETRFTCKG-RKVLQFLGTSTFSQYTVVNQIAVAKIDPSAPLDTVCLLGCGVSTGFGAAV 185

Query: 179 NSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSK 238
           N+  V  G T AVFG                      VD++  + E AK  GAT  +N  
Sbjct: 186 NTAKVEPGSTCAVFGLGAVGLAAVMGCHSAGAKRIIAVDLNPDKFEKAKVFGATDFVNPN 245

Query: 239 DEDPAEK--IKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEV 296
           D        + ++T  GV F+L+  G V V R A +S      V ++             
Sbjct: 246 DHSEPISQVLSKMTNGGVDFSLECVGNVGVMRNALESCLKGWGVSVLVGW-TDLHDVATR 304

Query: 297 GASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADSAS 355
              L+ G  ++  + G    +D +P++V  +   K  +++ +    PLE +NDA      
Sbjct: 305 PIQLIAGRTWKGSMFGGFKGKDGVPKMVKAYLDKKVKLDEFITHRMPLESVNDAIDLMKH 364

Query: 356 GEVIKPIITF 365
           G+ I+ +++ 
Sbjct: 365 GKCIRTVLSL 374


>3cosA [x.x.x] ALCOHOL DEHYDROGENASE 4
          Length = 379

 Score =  159 bits (402), Expect = 1e-41
 Identities = 102/374 (27%), Positives = 151/374 (40%), Gaps = 10/374 (2%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLP--XX 58
           ++  AAI     +P  I  +++  P+  EV++++IA  +CHTDA V D  +         
Sbjct: 7   IKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIV 66

Query: 59  XXXXXXXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFAC---- 114
                                D  + L    C +C  CL      C K  +         
Sbjct: 67  GHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQ 126

Query: 115 TRDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGA 174
             +D ++ F+  G+ V  HFFG STF+ YT VS  ++ K+DDD             STG 
Sbjct: 127 LMEDKTSRFTCKGKPV-YHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGY 185

Query: 175 GAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHT 234
           GA +N+  V  G T AVFG                      +DI++ +   AK LGAT  
Sbjct: 186 GAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDC 245

Query: 235 INSKDEDPAE--KIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEA 292
           +N +D        I +LT  GV FALD  G     + A D              A G++ 
Sbjct: 246 LNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKG 305

Query: 293 TFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFA 351
                  L+ G        G     D IP+LV  ++  KF ++ LV  T P + I++AF 
Sbjct: 306 LTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDKISEAFD 365

Query: 352 DSASGEVIKPIITF 365
               G+ I+ I+ F
Sbjct: 366 LMNQGKSIRTILIF 379


>1e3eB [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
          Length = 373

 Score =  158 bits (401), Expect = 2e-41
 Identities = 96/373 (25%), Positives = 145/373 (38%), Gaps = 11/373 (2%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AAI   T  P  I  I++  P+  EV+++VIA  VC TD    D       P    
Sbjct: 4   IKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCPTDINATDPKKKALFPVVLG 63

Query: 61  XXXXXXXXXXXXXXXXXK-PDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFAC----T 115
                            K  D  +      C +C  CL      C K  +  +       
Sbjct: 64  HECAGIVESVGPGVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRNFKYPTIDQEL 123

Query: 116 RDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAG 175
            +D ++ F+  G  +  HF G S+F+ YT VS  ++ +VDD+             S+G G
Sbjct: 124 MEDRTSRFTCKGRSI-YHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYG 182

Query: 176 AILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTI 235
           A +N+  V  G T AVFG                      +DI+  +   AK LGAT  +
Sbjct: 183 AAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCL 242

Query: 236 NSKDEDPA--EKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEAT 293
           N ++ D    + I +LT  GV ++LD  G     + A D   +      V       +  
Sbjct: 243 NPRELDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTV--VGAKVDEM 300

Query: 294 FEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFAD 352
                 ++ G        G     D +P LV  ++  KF ++ LV    P E INDA   
Sbjct: 301 TIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDL 360

Query: 353 SASGEVIKPIITF 365
              G+ I+ I+TF
Sbjct: 361 MKEGKSIRTILTF 373


>1e3lB [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
          Length = 373

 Score =  154 bits (390), Expect = 3e-40
 Identities = 99/373 (26%), Positives = 146/373 (39%), Gaps = 11/373 (2%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AAI   T  P  I  I++  P+  EV+++VIA  VCHTD    D       P    
Sbjct: 4   IKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFPVVLG 63

Query: 61  XXXXXXXXXXXXXXXXXKPDDK-VVLGFNSCGQCLKCLGGKPAYCE----KFYDRNFACT 115
                            KP DK +      C +C  CL      C       Y       
Sbjct: 64  HECAGIVESVGPGVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRNFKYPTIDQEL 123

Query: 116 RDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAG 175
            +D ++ F+  G  +  HF G S+F+ YT VS  ++ +VDD+             S+G G
Sbjct: 124 MEDRTSRFTCKGRSI-YHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYG 182

Query: 176 AILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTI 235
           A +N+  V  G T AVFG                      +DI+  +   AK LGAT  +
Sbjct: 183 AAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCL 242

Query: 236 NSKDEDP--AEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEAT 293
           N ++ D    + I +LT  GV ++LD  G     + A D   +      V       +  
Sbjct: 243 NPRELDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTV--VGAKVDEM 300

Query: 294 FEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFAD 352
                 ++ G        G     D +P LV  ++  KF ++ LV    P E INDA   
Sbjct: 301 TIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDL 360

Query: 353 SASGEVIKPIITF 365
              G+ I+ I+TF
Sbjct: 361 MKEGKSIRTILTF 373


>3cosD [x.x.x] ALCOHOL DEHYDROGENASE 4
          Length = 381

 Score =  150 bits (379), Expect = 6e-39
 Identities = 102/374 (27%), Positives = 151/374 (40%), Gaps = 10/374 (2%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVR--DQIYPTFLPXX 58
           ++  AAI     +P  I  +++  P+  EV++++IA  +CHTDA V         F    
Sbjct: 9   IKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEGLAFPVIV 68

Query: 59  XXXXXXXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKF----YDRNFAC 114
                                D  + L    C +C  CL      C K        +   
Sbjct: 69  GHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLKSPASDQQ 128

Query: 115 TRDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGA 174
             +D ++ F+  G+ V  HFFG STF+ YT VS  ++ K+DDD             STG 
Sbjct: 129 LMEDKTSRFTCKGKPV-YHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGCGFSTGY 187

Query: 175 GAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHT 234
           GA +N+  V  G T AVFG                      +DI++ +   AK LGAT  
Sbjct: 188 GAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKALGATDC 247

Query: 235 INSKDEDPAEK--IKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEA 292
           +N +D     +  I +LT  GV FALD  G     + A D              A G++ 
Sbjct: 248 LNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGVAAGSKG 307

Query: 293 TFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFA 351
                  L+ G        G     D IP+LV  ++  KF ++ LV  T P + I++AF 
Sbjct: 308 LTVFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDKISEAFD 367

Query: 352 DSASGEVIKPIITF 365
               G+ I+ I+ F
Sbjct: 368 LMNQGKSIRTILIF 381


>1e3lA [b.35.1 - c.2.1] ALCOHOL DEHYDROGENASE, CLASS II
          Length = 376

 Score =  149 bits (377), Expect = 1e-38
 Identities = 99/373 (26%), Positives = 146/373 (39%), Gaps = 11/373 (2%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXX 60
           ++  AAI   T  P  I  I++  P+  EV+++VIA  VCHTD    D       P    
Sbjct: 7   IKCKAAIAWKTGSPLCIEEIEVSPPKACEVRIQVIATCVCHTDINATDPKKKALFPVVLG 66

Query: 61  XXXXXXXXXXXXXXXXXKP-DDKVVLGFNSCGQCLKCLGGKPAYCEKF----YDRNFACT 115
                            KP D  +      C +C  CL      C K     Y       
Sbjct: 67  HECAGIVESVGPGVTNFKPGDKVIPFFAPQCKRCKLCLSPLTNLCGKLRNFKYPTIDQEL 126

Query: 116 RDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAG 175
            +D ++ F+  G  +  HF G S+F+ YT VS  ++ +VDD+             S+G G
Sbjct: 127 MEDRTSRFTCKGRSI-YHFMGVSSFSQYTVVSEANLARVDDEANLERVCLIGCGFSSGYG 185

Query: 176 AILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTI 235
           A +N+  V  G T AVFG                      +DI+  +   AK LGAT  +
Sbjct: 186 AAINTAKVTPGSTCAVFGLGCVGLSAIIGCKIAGASRIIAIDINGEKFPKAKALGATDCL 245

Query: 236 NSKDEDP--AEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEAT 293
           N ++ D    + I +LT  GV ++LD  G     + A D   +      V       +  
Sbjct: 246 NPRELDKPVQDVITELTAGGVDYSLDCAGTAQTLKAAVDCTVLGWGSCTVVGAKV--DEM 303

Query: 294 FEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFAD 352
                 ++ G        G     D +P LV  ++  KF ++ LV    P E INDA   
Sbjct: 304 TIPTVDVILGRSINGTFFGGWKSVDSVPNLVSDYKNKKFDLDLLVTHALPFESINDAIDL 363

Query: 353 SASGEVIKPIITF 365
              G+ I+ I+TF
Sbjct: 364 MKEGKSIRTILTF 376


>2dfvA [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
          Length = 340

 Score =  143 bits (362), Expect = 6e-37
 Identities = 62/365 (16%), Positives = 114/365 (31%), Gaps = 34/365 (9%)

Query: 5   AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTF---LPXXXXX 61
            AI        E+  +D+ +P P EV ++V+A  +C TD  + +          P     
Sbjct: 3   VAIKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIGH 62

Query: 62  XXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDDGS 120
                           +  D V +  +  CG+C  C  G+   C+               
Sbjct: 63  EVAGEVVEIGPGVEGIEVGDYVSVETHIVCGKCYACRRGQYHVCQNTKIF---------- 112

Query: 121 TAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNS 180
                              FA Y  V A+++ K    +              G       
Sbjct: 113 ------------GVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEP---LGNAVDTVL 157

Query: 181 LGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDE 240
            G  +G +V + G                       +  + R E+AK++GA + IN  +E
Sbjct: 158 AGPISGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFEE 217

Query: 241 DPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGASL 300
           D  +++    G+GV   L+ +G      Q   ++   G V L+G   PG          +
Sbjct: 218 DVVKEVDITDGNGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLY-PGKVTIDFNNLII 276

Query: 301 VRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV--RTYPLEHINDAFADSASGEV 358
            +      I        +    +  L + GK  ++ ++  +    +   +AF   A    
Sbjct: 277 FKALTIYGITGRH--LWETWYTVSRLLQSGKLNLDPIITHKYKGFDKYEEAFELRAGKTG 334

Query: 359 IKPII 363
               +
Sbjct: 335 KVVFL 339


>2b83A [x.x.x] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
          Length = 351

 Score =  141 bits (356), Expect = 3e-36
 Identities = 51/369 (13%), Positives = 92/369 (24%), Gaps = 29/369 (7%)

Query: 6   AIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDA-IVRDQIYPTFLPXXXXXXXX 64
                          +       +  VR +A   C +D   V +                
Sbjct: 3   GFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAV 62

Query: 65  XXXXXXXXXXXXXKPDDK-VVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAF 123
                        KP D+ +V       + L+   G P +                    
Sbjct: 63  GEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFPQHSNGMLAGW------------ 110

Query: 124 SEDGEQVGSHFFGQSTFANYTNVS--ARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSL 181
                      F    F  Y +V+    ++  +  D+            +TG        
Sbjct: 111 -------KFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHG-AELA 162

Query: 182 GVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDED 241
            ++ G +V V G                      V      +E AK  GAT  +N K+  
Sbjct: 163 DIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGH 222

Query: 242 PAEKIKQLTGD-GVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGASL 300
             +++ +LT   GV   +   G      QA   +   G +  +     G           
Sbjct: 223 IVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWG 282

Query: 301 VRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV--RTYPLEHINDAFADSASGE- 357
                           +     L  +    +  + KLV    +  +HI +A         
Sbjct: 283 CGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPK 342

Query: 358 -VIKPIITF 365
            +IK ++  
Sbjct: 343 DLIKAVVIL 351


>2dphA [x.x.x] FORMALDEHYDE DISMUTASE
          Length = 398

 Score =  141 bits (355), Expect = 4e-36
 Identities = 50/400 (12%), Positives = 93/400 (23%), Gaps = 50/400 (12%)

Query: 5   AAIVRATKQP-----FEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXX 59
           + +   T+               +      V ++V++  +C +D  +    +        
Sbjct: 5   SVVYHGTRDLRVETVPYPKLEHNNRKLEHAVILKVVSTNICGSDQHIYRGRFIVPKGHVL 64

Query: 60  XXXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDD 118
                                D V + FN +CG+C  C   +   CE       A     
Sbjct: 65  GHEITGEVVEKGSDVELMDIGDLVSVPFNVACGRCRNCKEARSDVCENNLVNPDADLGAF 124

Query: 119 GSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAI- 177
           G       G             A Y  V     + +                        
Sbjct: 125 GFDLKGWSG-----------GQAEYVLVPYADYMLLKFGDKEQAMEKIKDLTLISDILPT 173

Query: 178 ----LNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATH 233
                 S GV+ G  V + G                       D +  RL++  + G   
Sbjct: 174 GFHGCVSAGVKPGSHVYIAGAGPVGRCAAAGARLLGAACVIVGDQNPERLKLLSDAGFET 233

Query: 234 TINSKDEDPAEKIKQL-TGDGVQFALDT--------------TGVVAVTRQAADSLAING 278
                     ++I Q+     V   +D                          D +   G
Sbjct: 234 IDLRNSAPLRDQIDQILGKPEVDCGVDAVGFEAHGLGDEANTETPNGALNSLFDVVRAGG 293

Query: 279 TVGLVGAPAPGAEATFEVGASLVRGWKF---------QTIIEGDAVPQDFIPRLVHLWRQ 329
            +G+ G    G++       +                  I+ G A   ++   L      
Sbjct: 294 AIGIPGIY-VGSDPDPVNKDAGSGRLHLDFGKMWTKSIRIMTGMAPVTNYNRHLTEAILW 352

Query: 330 GKF--PIEKLV-RTYPLEHINDAFADSASGEVIKPIITFP 366
            +     + +      L+   D +A    G   K +I   
Sbjct: 353 DQMPYLSKVMNIEVITLDQAPDGYAKFDKGSPAKFVIDPH 392


>2dq4A [x.x.x] L-THREONINE 3-DEHYDROGENASE
          Length = 343

 Score =  140 bits (352), Expect = 8e-36
 Identities = 63/367 (17%), Positives = 98/367 (26%), Gaps = 34/367 (9%)

Query: 5   AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIY----PTFLPXXXX 60
           A    A ++   +    + EP P E+ VRV AA +C TD  +             P    
Sbjct: 3   ALAKLAPEEGLTLVDRPVPEPGPGEILVRVEAASICGTDLHIWKWDAWARGRIRPPLVTG 62

Query: 61  XXXXXXXXXXXXXXXXXKP-DDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                            +  D   +     C  C  C  G    C               
Sbjct: 63  HEFSGVVEAVGPGVRRPQVGDHVSLESHIVCHACPACRTGNYHVCLNTQI---------- 112

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILN 179
                               FA Y  V A +      D+            +        
Sbjct: 113 ------------LGVDRDGGFAEYVVVPAENAWVNPKDLPFEVAAILEPFGNAVHTVYAG 160

Query: 180 SLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
           S          +                        V   N          A   +N  +
Sbjct: 161 SG---VSGKSVLITGAGPIGLMAAMVVRASGAGPILVSDPNPYRLAFARPYADRLVNPLE 217

Query: 240 EDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGAS 299
           ED  E ++++TG GV+  L+ +G  A   Q   +L   G   ++G P          G  
Sbjct: 218 EDLLEVVRRVTGSGVEVLLEFSGNEAAIHQGLMALIPGGEARILGIP-SDPIRFDLAGEL 276

Query: 300 LVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADSASGEV 358
           ++RG     I            +   L   G+  +  L+    PL    +AF   ASG+ 
Sbjct: 277 VMRGITAFGIAGRR--LWQTWMQGTALVYSGRVDLSPLLTHRLPLSRYREAFGLLASGQA 334

Query: 359 IKPIITF 365
           +K I+  
Sbjct: 335 VKVILDP 341


>2d8aA [x.x.x] PROBABLE L-THREONINE 3-DEHYDROGENASE
          Length = 327

 Score =  135 bits (340), Expect = 2e-34
 Identities = 60/365 (16%), Positives = 113/365 (30%), Gaps = 47/365 (12%)

Query: 5   AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTF---LPXXXXX 61
            AI        E+  +D+ +P P EV ++V+A  +C TD  + +          P     
Sbjct: 3   VAIKTKPGYGAELVEVDVPKPGPGEVLIKVLATSICGTDLHIYEWNEWAQSRIKPPQIGH 62

Query: 62  XXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDDGS 120
                           +  D V +  +  CG+C                           
Sbjct: 63  EVAGEVVEIGPGVEGIEVGDYVSVETHIVCGKC--------------------------- 95

Query: 121 TAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNS 180
                              FA Y  V A+++ K    +              G       
Sbjct: 96  -------YTKIFGVDTDGVFAEYAVVPAQNIWKNPKSIPPEYATLQEP---LGNAVDTVL 145

Query: 181 LGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDE 240
            G  +G +V + G                       +  + R E+AK++GA + IN  +E
Sbjct: 146 AGPISGKSVLITGAGPLGLLGIAVAKASGAYPVIVSEPSDFRRELAKKVGADYVINPFEE 205

Query: 241 DPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGASL 300
           D  +++    G+GV   L+ +G      Q   ++   G V L+G   PG          +
Sbjct: 206 DVVKEVDITDGNGVDVFLEFSGAPKALEQGLQAVTPAGRVSLLGLY-PGKVTIDFNNLII 264

Query: 301 VRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV--RTYPLEHINDAFADSASGEV 358
            +      I        +    +  L + GK  ++ ++  +    +   +AF +  +G+ 
Sbjct: 265 FKALTIYGITGRH--LWETWYTVSRLLQSGKLNLDPIITHKYKGFDKYEEAF-ELRAGKT 321

Query: 359 IKPII 363
            K + 
Sbjct: 322 GKVVF 326


>1bxzA [b.35.1 - c.2.1] NADP-DEPENDENT ALCOHOL DEHYDROGENASE
          Length = 352

 Score =  134 bits (338), Expect = 4e-34
 Identities = 55/368 (14%), Positives = 93/368 (25%), Gaps = 26/368 (7%)

Query: 5   AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLP--XXXXXX 62
              + +  +       +   P P +  VR +A   C +D     +               
Sbjct: 3   GFAMLSIGKV-GWIEKEKPAPGPFDAIVRPLAVAPCTSDIHTVFEGAIGERHNMILGHEA 61

Query: 63  XXXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTA 122
                            D  VV       +  +   G   +                   
Sbjct: 62  VGEVVEVGSEVKDFKPGDRVVVPAITPDWRTSEVQRGYHQHSGGMLAGWKF--------- 112

Query: 123 FSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLG 182
                    +   G      + N +  ++  +  ++            +TG         
Sbjct: 113 --------SNVKDGVFGEFFHVNDADMNLAHLPKEIPLEAAVMIPDMMTTGFHG-AELAD 163

Query: 183 VRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDP 242
           +  G TVAV G                      V      ++ AK  GAT  +N KD   
Sbjct: 164 IELGATVAVLGIGPVGLMAVAGAKLRGAGRIIAVGSRPVCVDAAKYYGATDIVNYKDGPI 223

Query: 243 AEKIKQLT-GDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGASLV 301
             +I  LT G GV  A+   G   +   A   +   GT+  V     G            
Sbjct: 224 ESQIMNLTEGKGVDAAIIAGGNADIMATAVKIVKPGGTIANVNYFGEGEVLPVPRLEWGC 283

Query: 302 RGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV--RTYPLEHINDAFADSASGE-- 357
                          +  + RL+ L    +    KLV       ++I  AF         
Sbjct: 284 GMAHKTIKGGLCPGGRLRMERLIDLVFYKRVDPSKLVTHVFRGFDNIEKAFMLMKDKPKD 343

Query: 358 VIKPIITF 365
           +IKP++  
Sbjct: 344 LIKPVVIL 351


>2cf5A [x.x.x] CINNAMYL ALCOHOL DEHYDROGENASE
          Length = 352

 Score =  134 bits (338), Expect = 4e-34
 Identities = 55/371 (14%), Positives = 101/371 (27%), Gaps = 31/371 (8%)

Query: 1   MQTL-AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTF-LPXX 58
            +       R         T  L E  P++V +R+I  G+CHTD             P  
Sbjct: 2   ERKTTGWAARDPSGILSPYTYTLRETGPEDVNIRIICCGICHTDLHQTKNDLGMSNYPMV 61

Query: 59  XXXXXXXXXXXXXXXXXXXKPDDKVVLG--FNSCGQCLKCLGGKPAYCEKFYDRNFACTR 116
                                 D V +G     CG C  C      YC K          
Sbjct: 62  PGHEVVGEVVEVGSDVSKFTVGDIVGVGCLVGCCGGCSPCERDLEQYCPKKIWSYNDVYI 121

Query: 117 DDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGA 176
           +                   Q  FA  T V  + VVK+ + +             T    
Sbjct: 122 N---------------GQPTQGGFAKATVVHQKFVVKIPEGMAVEQAAPLLCAGVTVYSP 166

Query: 177 ILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTIN 236
           + +    + G    + G                         +  R E  ++LGA   + 
Sbjct: 167 LSHFGLKQPGLRGGILGLGGVGHMGVKIAKAMGHHVTVISSSNKKREEALQDLGADDYVI 226

Query: 237 SKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEV 296
             D+    ++     D + + +DT  V          L ++G + L+G         F  
Sbjct: 227 GSDQAKMSELA----DSLDYVIDTVPVHHALEPYLSLLKLDGKLILMG--VINNPLQFLT 280

Query: 297 GASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLVRTYPLEHINDAFADSASG 356
              +      + I             ++   ++       ++    ++++N AF      
Sbjct: 281 PLLM---LGRKVITGSFIGSMKETEEMLEFCKEKGLSS--IIEVVKMDYVNTAFERLEKN 335

Query: 357 EVI-KPIITFP 366
           +V  + ++   
Sbjct: 336 DVRYRFVVDVE 346


>1e3jA [b.35.1 - c.2.1] NADP(H)-DEPENDENT KETOSE REDUCTASE
          Length = 348

 Score =  133 bits (335), Expect = 8e-34
 Identities = 60/377 (15%), Positives = 105/377 (27%), Gaps = 44/377 (11%)

Query: 3   TLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQ----IYPTFLPXX 58
            L+A++   +    +    + EP+ DEV +++   G+C +D    +      +    P  
Sbjct: 2   NLSAVLYK-QNDLRLEQRPIPEPKEDEVLLQMAYVGICGSDVHYYEHGRIADFIVKDPMV 60

Query: 59  XXXXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRD 117
                              K  D+V +     C +C  C  GK   C             
Sbjct: 61  IGHEASGTVVKVGKNVKHLKKGDRVAVEPGVPCRRCQFCKEGKYNLCPDL---------- 110

Query: 118 DGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAI 177
                         +        A Y   +A    K+ D+V                   
Sbjct: 111 -----------TFCATPPDDGNLARYYVHAADFCHKLPDNVSLEEGALLEPLSVGVHACR 159

Query: 178 LNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINS 237
                     T  +                              RLE+AK  GA  T+  
Sbjct: 160 RA---GVQLGTTVLVIGAGPIGLVSVLAAKAYGAFVVCTARSPRRLEVAKNCGADVTLVV 216

Query: 238 KDEDP-----AEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEA 292
                      E+I+   GD     +D +G         +     GT+ LVG  +     
Sbjct: 217 DPAKEEESSIIERIRSAIGDLPNVTIDCSGNEKCITIGINITRTGGTLMLVGMGSQMVTV 276

Query: 293 TFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFA 351
                   V     +  I+      +  P  + +   G+  +++LV  ++ LE   DAF 
Sbjct: 277 PL------VNACAREIDIKSVFRYCNDYPIALEMVASGRCNVKQLVTHSFKLEQTVDAFE 330

Query: 352 DSASGEV--IKPIITFP 366
            +       IK +I+  
Sbjct: 331 AARKKADNTIKVMISCR 347


>2eerB [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
          Length = 347

 Score =  132 bits (333), Expect = 1e-33
 Identities = 62/374 (16%), Positives = 113/374 (30%), Gaps = 41/374 (10%)

Query: 5   AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTF---------L 55
           A  +    +P ++  I + +P+  +V +++ AAGVCH+D  +R   +            L
Sbjct: 3   AMRLVEIGKPLKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLRIVEDLGVKL 62

Query: 56  PXXXXXXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFAC 114
           P                        D V +      G C  C  G+   C+         
Sbjct: 63  PVTLGHEIAGRIEEVGDEVVGYSKGDLVAVNPWEGEGNCYYCRIGEEHLCDSPR------ 116

Query: 115 TRDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGA 174
                                    +A Y  V     +     +             T  
Sbjct: 117 ----------------WLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTY 160

Query: 175 GAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHT 234
            A+  +    +   V +                        VD+    LE AK  GA + 
Sbjct: 161 RAVRKASLDPSKTLVVIGAGGGLGTMAIQIAKAVSGATIIGVDVREEALEAAKRAGADYV 220

Query: 235 INSKDEDPAEKIKQLTGDG-VQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEAT 293
           IN+  +DP  +I+++T        +D              LA  G   +VG    GA+  
Sbjct: 221 INASSQDPVSEIRRITQGKGADAVIDLNNSEKTLSIYPYVLAKQGKYVMVG--LFGADLK 278

Query: 294 FEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFAD 352
           +      +   +F   +      Q     ++ L   GK  ++ +V +T  LE  N+A  +
Sbjct: 279 YHAPLITLNEVQFIGSLV---GNQSDFLGIMSLAEAGK--VKPMVTKTMKLEEANEAIDN 333

Query: 353 SASGEVIKPIITFP 366
             + + +   +  P
Sbjct: 334 LENFKAVGRQVLVP 347


>2b5wA [x.x.x] GLUCOSE DEHYDROGENASE
          Length = 357

 Score =  125 bits (314), Expect = 2e-31
 Identities = 57/377 (15%), Positives = 95/377 (25%), Gaps = 41/377 (10%)

Query: 5   AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRD--QIYPTFLPXXXXXX 62
           A  V+  +    +      EP   E  VR +  GVC TD  V                  
Sbjct: 3   AIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVCGTDHEVIAGGHGGFPEGEDHLVLG 62

Query: 63  XXXXXXXXXXXXXXXKPDDKVVL---GFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                          +  D VV       + G        +P                 G
Sbjct: 63  HEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHG 122

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXST---GAGA 176
                                + +     + +V++                +        
Sbjct: 123 -------------------YMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAY 163

Query: 177 ILNSLGVRAGDTVAVF-----GXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGA 231
              S       +  V      G                       D  +  +++ +EL A
Sbjct: 164 ASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDA 223

Query: 232 THTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAE 291
           T+  + +      +      + + F  + TG      Q+  +LA NG   L+G P     
Sbjct: 224 TYVDSRQT---PVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVP-SDWA 279

Query: 292 ATFEVGASLVRGWKFQTIIEGD--AVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHIND 348
              + GA           + G   +  + F    V   +  K+ +E LV   +PL     
Sbjct: 280 FEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEA 339

Query: 349 AFADSASGEVIKPIITF 365
           AF D      IK  I F
Sbjct: 340 AFDD--DDTTIKTAIEF 354


>3b70A [x.x.x] ENOYL REDUCTASE
          Length = 357

 Score =  123 bits (309), Expect = 8e-31
 Identities = 43/371 (11%), Positives = 77/371 (20%), Gaps = 43/371 (11%)

Query: 5   AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXXX 64
           A  V    +              D+V VRV A  +  +D  +R Q    +          
Sbjct: 11  ALTVNDHDEVTVWNAAPCPMLPRDQVYVRVEAVAINPSDTKMRGQFATPWAFLGTDYAGT 70

Query: 65  XXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFS 124
                          D         C +             +                  
Sbjct: 71  VVAVGSDVTHIQ-VGDRVYGAQNEMCPRTPDQGAFSQYTVTR------------------ 111

Query: 125 EDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVR 184
               +V +      +F     + A                           A       +
Sbjct: 112 ---GRVWAKIPKGLSFEQAAALPAGISTAGLAMKLLGLP-------LPSPSADQPPTHSK 161

Query: 185 AGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPAE 244
               +   G                              ++AK  GA    + +  + A+
Sbjct: 162 PVYVLVYGGSTATATVTMQMLRLSGYIPIA--TCSPHNFDLAKSRGAEEVFDYRAPNLAQ 219

Query: 245 KIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGASLVRGW 304
            I+  T + +++ALD    V  T     ++   G   +   P P          +L    
Sbjct: 220 TIRTYTKNNLRYALDCITNVESTTFCFAAIGRAGGHYVSLNPFPETRKMVTTDWTLGPTI 279

Query: 305 -----------KFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFAD 352
                            E     +D       L   G+     L       +HI      
Sbjct: 280 FGEGSTWPAPYGRPGSEEERQFGEDLWRIAGQLVEDGRLVHHPLRVVQGGFDHIKQGMEL 339

Query: 353 SASGEVIKPII 363
              GE+    +
Sbjct: 340 VRKGELSGEKL 350


>2eerA [x.x.x] NAD-DEPENDENT ALCOHOL DEHYDROGENASE
          Length = 346

 Score =  122 bits (307), Expect = 1e-30
 Identities = 62/371 (16%), Positives = 108/371 (29%), Gaps = 41/371 (11%)

Query: 5   AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTF---------L 55
           A  +    +P ++  I + +P+  +V +++ AAGVCH+D  +R   +            L
Sbjct: 3   AMRLVEIGKPLKLEDIPIPKPKGSQVLIKIEAAGVCHSDVHMRQGRFGNLRIVEDLGVKL 62

Query: 56  PXXXXXXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFAC 114
           P                        D V +      G C  C  G+   C+         
Sbjct: 63  PVTLGHEIAGRIEEVGDEVVGYSKGDLVAVNPWEGEGNCYYCRIGEEHLCDSPR------ 116

Query: 115 TRDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGA 174
                                    +A Y  V     +     +             T  
Sbjct: 117 ----------------WLGINYDGAYAEYVLVPHYKYLYKLRRLSAVEAAPLTCSGVTTY 160

Query: 175 GAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHT 234
            A+  +    +   V +                        VD+    LE AK  GA + 
Sbjct: 161 RAVRKASLDPSKTLVVIGAGGGLGTMAIQIAKAVSGATIIGVDVREEALEAAKRAGADYV 220

Query: 235 INSKDEDPA-EKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEAT 293
           IN+  +DP  E  +   G G    +D              LA  G   +VG    GA+  
Sbjct: 221 INASSQDPVSEIRRITQGKGADAVIDLNNSEKTLSIYPYVLAKQGKYVMVG--LFGADLK 278

Query: 294 FEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFAD 352
           +      +        I      Q     ++ L   GK  ++ +V +T  LE  N+A  +
Sbjct: 279 YHAPLITLNEV---QFIGSLVGNQSDFLGIMSLAEAGK--VKPMVTKTMKLEEANEAIDN 333

Query: 353 SASGEVIKPII 363
             + + +   +
Sbjct: 334 LENFKAVGRQV 344


>2b5vA [x.x.x] GLUCOSE DEHYDROGENASE
          Length = 355

 Score =  120 bits (302), Expect = 5e-30
 Identities = 53/375 (14%), Positives = 93/375 (24%), Gaps = 40/375 (10%)

Query: 6   AIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTF----LPXXXXX 61
           AI     +P  +      EP   E  VR +  GV  TD  V    +  F           
Sbjct: 3   AIAVKRGRP-VVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGH 61

Query: 62  XXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDDGS 120
                                  +    + G        +P                   
Sbjct: 62  EAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERG------- 114

Query: 121 TAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGA---I 177
                               + +     + +V++                +  A      
Sbjct: 115 ------------IVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYA 162

Query: 178 LNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXV-----DIHNSRLEMAKELGAT 232
             S       +  V G                            D  +  +++ +EL AT
Sbjct: 163 SRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDAT 222

Query: 233 HTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPA-PGAE 291
           +  + +      +      + + F  + TG      Q+  +LA NG   L+G P+    E
Sbjct: 223 YVDSRQT---PVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFE 279

Query: 292 ATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAF 350
                    +       +   ++  + F    V   +  K+ +E LV   +PL     AF
Sbjct: 280 VDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAF 339

Query: 351 ADSASGEVIKPIITF 365
            D      IK  I F
Sbjct: 340 DD--DDTTIKTAIEF 352


>3b6zA [x.x.x] ENOYL REDUCTASE
          Length = 352

 Score =  119 bits (299), Expect = 1e-29
 Identities = 43/370 (11%), Positives = 75/370 (20%), Gaps = 43/370 (11%)

Query: 5   AAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXXX 64
           A  V    +              D+V VRV A  +  +D  +R                 
Sbjct: 10  ALTVNDHDEVTVWNAAPCPMLPRDQVYVRVEAVAINPSDTKMRG--QFATPWAFLGTDYA 67

Query: 65  XXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAF 123
                        +  D+V    N  C +                          G +  
Sbjct: 68  GTVVAVGSDVTHIQVGDRVYGAQNEMCPRTPDQGAFSQYTV---TRGRVWAKIPKGLSF- 123

Query: 124 SEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGV 183
                                    ++                         A       
Sbjct: 124 ------------------------EQAAALPAGISTAGLAMKLLGLPLPSPSADQPP-TH 158

Query: 184 RAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPA 243
                V V+G                              ++AK  GA    + +  + A
Sbjct: 159 SKPVYVLVYGGSTATATVTMQMLRLSGYIPI-ATCSPHNFDLAKSRGAEEVFDYRAPNLA 217

Query: 244 EKIKQLTGDGVQFALDTTGVVAVTRQAA-DSLAINGTVGLVGAPAPG--------AEATF 294
           + I+  T + +++ALD    V  T           G    +                  F
Sbjct: 218 QTIRTYTKNNLRYALDCITNVESTTFCFAAIGRAGGHYVSLNPFPRKMVTTDWTLGPTIF 277

Query: 295 EVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADS 353
             G++    +      E     +D       L   G+     L       +HI       
Sbjct: 278 GEGSTWPAPYGRPGSEEERQFGEDLWRIAGQLVEDGRLVHHPLRVVQGGFDHIKQGMELV 337

Query: 354 ASGEVIKPII 363
             GE+    +
Sbjct: 338 RKGELSGEKL 347


>2eihA [x.x.x] ALCOHOL DEHYDROGENASE
          Length = 343

 Score =  116 bits (290), Expect = 1e-28
 Identities = 72/365 (19%), Positives = 116/365 (31%), Gaps = 34/365 (9%)

Query: 5   AAIVRATKQP--FEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTF--LPXXXX 60
           A ++RA   P   E+A + + EP P EV+VR+ AA + H D  VR  +      LP    
Sbjct: 3   AVVMRARGGPEVLEVADLPVPEPGPKEVRVRLKAAALNHLDVWVRKGVASPKLPLPHVLG 62

Query: 61  XXXXXXXXXXXXXXXXXKPDDKVVLGFNS-CGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                             P D+VV+     CG+C +CL G+   C     +         
Sbjct: 63  ADGSGVVDAVGPGVEGFAPGDEVVINPGLSCGRCERCLAGEDNLCP--RYQIL------- 113

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILN 179
                              T+A Y  +   ++     ++             T    +++
Sbjct: 114 -------------GEHRHGTYAEYVVLPEANLAPKPKNLSFEEAAAIPLTFLTAWQMVVD 160

Query: 180 SLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
            LGVR GD V V                              +L  AK LGA  T+N   
Sbjct: 161 KLGVRPGDDVLVMAAGSGVSVAAIQIAKLFGARVIATAGSEDKLRRAKALGADETVNYTH 220

Query: 240 EDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGAS 299
            D  +++++LTG      +              + A  G + + GA + G E T      
Sbjct: 221 PDWPKEVRRLTGGKGADKVVDHTGALYFEGVIKATANGGRIAIAGA-SSGYEGTLPFAHV 279

Query: 300 LVRGWKFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLV-RTYPLEHINDAFADSASGEV 358
             R                 I R V   +     ++ +V +  PLE   +         V
Sbjct: 280 FYRQLSILGSTMASKSRLFPILRFVEEGK-----LKPVVGQVLPLEAAAEGHRLLEERRV 334

Query: 359 IKPII 363
              ++
Sbjct: 335 FGKVV 339


>2cdaA [x.x.x] GLUCOSE DEHYDROGENASE
          Length = 360

 Score =  113 bits (284), Expect = 6e-28
 Identities = 46/368 (12%), Positives = 85/368 (23%), Gaps = 18/368 (4%)

Query: 5   AAIVRATKQPFEIATIDLDE-PRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXX 63
           A IV+      ++  +D  +     ++++R I  G+C TD  + +               
Sbjct: 3   AIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLKGKDFLVLGHEA 62

Query: 64  XXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAF 123
                              V      CG C  CL G+P +CE          + DG    
Sbjct: 63  IGVVEESYHGFSQGDLVMPVNRRG--CGICRNCLVGRPDFCETGEFGEAGIHKMDGFMRE 120

Query: 124 SEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGV 183
               +          +  +   ++                                  G 
Sbjct: 121 WWYDDPK-YLVKIPKSIEDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDGT 172

Query: 184 RAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPA 243
                V V G                       +           +  T T      +  
Sbjct: 173 LNCRKVLVVGTGPIGVLFTLLFRTYGLEVWM-ANRREPTEVEQTVIEETKTNYYNSSNGY 231

Query: 244 EKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAP--APGAEATFEVGASLV 301
           +K+K   G        T   V +       L  NG +GL G             +   + 
Sbjct: 232 DKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVH 291

Query: 302 RGWKFQTIIEGDAVPQDFIPRLVHLWR-QGKFPIEKLV-RTYPLEHINDAFA--DSASGE 357
                  ++ G           +  W+       + L+ +T  +    +           
Sbjct: 292 TNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHG 351

Query: 358 VIKPIITF 365
            IK  I +
Sbjct: 352 EIKIRILW 359


>2cdbC [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
          Length = 358

 Score =  112 bits (281), Expect = 1e-27
 Identities = 45/345 (13%), Positives = 82/345 (23%), Gaps = 18/345 (5%)

Query: 5   AAIVRATKQPFEIATIDLDE-PRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXX 63
           A IV+      ++  +D  +     ++++R I  G+C  D  + +     FL        
Sbjct: 3   AIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGADREIVNGKLKDFLV--LGHEA 60

Query: 64  XXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAF 123
                              V      CG C  CL G+P +CE          + DG    
Sbjct: 61  IGVVEESYHGFSQGDLVMPV--NRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMRE 118

Query: 124 SEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGV 183
               +          +  +   ++                                  G 
Sbjct: 119 WWYDDPK-YLVKIPKSIEDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDGT 170

Query: 184 RAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPA 243
                V V G                       +           +  T T      +  
Sbjct: 171 LNCRKVLVVG-TGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETKTNYYNSSNGY 229

Query: 244 EKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPG--AEATFEVGASLV 301
           +K+K   G        T   V +       L  NG +GL G    G        +   + 
Sbjct: 230 DKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVH 289

Query: 302 RGWKFQTIIEGDAVPQDFIPRLVHLWR-QGKFPIEKLV-RTYPLE 344
                  ++ G           +  W+       + L+ +T  + 
Sbjct: 290 TNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSIN 334


>2dm6A [x.x.x] NADP-DEPENDENT LEUKOTRIENE B4 12-
          Length = 331

 Score =  110 bits (275), Expect = 7e-27
 Identities = 40/379 (10%), Positives = 88/379 (23%), Gaps = 69/379 (18%)

Query: 1   MQTLAAIV-------RATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPT 53
           M    +         + T+  FE+ T++L   +  EV +  +   V     I   ++   
Sbjct: 3   MVKAKSWTLKKHFQGKPTQSDFELKTVELPPLKNGEVLLEALFLSVDPYMRIASKRLKEG 62

Query: 54  FLPXXXXXXXXXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFA 113
            +                          +V     S         G     +        
Sbjct: 63  AVM----------------------MGQQVARVVESKNSAFPA--GSIVLAQ-------- 90

Query: 114 CTRDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTG 173
                                +     ++   +        D                T 
Sbjct: 91  -------------------SGWTTHFISDGKGLEKLLTEWPDKLPLSLALGTIGMPGLTA 131

Query: 174 AGAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATH 233
              +L   GV+ G+TV V                            + ++   K++G   
Sbjct: 132 YFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKVVGAAGSDEKIAYLKQIGFDA 191

Query: 234 TINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEAT 293
             N K  +  E+  +                         +   G + + GA +      
Sbjct: 192 AFNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMKDFGKIAICGAISVYNRMD 251

Query: 294 FE-----VGASLVRGWKFQTIIEGDAVPQ---DFIPRLVHLWRQGKFPIEKLV-RTYPLE 344
                    + + +  + +  I            +  L+    +GK  I+     T   E
Sbjct: 252 QLPPGPSPESIIYKQLRIEGFIVYRWQGDVREKALRDLMKWVLEGK--IQYHEHVTKGFE 309

Query: 345 HINDAFADSASGEVIKPII 363
           ++  AF +  +G  +   +
Sbjct: 310 NMPAAFIEMLNGANLGKAV 328


>2cd9A [x.x.x] GLUCOSE DEHYDROGENASE
          Length = 363

 Score =  109 bits (272), Expect = 2e-26
 Identities = 48/369 (13%), Positives = 88/369 (23%), Gaps = 17/369 (4%)

Query: 5   AAIVRATKQPFEIATIDLDE-PRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXX 63
           A IV+      ++  +D  +     ++++R I  G+C TD  + +               
Sbjct: 3   AIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLSKGKDFLVLG 62

Query: 64  XXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTA 122
                            D V+      CG C  CL G+P +CE          + DG   
Sbjct: 63  HEAIGVVEESYHGFSQGDLVMPVNRRGCGICRNCLVGRPDFCETGEFGEAGIHKMDGFMR 122

Query: 123 FSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLG 182
                +          +  +   ++                                  G
Sbjct: 123 EWWYDDP-KYLVKIPKSIEDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDG 174

Query: 183 VRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDP 242
                 V V G                       +           +  T T      + 
Sbjct: 175 TLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWM-ANRREPTEVEQTVIEETKTNYYNSSNG 233

Query: 243 AEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPG--AEATFEVGASL 300
            +K+K   G        T   V +       L  NG +GL G    G        +   +
Sbjct: 234 YDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIV 293

Query: 301 VRGWKFQTIIEGDAVPQDFIPRLVHLWR-QGKFPIEKLV-RTYPLEHINDAFA--DSASG 356
                   ++ G           +  W+       + L+ +T  +    +          
Sbjct: 294 HTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEH 353

Query: 357 EVIKPIITF 365
             IK  I +
Sbjct: 354 GEIKIRILW 362


>2cdaB [x.x.x] GLUCOSE DEHYDROGENASE
          Length = 359

 Score =  109 bits (272), Expect = 2e-26
 Identities = 46/368 (12%), Positives = 84/368 (22%), Gaps = 19/368 (5%)

Query: 5   AAIVRATKQPFEIATIDL-DEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXX 63
           A IV+      ++  +D        ++++R I  G+C TD  + +               
Sbjct: 3   AIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLGKD-FLVLGHEA 61

Query: 64  XXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAF 123
                              V      CG C  CL G+P +CE          + DG    
Sbjct: 62  IGVVEESYHGFSQGDLVMPVNRRG--CGICRNCLVGRPDFCETGEFGEAGIHKMDGFMRE 119

Query: 124 SEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGV 183
               +          +  +   ++                                  G 
Sbjct: 120 WWYDDPK-YLVKIPKSIEDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDGT 171

Query: 184 RAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPA 243
                V V G                       +           +  T T      +  
Sbjct: 172 LNCRKVLVVGTGPIGVLFTLLFRTYGLEVWM-ANRREPTEVEQTVIEETKTNYYNSSNGY 230

Query: 244 EKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPA--PGAEATFEVGASLV 301
           +K+K   G        T   V +       L  NG +GL G             +   + 
Sbjct: 231 DKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVH 290

Query: 302 RGWKFQTIIEGDAVPQDFIPRLVHLWR-QGKFPIEKLV-RTYPLEHINDAFA--DSASGE 357
                  ++ G           +  W+       + L+ +T  +    +           
Sbjct: 291 TNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHG 350

Query: 358 VIKPIITF 365
            IK  I +
Sbjct: 351 EIKIRILW 358


>2cd9B [x.x.x] GLUCOSE DEHYDROGENASE
          Length = 361

 Score =  106 bits (264), Expect = 1e-25
 Identities = 47/380 (12%), Positives = 84/380 (22%), Gaps = 41/380 (10%)

Query: 5   AAIVRATKQPFEIATIDLDE-PRPDEVQVRVIAAGVCHTDAIVRDQIYPTF-LPXXXXXX 62
           A IV+      ++  +D  +     ++++R I  G+C TD  + +               
Sbjct: 3   AIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGTDREIVNGKLTLGKDFLVLGHE 62

Query: 63  XXXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTA 122
                               V      CG C  CL G+P +CE                 
Sbjct: 63  AIGVVEESYHGFSQGDLVMPVN--RRGCGICRNCLVGRPDFCETGEFGE----------- 109

Query: 123 FSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDD-----------DVXXXXXXXXXXXXS 171
                               +     + +VK+                            
Sbjct: 110 --------AGIHKMDGFMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQ 161

Query: 172 TGAGAILNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGA 231
                     G      V V G                       +           +  
Sbjct: 162 KRVPVWTCDDGTLNCRKVLVVG-TGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEE 220

Query: 232 THTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPG-- 289
           T T      +  +K+K   G        T   V +       L  NG +GL G    G  
Sbjct: 221 TKTNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSV 280

Query: 290 AEATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWR-QGKFPIEKLV-RTYPLEHIN 347
                 +   +        ++ G           +  W+       + L+ +T  +    
Sbjct: 281 PLDYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEK 340

Query: 348 DAFA--DSASGEVIKPIITF 365
           +            IK  I +
Sbjct: 341 ELLKVLREKEHGEIKIRILW 360


>2cdbA [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
          Length = 360

 Score =  105 bits (263), Expect = 2e-25
 Identities = 44/378 (11%), Positives = 87/378 (23%), Gaps = 38/378 (10%)

Query: 5   AAIVRATKQPFEIATIDLDE-PRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXX 63
           A IV+      ++  +D  +     ++++R I  G+C  D  + +               
Sbjct: 3   AIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGADREIVNGKLKGKDFLVLGHEA 62

Query: 64  XXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAF 123
                              V      CG C  CL G+P +CE          + DG    
Sbjct: 63  IGVVEESYHGFSQGDLVMPVN--RRGCGICRNCLVGRPDFCETGEFGEAGIHKMDG---- 116

Query: 124 SEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSL-- 181
                              +     + +VK+   +               +   +  +  
Sbjct: 117 ---------------FMREWWYDDPKYLVKIPKSIEDIGILAQPLADIEKSIEEILEVQK 161

Query: 182 --------GVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATH 233
                            +                         +           +  T 
Sbjct: 162 RVPVWTCDDGTLNCRKVLVVGTGPIGVLFTLLFRTYGLEVWMANRREPTEVEQTVIEETK 221

Query: 234 TINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPG--AE 291
           T      +  +K+K   G        T   V +       L  NG +GL G    G    
Sbjct: 222 TNYYNSSNGYDKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPL 281

Query: 292 ATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWR-QGKFPIEKLV-RTYPLEHINDA 349
               +   +        ++ G           +  W+       + L+ +T  +    + 
Sbjct: 282 DYKTLQEIVHTNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKEL 341

Query: 350 FA--DSASGEVIKPIITF 365
                      IK  I +
Sbjct: 342 LKVLREKEHGEIKIRILW 359


>2cdbB [x.x.x] GLUCOSE DEHYDROGENASE GLUCOSE 1-DEHYDROGENASE,
          Length = 359

 Score =  105 bits (261), Expect = 3e-25
 Identities = 46/368 (12%), Positives = 84/368 (22%), Gaps = 19/368 (5%)

Query: 5   AAIVRATKQPFEIATIDL-DEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXX 63
           A IV+      ++  +D        ++++R I  G+C  D  + +               
Sbjct: 3   AIIVKPPNAGVQVKDVDEKKLDSYGKIKIRTIYNGICGADREIVNGKLGKD-FLVLGHEA 61

Query: 64  XXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAF 123
                              V      CG C  CL G+P +CE          + DG    
Sbjct: 62  IGVVEESYHGFSQGDLVMPVNRRG--CGICRNCLVGRPDFCETGEFGEAGIHKMDGFMRE 119

Query: 124 SEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGV 183
               +          +  +   ++                                  G 
Sbjct: 120 WWYDDPK-YLVKIPKSIEDIGILA-------QPLADIEKSIEEILEVQKRVPVWTCDDGT 171

Query: 184 RAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPA 243
                V V G                       +           +  T T      +  
Sbjct: 172 LNCRKVLVVGTGPIGVLFTLLFRTYGLEVWM-ANRREPTEVEQTVIEETKTNYYNSSNGY 230

Query: 244 EKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPG--AEATFEVGASLV 301
           +K+K   G        T   V +       L  NG +GL G    G        +   + 
Sbjct: 231 DKLKDSVGKFDVIIDATGADVNILGNVIPLLGRNGVLGLFGFSTSGSVPLDYKTLQEIVH 290

Query: 302 RGWKFQTIIEGDAVPQDFIPRLVHLWR-QGKFPIEKLV-RTYPLEHINDAFA--DSASGE 357
                  ++ G           +  W+       + L+ +T  +    +           
Sbjct: 291 TNKTIIGLVNGQKPHFQQAVVHLASWKTLYPKAAKMLITKTVSINDEKELLKVLREKEHG 350

Query: 358 VIKPIITF 365
            IK  I +
Sbjct: 351 EIKIRILW 358


>2c0cA [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
          Length = 353

 Score =  102 bits (254), Expect = 2e-24
 Identities = 57/375 (15%), Positives = 97/375 (25%), Gaps = 69/375 (18%)

Query: 11  TKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXXXXXXXXXXXXX 70
            +         +  P   ++ VR    GV  +D       Y                   
Sbjct: 28  REAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDP----------------- 70

Query: 71  XXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFSEDGEQV 130
                         +GF   G+ +                         ++A    G+ V
Sbjct: 71  -------SVKPPFDIGFEGIGEVVAL--------------------GLSASARYTVGQAV 103

Query: 131 GSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVRAGDTVA 190
              +    +FA YT V A     V                +T   ++    G+  G  V 
Sbjct: 104 --AYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSG--TTAYISLKELGGLSEGKKVL 159

Query: 191 VFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLT 250
           V                            + +    K LG    IN K E     +KQ  
Sbjct: 160 VTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEY 219

Query: 251 GDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGASLVRGWKFQTII 310
            +GV    ++ G  A+   A D+LA  G + ++G    G +    +          + + 
Sbjct: 220 PEGVDVVYESVG-GAMFDLAVDALATKGRLIVIGFI-SGYQTPTGLSPVKAGTLPAKLLK 277

Query: 311 -----------EGDAVPQDFIPRLVHLWRQGKFPIEKLV-------RTYPLEHINDAFAD 352
                         +  Q  +  L+ +   G    E  +       R   LE I  A   
Sbjct: 278 KSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFTGLESIFRAVNY 337

Query: 353 SASGEVI-KPIITFP 366
              G+   K ++  P
Sbjct: 338 MYMGKNTGKIVVELP 352


>2c0cB [x.x.x] ZINC BINDING ALCOHOL DEHYDROGENASE, DOMAIN
          Length = 342

 Score = 97.4 bits (241), Expect = 6e-23
 Identities = 57/386 (14%), Positives = 97/386 (25%), Gaps = 74/386 (19%)

Query: 5   AAIVRATKQP-----FEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLPXXX 59
             +V                  +  P   ++ VR    GV  +D       Y        
Sbjct: 6   KLVVTRLSPNFREAVTLSRDCPVPLPGDGDLLVRNRFVGVNASDINYSAGRYDP------ 59

Query: 60  XXXXXXXXXXXXXXXXXXKPDDKVVLGFNSCGQCLKCLGGKPAYCEKFYDRNFACTRDDG 119
                                    +GF   G+ +                         
Sbjct: 60  ------------------SVKPPFDIGFEGIGEVVAL--------------------GLS 81

Query: 120 STAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILN 179
           ++A    G+     +    +FA YT V A     V                +  +     
Sbjct: 82  ASARYTVGQ--AVAYMAPGSFAEYTVVPASIATPVPSVKPEYLTLLVSGTTAYISLK--E 137

Query: 180 SLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
             G+  G  V V                            + +    K LG    IN K 
Sbjct: 138 LGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKT 197

Query: 240 EDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGAS 299
           E     +KQ   +GV    ++ G  A+   A D+LA  G + ++G    G +    +   
Sbjct: 198 EPVGTVLKQEYPEGVDVVYESVG-GAMFDLAVDALATKGRLIVIGFI-SGYQTPTGLSPV 255

Query: 300 LVRGWKFQTIIEGDAV-----------PQDFIPRLVHLWRQGKFPIEKLV-------RTY 341
                  + + +  +V            Q  +  L+ +   G    E  +       R  
Sbjct: 256 KAGTLPAKLLKKSASVQGFFLNHYLSKYQAAMSHLLEMCVSGDLVCEVDLGDLSPEGRFT 315

Query: 342 PLEHINDAFADSASGEVI-KPIITFP 366
            LE I  A      G+   K ++  P
Sbjct: 316 GLESIFRAVNYMYMGKNTGKIVVELP 341


>2dg2A [x.x.x] APOLIPOPROTEIN A-I BINDING PROTEIN
          Length = 227

 Score = 87.2 bits (215), Expect = 7e-20
 Identities = 17/230 (7%), Positives = 41/230 (17%), Gaps = 20/230 (8%)

Query: 136 GQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVRAGDTVAVF--- 192
              +      V      +    V             T           ++  TV V    
Sbjct: 3   KYLSQEEAQAVDQELFNEYQFSVDQLELAGLSCA--TAIAKAYPPTSSKSPPTVLVICGP 60

Query: 193 GXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGD 252
           G                               +   L      +           +   +
Sbjct: 61  GNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKDIPFLGE---PPEPVDE 117

Query: 253 GVQFALDTTGVVAVTR--------QAADSLAINGTVGLVGAPAPGAEATFEVGASLVRGW 304
             +  +D     +             +    +   +  +  P  G +      + +    
Sbjct: 118 LYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIP-SGWDVEKGNPSGIQPDL 176

Query: 305 KFQTIIEGDAVPQDFIPRLVHLWRQGKFPIEKLVRTYPLEHINDAFADSA 354
               I               + +  G+F    L + Y L   +    +  
Sbjct: 177 ---LISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECV 223


>1ch6A [x.x.x] GLUTAMATE DEHYDROGENASE
          Length = 496

 Score = 67.9 bits (164), Expect = 5e-14
 Identities = 10/175 (5%), Positives = 26/175 (14%), Gaps = 19/175 (10%)

Query: 1   MQTLAAIVRATKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAI-------------VR 47
              +  I+R  K    + ++     R D     +      H+                  
Sbjct: 37  RNRVRGILRIIKPCNHVLSLSFPIRRDDGSWEVIEGYRAQHSHQRTPCKGGIRYSTDVSV 96

Query: 48  DQIYPTFLPXXXXXXXXXXXXXXXXXXXXXKPDDKVVLGFN-SCGQCLKCLGGKPAYCEK 106
           D++                            P +           +    L  K      
Sbjct: 97  DEVKALASLMTYKCAVVDVPFGGAKAGVKINPKNYTDEDLEKITRRFTMELAKKGFIGPG 156

Query: 107 F----YDRNFACTRDDGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDD 157
                 + +                          +              ++   
Sbjct: 157 VDVPAPNMSTGEREMSWIADTYASTIGHY-DINAHACVTGKPISQGGIHGRISAT 210


>2ebjA [x.x.x] PYRROLIDONE CARBOXYL PEPTIDASE
          Length = 192

 Score = 63.3 bits (153), Expect = 1e-12
 Identities = 11/175 (6%), Positives = 31/175 (17%), Gaps = 9/175 (5%)

Query: 132 SHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVRAGDTVAV 191
           + F    +  +  + +   ++  + D                  A+ +         + +
Sbjct: 5   TGFEPFGSLEHNPSQALLDLLPSEVDGKPLRKAVLPVDAEALGEALEDLHREGPKAVLHL 64

Query: 192 FGXXXXXXXXXXXXXXXXXXXXXXV-DIHNSRLEMAKELGATHTINSKDEDPAEKIKQLT 250
                                                  G           P + +    
Sbjct: 65  GLAEDRPVLTLERLAVNLLDFPRPDNRGRVLEDLPIVPGGPLA---LPARFPVKPVLARW 121

Query: 251 -GDGVQFALDTTGVVAVT----RQAADSLAINGTVGLVGAPAPGAEATFEVGASL 300
              G+      +    +       +   L     VG +  P     A       +
Sbjct: 122 REAGIPGRPSLSAGSYLCNQAFYLSLYRLPEEVPVGFLHLPPDETLALKRPRPYV 176


>2a33B [x.x.x] HYPOTHETICAL PROTEIN
          Length = 170

 Score = 56.1 bits (135), Expect = 2e-10
 Identities = 15/165 (9%), Positives = 30/165 (18%), Gaps = 14/165 (8%)

Query: 171 STGAGAILNSLGVRAGDTVA------VFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLE 224
           S G  +      V  G+ +       V+G                      +      + 
Sbjct: 14  SQGKKSSYQDAAVDLGNELVSRNIDLVYGGGSIGLGLVSQAVHDGGRHVIGIIPKGETVG 73

Query: 225 MAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVG 284
             + +             A          ++  L+      +          +  VGL+ 
Sbjct: 74  EVRAVADHQRKAEAKHSDAFIALPGGYGTLEELLEVITWAQLGIH-------DKPVGLLN 126

Query: 285 APAPGAEATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLWRQ 329
                           V             V       LV    +
Sbjct: 127 VDGYYNS-LLSFIDKAVEEGFISPTAREIIVSAPTAKELVKKLEE 170


>1dl5B [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
          Length = 316

 Score = 49.3 bits (116), Expect = 2e-08
 Identities = 19/193 (9%), Positives = 38/193 (19%), Gaps = 3/193 (1%)

Query: 127 GEQVGSHFFG--QSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVR 184
            + +   F    +  F   +   +     +                 +     +  +G+ 
Sbjct: 15  SDHIAKAFLEIPREEFLTKSYPLSYVYEDIVLVSYDDGEEYSTSSQPSLMALFMEWVGLD 74

Query: 185 AGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPAE 244
            G  V   G                      V+      E+AK       I +      +
Sbjct: 75  KGMRVLEIGGGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFVCGD 134

Query: 245 KIKQLTGDG-VQFALDTTGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGASLVRG 303
               +           T GV  V       L   G V +             +       
Sbjct: 135 GYYGVPEFSPYDVIFVTVGVDEVPETWFTQLKEGGRVIVPINLKLSRRQPAFLFKKKDPY 194

Query: 304 WKFQTIIEGDAVP 316
                 +E   + 
Sbjct: 195 LVGNYKLETRFIT 207


>1dlgA [d.68.2] UDP-N-ACETYLGLUCOSAMINE ENOLPYRUVYL TRANSFERASE
          Length = 418

 Score = 49.2 bits (116), Expect = 2e-08
 Identities = 11/145 (7%), Positives = 31/145 (21%), Gaps = 6/145 (4%)

Query: 216 VDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLA 275
                +   + +  G  + +     +    +      G +                  L 
Sbjct: 208 GTDRITIEGVERLGGGVYRVLPDRIETGTFLVAAAISGGKIVCRNAQ-PDTLDAVLAKLR 266

Query: 276 INGTVGLVGAPAPGAEATFEVGASLVRGWKFQTIIEGDAVPQDFIPRLVHL-WRQGKFPI 334
             G     G        + ++     +    +T               +     +G   I
Sbjct: 267 EAGADIETGEDW----ISLDMHGKRPKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVI 322

Query: 335 EKLVRTYPLEHINDAFADSASGEVI 359
            + +      H+ +     A  E+ 
Sbjct: 323 TETIFENRFMHVPELIRMGAHAEIE 347



 Score = 36.9 bits (84), Expect = 9e-05
 Identities = 2/46 (4%), Positives = 9/46 (19%)

Query: 11 TKQPFEIATIDLDEPRPDEVQVRVIAAGVCHTDAIVRDQIYPTFLP 56
               ++ T    +     V +             +   +  +   
Sbjct: 50 IDTTMKLLTQLGTKVERGSVWIDASNVNNFSAPYDLVKTMRASIWA 95


>3c85C [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
          Length = 144

 Score = 46.4 bits (109), Expect = 1e-07
 Identities = 10/105 (9%), Positives = 24/105 (22%), Gaps = 2/105 (1%)

Query: 183 VRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDP 242
           +  G    +                        ++I     +  +  G        D   
Sbjct: 2   INPGHAQVLILGGRIGTGAYDELRARYGKISLGIEIREEAAQQHRSEGRNVISG--DATD 59

Query: 243 AEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPA 287
            +  +++   G    +         + A + L      G + A A
Sbjct: 60  PDFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYKGQIAAIA 104


>2bhtD [x.x.x] CYSTEINE SYNTHASE B
          Length = 284

 Score = 46.0 bits (108), Expect = 2e-07
 Identities = 17/194 (8%), Positives = 40/194 (20%), Gaps = 9/194 (4%)

Query: 132 SHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSL---GVRAGDT 188
               G +       +   +  +V                      I+ +     ++ GD 
Sbjct: 5   EQTIGNTPLVKLQRMGPDNGSEVWL--KLEGNNPAGSVDRAALSMIVEAEKRGRIKPGDV 62

Query: 189 VAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQ 248
           +                          + + + R    +  GA   +    +   E   +
Sbjct: 63  LIEATSGNTGIALAMIAALKGYRMK--LLMPDERRAAMRAYGAELIMEGARDLALEMANR 120

Query: 249 LTGDGVQFALDTTGVVAVTRQAADSLA--INGTVGLVGAPAPGAEATFEVGASLVRGWKF 306
             G  +    +     A        +     G +    +          V   +    K 
Sbjct: 121 GEGKLLDQFNNPDNPKAHYTTTGPEIWQQTGGRITHFVSSMGTTGTITGVSEFMREQSKP 180

Query: 307 QTIIEGDAVPQDFI 320
            TI+         I
Sbjct: 181 VTIVGLQPEEGSSI 194


>3c3pB [x.x.x] METHYLTRANSFERASE
          Length = 185

 Score = 45.4 bits (106), Expect = 3e-07
 Identities = 18/168 (10%), Positives = 32/168 (19%), Gaps = 3/168 (1%)

Query: 139 TFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSLGVRAGDTVAVFGXXXXX 198
               Y +        V                      +     ++    V V G     
Sbjct: 6   RIGAYLDGLLPEADPVVAAEQIARERNIPIVDRQTGRLLYLLARIKQPQLVVVPGDGLGC 65

Query: 199 XXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDG-VQFA 257
                            +D     +E A+ L     I+  +    + +    G   +   
Sbjct: 66  ASWWFARAISISSRVV-IDPDRDNVEHARRLHDNGLIDRVELQVGDPLGIAAGQRDIDIL 124

Query: 258 LDT-TGVVAVTRQAADSLAINGTVGLVGAPAPGAEATFEVGASLVRGW 304
            D      A   +    LA N  +  V A                   
Sbjct: 125 FDCDVFNGADVLERNRCLAKNALLIAVNALRREFNHHLSRRRDFFTTI 172


>3eeqB [x.x.x] PUTATIVE COBALAMIN BIOSYNTHESIS PROTEIN G
          Length = 304

 Score = 45.1 bits (105), Expect = 3e-07
 Identities = 12/175 (6%), Positives = 36/175 (20%), Gaps = 28/175 (16%)

Query: 216 VDIHNSRLEMAKELGATHTINSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSLA 275
             +   R+         +  N    + A     L  + +             +  +  ++
Sbjct: 118 TKLSIERIANILIAKIINPENIVKINAAL----LRDESICIDGINVNFPENIKVCSYIIS 173

Query: 276 INGTVGLVGAPAPGAEATF--------EVGASLVRGWKFQTIIEGDAVPQDFIPRLVHLW 327
           +                          +V    +R   ++ +   +   +          
Sbjct: 174 LRDKEYKDKIVVWLKPLKISIGIGSKKDVKMEEIRDGIYKVLERLNLKRERIGIIASIRE 233

Query: 328 R----------------QGKFPIEKLVRTYPLEHINDAFADSASGEVIKPIITFP 366
                            + +          P + + +  A  A G   K I+   
Sbjct: 234 EVKKIADEFNVRFRLVNEEEINNFMNPCLTPPKGVAEISALIAGGRNSKLILRKI 288


>3c85B [x.x.x] PUTATIVE GLUTATHIONE-REGULATED POTASSIUM-EFFLUX
          Length = 142

 Score = 42.6 bits (99), Expect = 2e-06
 Identities = 9/105 (8%), Positives = 24/105 (22%), Gaps = 2/105 (1%)

Query: 183 VRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDP 242
           +  G    +                        ++I     +  +  G         +  
Sbjct: 2   INPGHAQVLILGGRIGTGAYDELRARYGKISLGIEIREEAAQQHRSEGRNVISGDATDP- 60

Query: 243 AEKIKQLTGDGVQFALDTTGVVAVTRQAADSLAINGTVGLVGAPA 287
            +  +++   G    +         + A + L      G + A A
Sbjct: 61  -DFWERILDTGHVKLVLLAPHHQGNQTALEQLQRRNYKGQIAAIA 104


>2bhtB [x.x.x] CYSTEINE SYNTHASE B
          Length = 280

 Score = 40.9 bits (95), Expect = 6e-06
 Identities = 20/193 (10%), Positives = 41/193 (21%), Gaps = 11/193 (5%)

Query: 132 SHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAI---LNSLGVRAGDT 188
               G +       +   +  +V   +                  I        ++ GD 
Sbjct: 5   EQTIGNTPLVKLQRMGPDNGSEV--WLKLEGNNPAGSVDRAALSMIVEAEKRGRIKPGDV 62

Query: 189 VAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKDEDPAEKIKQ 248
           +                          + + ++R    +  GA     ++DE       +
Sbjct: 63  LIEAT--SGNTGIALAMIAALKGYRMKLLMPDNRRAAMRAYGAELIEGARDEMANRGEGK 120

Query: 249 LTGDGVQFALDTTGVVAVTRQAADSLA-INGTVGLVGAPAPGAEATFEVGASLVRGWKFQ 307
           L     QF          T    +      G +    +          V   +    K  
Sbjct: 121 LL---DQFNNPDNPKAHYTTTGPEIWQQTGGRITHFVSSMGTTGTITGVSEFMREQSKPV 177

Query: 308 TIIEGDAVPQDFI 320
           TI+         I
Sbjct: 178 TIVGLQPEEGSSI 190


>2eguA [x.x.x] CYSTEINE SYNTHASE
          Length = 271

 Score = 40.8 bits (95), Expect = 6e-06
 Identities = 14/158 (8%), Positives = 34/158 (21%), Gaps = 11/158 (6%)

Query: 125 EDGEQVGSHFFGQSTF---ANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAILNSL 181
                + +   G +         +  +  V    + +            +    A     
Sbjct: 3   RTVNSI-TELIGDTPAVKLNRIVDEDSADVYLKLEFMNPGSSVKDRIALAMIEAAEKAG- 60

Query: 182 GVRAGDTVAVF--GXXXXXXXXXXXXXXXXXXXXXXVDIHNSRLEMAKELGATHTINSKD 239
            ++ GDT+     G                        +   R  + +  GA   +    
Sbjct: 61  KLKPGDTIVEPTSGNTGIGLAMVAAAKGYKAVLVMPDTMSLERRNLLRAYGAELVLTPGA 120

Query: 240 EDPAEKIKQ----LTGDGVQFALDTTGVVAVTRQAADS 273
           +     I +    +   G         +V       D+
Sbjct: 121 QGMRGAIAKAEELVREHGYFMPTTGKEIVEQMGDQLDA 158


>2cqwA [x.x.x] SUSHI DOMAIN CONTAINING 2
          Length = 84

 Score = 40.0 bits (93), Expect = 1e-05
 Identities = 5/82 (6%), Positives = 12/82 (14%), Gaps = 25/82 (30%)

Query: 78  KPDDKVVLGF--NSCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFSEDGEQVGSHFF 135
           +   +  L     +C     C      YC +                             
Sbjct: 24  RCGAQDGLCSCHPTCSGLGTCCEDFLDYCLEILP-----------------------SSG 60

Query: 136 GQSTFANYTNVSARSVVKVDDD 157
                 ++     +        
Sbjct: 61  SMMGGKDFVVQHLKWTDPSGPS 82


>3e8wA [x.x.x] TAKEOUT-LIKE PROTEIN 1
          Length = 219

 Score = 39.9 bits (93), Expect = 1e-05
 Identities = 8/144 (5%), Positives = 30/144 (20%), Gaps = 11/144 (7%)

Query: 222 RLEMAKELGA--THTINSKDEDPAEKIKQLT-GDGVQFALDTTGVVAVTRQAADSLAING 278
           +  +  +     T   +         +     G       +    + V+    +  A   
Sbjct: 79  KKNIEVDFHLDATVKGHYTAGGRILILPITGDGQMKLKLKNIHIHLVVSY-EMEKDAEGV 137

Query: 279 TVGLVGAPAPGAEATFEVGASLVRGWKFQTIIEGDAVP---QDFIPRLVHLWRQGKFPIE 335
              +        +         +           D +         ++   + +    + 
Sbjct: 138 DHVIFKKYTVTFDVKDNA-QFGLTNLFNGNKELSDTMLTFLNQNWKQVSEEFGKP---VM 193

Query: 336 KLVRTYPLEHINDAFADSASGEVI 359
           +       ++I    A     E+ 
Sbjct: 194 EAAAKKIFKNIKHFLAKVPIAEIA 217


>3ci9B [x.x.x] HEAT SHOCK FACTOR-BINDING PROTEIN 1
          Length = 45

 Score = 39.3 bits (92), Expect = 2e-05
 Identities = 4/40 (10%), Positives = 10/40 (25%)

Query: 235 INSKDEDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSL 274
           +          ++Q+       +    G +       D L
Sbjct: 1   VQDLTSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDL 40


>3ci9A [x.x.x] HEAT SHOCK FACTOR-BINDING PROTEIN 1
          Length = 44

 Score = 37.8 bits (88), Expect = 5e-05
 Identities = 5/42 (11%), Positives = 11/42 (26%), Gaps = 2/42 (4%)

Query: 235 INSKD--EDPAEKIKQLTGDGVQFALDTTGVVAVTRQAADSL 274
              +D        ++Q+       +    G +       D L
Sbjct: 2   KTVQDLTSVVQTLLQQMQDKFQTISDQIIGRIDDMSSRIDDL 43


>2bryA [x.x.x] NEDD9 INTERACTING PROTEIN WITH CALPONIN HOMOLOGY
          Length = 479

 Score = 36.8 bits (83), Expect = 1e-04
 Identities = 7/75 (9%), Positives = 18/75 (24%), Gaps = 7/75 (9%)

Query: 81  DKVVLGFN-SCGQCLKCLGGKPAYCEKFYDRNFACTRDDGSTAFSEDGEQVGSHFFGQST 139
                        C   L      C              G  +     +   +++  +S 
Sbjct: 4   AHDHFETFVQAQLCQDVLSSFQGLCR------ALGVESGGGLSQYHKIKAQLNYWSAKSL 57

Query: 140 FANYTNVSARSVVKV 154
           +A     +++ V + 
Sbjct: 58  WAKLDKRASQPVYQQ 72


>3dwgB [x.x.x] CYSTEINE SYNTHASE B
          Length = 321

 Score = 33.6 bits (76), Expect = 0.001
 Identities = 13/126 (10%), Positives = 26/126 (20%), Gaps = 4/126 (3%)

Query: 118 DGSTAFSEDGEQVGSHFFGQSTFANYTNVSARSVVKVDDDVXXXXXXXXXXXXSTGAGAI 177
           D       +   VG                 R   K++D                   A 
Sbjct: 7   DSLLQALGNTPLVGLQRLSPRWDDGRDGPHVRLWAKLED-RNPTGSIKDRPAVRMIEQA- 64

Query: 178 LNSLGVRAGDTVAVFGXXXXXXXXXXXXXXXXXXXXXXVDIHNSR--LEMAKELGATHTI 235
                +R G T+                          +  + S    ++ +  GA    
Sbjct: 65  EADGLLRPGATILEPTSGNTGISLAMAARLKGYRLICVMPENTSVERRQLLELYGAQIIF 124

Query: 236 NSKDED 241
           ++ +  
Sbjct: 125 SAANTA 130


  Database: 95pdb09Oct16_0000
    Posted date:  Oct 27, 2009  4:27 PM
  Number of letters in database: 15,983,541
  Number of sequences in database:  66,450
  
Lambda     K      H
   0.336    0.145    0.473 

Gapped
Lambda     K      H
   0.267   0.0500    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 66450
Number of Hits to DB: 21,270,111
Number of extensions: 1276517
Number of successful extensions: 15029
Number of sequences better than 1.0e-03: 10
Number of HSP's gapped: 5905
Number of HSP's successfully gapped: 653
Length of database: 100,000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)